Contig-U10248-1
Contig ID Contig-U10248-1
Contig update 2002. 9.13
Contig sequence
>Contig-U10248-1 (Contig-U10248-1Q) /CSM_Contig/Contig-U10248-1Q.Seq.d
GTGTTTTTTGTGTACATATAAATAAATATATTAAAAAAATGAGTGATCCA
GATGTTTTTAAAATTTTATTAATTGGTGATTCAGCAGTTGGAAAAACATC
GTTATTATTAAGATTTACAGATCCCAATAATTTTCAAGAGACTTCAGTAA
ATATGACTAGCGTTGATTATAAAAATAAAAATATAACTATTGATGGAAGA
ACATTTAATTTACAAATTTGGGATACAGCAGGACAAGAGAGATTCAGAAC
AATTACATCATCTTTTTATAGAGGAGCACATGGTGTTTTAGTATGTTATG
ATGTCACTGATCAACTTACATATAATAACGTTGGGTTATGGATGCAAGAA
ATTCAAAGATATGGAGTACTTGGCGTTAGTGAGAGTTTGAGTTGGAAACA
AATGCGATCTCGAAGATAGAAAATTGGTTAATTAACGCTTCAATTGCCCA
AGAATACGCTGATATTCTCGGTATTCCATTCATTGAAACTTCTGCTACAA
CTGGTGTTAATGTAGAAGAGGCTTTCATGGCAATGGCAGATGAAATTTAT
AGAAATCATATAGGTGGCTCAAAACCTTCTGTTGTAAAACCAGTATGTGG
AAGTCCTCCCCGCACGAAAAAAAATATTTGCTAATTTTAAAGAAGAGTGG
ATAGAAGAAGCGCCGGGTTTTTGCCAATTGTTTTAATAGTTTTATATAAT
TGCAACATCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

Gap no gap
Contig length 773
Chromosome number (1..6, M) 6
Chromosome length 3595308
Start point 664521
End point 665262
Strand (PLUS/MINUS) PLUS
Number of clones 13
Number of EST 15
Link to clone list U10248
List of clone(s)

est1=SSG849E,-33,739
est2=VSD572F,1,493
est3=VSD572Z,1,449
est4=SSF791E,35,647
est5=SSC869E,43,641
est6=SSH468Z,50,642
est7=VFJ330Z,55,444
est8=SSF195Z,78,748
est9=VSD412Z,103,587
est10=SSA153F,116,584
est11=SSD504Z,192,641
est12=SSL425Z,303,641
est13=SSI569F,354,742
est14=SSE186F,450,643
est15=SSE186Z,645,774
Translated Amino Acid sequence
VFCVHINKYIKKMSDPDVFKILLIGDSAVGKTSLLLRFTDPNNFQETSVNMTSVDYKNKN
ITIDGRTFNLQIWDTAGQERFRTITSSFYRGAHGVLVCYDVTDQLTYNNVGLWMQEIQRY
GVLGVSESLSWKQMRSRR*kig*ltlqlpkntlifsvfhslklllqlvlm*krlswqwqm
kfieii*vaqnlll*nqyvevlparkkifanfkeewieeapgfcqlf**fyiiatskkkk
kkkkkkkkkkkkkkkkk


Translated Amino Acid sequence (All Frames)
Frame A:
vffvyi*inilkk*viqmflkfy*lviqqlekhryy*dlqipiifkrlq*i*laliikik
i*llmeehliykfgiqqdkrdseqlhhlfieehmvf*yvmmslinlhiitlgygckkfkd
meylalvrv*vgnkcdledrklvn*rfncprir*ysrysih*nfcynwc*crrgfhgngr
*nl*ksyrwlktfccktsmwkssphekkyllilkksg*kkrrvfancfnsfi*lqhqkkk
kkkkkkkkkkkkkkkkk


Frame B:
cflctyk*iy*kne*srcf*nfinw*fsswkniviikiyrsq*fsrdfskyd*r*l*k*k
yny*wkni*ftnlgysrtreiqnnyiifl*rstwcfsml*ch*styi**rwvmdarnski
wstwr**efeletnaiskienwlinasiaqeyadilgipfietsattgvnveeafmamad
eiyrnhiggskpsvvkpvcgspprtkknic*f*rrvdrrsagflpivlivlyncnikkkk
kkkkkkkkkkkkkkkkk


Frame C:
VFCVHINKYIKKMSDPDVFKILLIGDSAVGKTSLLLRFTDPNNFQETSVNMTSVDYKNKN
ITIDGRTFNLQIWDTAGQERFRTITSSFYRGAHGVLVCYDVTDQLTYNNVGLWMQEIQRY
GVLGVSESLSWKQMRSRR*kig*ltlqlpkntlifsvfhslklllqlvlm*krlswqwqm
kfieii*vaqnlll*nqyvevlparkkifanfkeewieeapgfcqlf**fyiiatskkkk
kkkkkkkkkkkkkkkkk


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U10248-1 (Contig-U10248-1Q)
/CSM_Contig/Contig-U10248-1Q.Seq.d
(773 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U10248-1 (Contig-U10248-1Q) /CSM_Contig/Conti... 1316 0.0
Contig-U12243-1 (Contig-U12243-1Q) /CSM_Contig/Conti... 88 2e-17
Contig-U14029-1 (Contig-U14029-1Q) /CSM_Contig/Conti... 84 3e-16
Contig-U12705-1 (Contig-U12705-1Q) /CSM_Contig/Conti... 54 2e-07
Contig-U05483-1 (Contig-U05483-1Q) /CSM_Contig/Conti... 40 0.003
Contig-U04090-1 (Contig-U04090-1Q) /CSM_Contig/Conti... 40 0.003
Contig-U13241-1 (Contig-U13241-1Q) /CSM_Contig/Conti... 38 0.014
Contig-U11106-1 (Contig-U11106-1Q) /CSM_Contig/Conti... 38 0.014
Contig-U11038-1 (Contig-U11038-1Q) /CSM_Contig/Conti... 38 0.014
Contig-U09516-1 (Contig-U09516-1Q) /CSM_Contig/Conti... 38 0.014

>Contig-U10248-1 (Contig-U10248-1Q) /CSM_Contig/Contig-U10248-1Q.Seq.d
Length = 773

Score = 1316 bits (664), Expect = 0.0
Identities = 694/709 (97%)
Strand = Plus / Plus


Query: 1 gtgttttttgtgtacatataaataaatatattnnnnnnntgagtgatccagatgttttta 60
|||||||||||||||||||||||||||||||| |||||||||||||||||||||
Sbjct: 1 gtgttttttgtgtacatataaataaatatattaaaaaaatgagtgatccagatgttttta 60


Query: 61 aaattttattaattggtgattcagcagttggaaaaacatcgttattattaagatttacag 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 aaattttattaattggtgattcagcagttggaaaaacatcgttattattaagatttacag 120


Query: 121 atcccaataattttcaagagacttcagtaaatatgactagcgttgattataaaaataaaa 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 atcccaataattttcaagagacttcagtaaatatgactagcgttgattataaaaataaaa 180


Query: 181 atataactattgatggaagaacatttaatttacaaatttgggatacagcaggacaagaga 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 atataactattgatggaagaacatttaatttacaaatttgggatacagcaggacaagaga 240


Query: 241 gattcagaacaattacatcatctttttatagaggagcacatggtgttttagtatgttatg 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gattcagaacaattacatcatctttttatagaggagcacatggtgttttagtatgttatg 300


Query: 301 atgtcactgatcaacttacatataataacgttgggttatggatgcaagaaattcaaagat 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 atgtcactgatcaacttacatataataacgttgggttatggatgcaagaaattcaaagat 360


Query: 361 atggagtacttggcgttagtgagagtttgagttggaaacaaatgcgatctcgaagataga 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 atggagtacttggcgttagtgagagtttgagttggaaacaaatgcgatctcgaagataga 420


Query: 421 aaattggttaattaacgcttcaattgcccaagaatacgctgatattctcggtattccatt 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aaattggttaattaacgcttcaattgcccaagaatacgctgatattctcggtattccatt 480


Query: 481 cattgaaacttctgctacaactggtgttaatgtagaagaggctttcatggcaatggcaga 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 cattgaaacttctgctacaactggtgttaatgtagaagaggctttcatggcaatggcaga 540


Query: 541 tgaaatttatagaaatcatataggtggctcaaaaccttctgttgtaaaaccagtatgtgg 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 tgaaatttatagaaatcatataggtggctcaaaaccttctgttgtaaaaccagtatgtgg 600


Query: 601 aagtcctccccgcacgnnnnnnnntatttgctaattttaaagaagagtggatagaagaag 660
|||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 601 aagtcctccccgcacgaaaaaaaatatttgctaattttaaagaagagtggatagaagaag 660


Query: 661 cgccgggtttttgccaattgttttaatagttttatataattgcaacatc 709
|||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 cgccgggtttttgccaattgttttaatagttttatataattgcaacatc 709


>Contig-U12243-1 (Contig-U12243-1Q) /CSM_Contig/Contig-U12243-1Q.Seq.d
Length = 1637

Score = 87.7 bits (44), Expect = 2e-17
Identities = 71/80 (88%)
Strand = Plus / Plus


Query: 205 ttaatttacaaatttgggatacagcaggacaagagagattcagaacaattacatcatctt 264
|||| |||||||| |||||||| ||||||||||| ||||||||||||||||||||||| |
Sbjct: 1051 ttaaattacaaatctgggatactgcaggacaagaaagattcagaacaattacatcatcat 1110


Query: 265 tttatagaggagcacatggt 284
|||| | || |||||||||
Sbjct: 1111 attatcgtggtgcacatggt 1130


Score = 52.0 bits (26), Expect = 9e-07
Identities = 26/26 (100%)
Strand = Plus / Plus


Query: 338 atggatgcaagaaattcaaagatatg 363
||||||||||||||||||||||||||
Sbjct: 1184 atggatgcaagaaattcaaagatatg 1209


>Contig-U14029-1 (Contig-U14029-1Q) /CSM_Contig/Contig-U14029-1Q.Seq.d
Length = 895

Score = 83.8 bits (42), Expect = 3e-16
Identities = 54/58 (93%)
Strand = Plus / Plus


Query: 205 ttaatttacaaatttgggatacagcaggacaagagagattcagaacaattacatcatc 262
|||| ||||||||||||||||| ||||||||||| ||||| |||||||||||||||||
Sbjct: 212 ttaaattacaaatttgggatactgcaggacaagaaagatttagaacaattacatcatc 269


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 17,413
Number of Sequences: 6905
Number of extensions: 17413
Number of successful extensions: 2971
Number of sequences better than 10.0: 474
length of query: 773
length of database: 5,674,871
effective HSP length: 16
effective length of query: 757
effective length of database: 5,564,391
effective search space: 4212243987
effective search space used: 4212243987
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.11.18
Homology vs DNA
Query= Contig-U10248-1 (Contig-U10248-1Q) /CSM_Contig/Contig-U10248-1Q.Seq.d
(773 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(C92753) Dictyostelium discoideum slug cDNA, clone SSF195. 585 0.0 6
(C89790) Dictyostelium discoideum slug cDNA, clone SSG849. 391 0.0 6
(C93090) Dictyostelium discoideum slug cDNA, clone SSF791. 377 0.0 4
(C93969) Dictyostelium discoideum slug cDNA, clone SSC869. 377 0.0 4
(AU038248) Dictyostelium discoideum slug cDNA, clone SSH468. 377 0.0 4
(AU264263) Dictyostelium discoideum vegetative cDNA clone:VS... 367 e-178 5
(AU264264) Dictyostelium discoideum vegetative cDNA clone:VS... 377 e-174 4
(AU263986) Dictyostelium discoideum vegetative cDNA clone:VS... 377 e-154 5
(C24651) Dictyostelium discoideum slug cDNA, clone SL-X053. 472 e-151 2
(BJ432673) Dictyostelium discoideum cDNA clone:ddv19l07, 3' ... 377 e-150 3
(AU037344) Dictyostelium discoideum slug cDNA, clone SSD504. 224 e-121 3
(AU038742) Dictyostelium discoideum slug cDNA, clone SSL425. 188 5e-93 3
(AU073381) Dictyostelium discoideum slug cDNA, clone SSG849. 307 3e-79 1
(AU072322) Dictyostelium discoideum slug cDNA, clone SSE186. 188 2e-43 1
(C93909) Dictyostelium discoideum slug cDNA, clone SSL855. 88 1e-27 3
(C93260) Dictyostelium discoideum slug cDNA, clone SSM886. 88 1e-27 3
(C93756) Dictyostelium discoideum slug cDNA, clone SSL682. 88 1e-27 3
(C92440) Dictyostelium discoideum slug cDNA, clone SSE547. 88 1e-27 3
(C93305) Dictyostelium discoideum slug cDNA, clone SSM603. 88 1e-27 3
(AU038347) Dictyostelium discoideum slug cDNA, clone SSH594. 88 1e-27 3
(C90430) Dictyostelium discoideum slug cDNA, clone SSI475. 88 1e-27 3
(BJ430080) Dictyostelium discoideum cDNA clone:ddv6c03, 3' e... 88 1e-27 3
(AU071405) Dictyostelium discoideum slug cDNA, clone SSB423. 88 1e-27 3
(AU071406) Dictyostelium discoideum slug cDNA, clone SSB424. 88 1e-27 3
(C93700) Dictyostelium discoideum slug cDNA, clone SSL623. 76 4e-24 3
(L21010) Dictyostelium discoideum Rab1B mRNA, 3' end of cds. 52 1e-16 3
(EE671325) SAAH-aac56f11.g1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EC617428) SAAH-aaa40d06.g1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EE666041) SAAH-aab55g07.g1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EG413517) SAAH-aab11d02.b1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EG409726) SAAH-aaa40d06.b1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EG416999) SAAH-aab55g07.b1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EE282655) SAAH-aab11d02.g1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EG412200) SAAH-aaa93a01.b1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(EE281430) SAAH-aaa93a01.g1 Agen 0058 Schmidtea mediterranea... 78 1e-15 2
(CX093712) EHAFO92TR E. histolytica Normalized cDNA library ... 68 8e-15 2
(CX096754) EHAGW91TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX095550) EHAGF29TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX089606) EHAE145TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX087978) EHAD958TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX087205) EHACW03TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX087006) EHACT15TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX083514) EHABC79TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX083384) EHABA95TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX096532) EHAGT80TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX094558) EHAG093TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX089578) EHAE104TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX089231) EHADU91TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX089049) EHADR49TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX093218) EHAFH94TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX098528) EHAHN04TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX089366) EHADX32TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX099079) EHAHU93TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX099390) EHAHZ58TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX085209) EHAC232TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX087202) EHACV95TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX082060) EHAAR08TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX091347) EHAER18TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX089538) EHAE015TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX091910) EHAEZ32TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX086526) EHACL32TRB E. histolytica Normalized cDNA library... 68 1e-14 2
(CX085802) EHACA63TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(AB054578) Entamoeba histolytica EhRab1A mRNA for small GTPa... 68 1e-14 2
(CX085623) EHAC819TR E. histolytica Normalized cDNA library ... 68 1e-14 2
(CX087103) EHACU61TR E. histolytica Normalized cDNA library ... 68 2e-14 2
(CX094135) EHAFU88TR E. histolytica Normalized cDNA library ... 68 3e-14 2
(CX083995) EHABK22TR E. histolytica Normalized cDNA library ... 68 4e-14 2
(DN302017) PL04024A2H01 cDNA from sexually mature hermaphodi... 70 2e-13 2
(EC615581) SAAH-aaa66h03.g1 Agen 0058 Schmidtea mediterranea... 70 2e-13 2
(DN313077) PL06014B1F11 cDNA from juvenile hermaphodites Sch... 70 2e-13 2
(DN308618) PL05017A1F04 cDNA from sexually mature hermaphodi... 70 2e-13 2
(DN314465) PL06018A2F09 cDNA from juvenile hermaphodites Sch... 70 2e-13 2
(EG350396) SAAH-aad11e09.g1 Agen 0058 Schmidtea mediterranea... 70 2e-13 2
(EE672460) SAAH-aab74f01.g1 Agen 0058 Schmidtea mediterranea... 70 2e-13 2
(EG351240) SAAH-aad16g09.g1 Agen 0058 Schmidtea mediterranea... 70 2e-13 2
(EG348194) SAAH-aac84f09.g1 Agen 0058 Schmidtea mediterranea... 70 2e-13 2
(EC618058) SAAH-aaa63g09.g1 Agen 0058 Schmidtea mediterranea... 70 2e-13 2
(DN312681) PL06013B1D07 cDNA from juvenile hermaphodites Sch... 70 2e-13 2
(EG347207) SAAH-aaa75a09.g1 Agen 0058 Schmidtea mediterranea... 70 2e-13 2
(EG351239) SAAH-aad16g09.b1 Agen 0058 Schmidtea mediterranea... 68 9e-13 2
(L21009) Dictyostelium discoideum Rab1A mRNA, complete cds. 84 9e-12 1
(AU270410) Dictyostelium discoideum vegetative cDNA clone:VS... 84 9e-12 1
(AU061016) Dictyostelium discoideum slug cDNA, clone SLC626. 84 9e-12 1
(BJ331981) Dictyostelium discoideum cDNA clone:dda37f20, 5' ... 84 9e-12 1
(C89695) Dictyostelium discoideum slug cDNA, clone SSA695. 66 1e-11 2
(EE722787) camnoP089E11 camno Biomphalaria glabrata cDNA clo... 62 2e-11 3
(EE723373) campoP091F06 campo Biomphalaria glabrata cDNA clo... 62 2e-11 3
(AU284822) Dictyostelium discoideum gamete cDNA clone:FC-BM0... 62 1e-10 2
(CX082008) EHAAQ33TR E. histolytica Normalized cDNA library ... 50 1e-10 3
(DN297967) PL04011A1H10 cDNA from sexually mature hermaphodi... 60 2e-10 2
(C90802) Dictyostelium discoideum slug cDNA, clone SSJ166. 44 3e-10 3
(DW089133) CLPY13252.b1_G02.ab1 CLP(XYZ) lettuce perennis La... 42 6e-10 3
(EC823893) SME00006668 esmbsro2 Sawyeria marylandensis cDNA,... 60 1e-09 3
(AU037699) Dictyostelium discoideum slug cDNA, clone SSE186. 76 2e-09 1
(AJ765704) Gerbera hybrid cv. 'Terra Regina' EST, clone G000... 48 3e-09 4
(AJ765567) Gerbera hybrid cv. 'Terra Regina' EST, clone G000... 48 3e-09 4
(AM821874) Nicotiana tabacum EST, clone nt005170041. 74 9e-09 1
(AJ750252) Gerbera hybrid cv. 'Terra Regina' EST, clone G000... 48 9e-09 4
(DW113074) CLRY1165.b1_I03.ab1 CLR(XYZ) lettuce serriola Lac... 48 9e-09 4
(AJ759762) Gerbera hybrid cv. 'Terra Regina' EST, clone G000... 48 9e-09 4

>(C92753) Dictyostelium discoideum slug cDNA, clone SSF195.
Length = 666

Score = 585 bits (295), Expect(6) = 0.0
Identities = 301/303 (99%)
Strand = Plus / Plus


Query: 78 gattcagcagttggaaaaacatcgttattattaagatttacagatcccaataattttcaa 137
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 gattcagcagttggaaaaacatcgttattattaagatttacagatcccaataattttcaa 60


Query: 138 gagacttcagtaaatatgactagcgttgattataaaaataaaaatataactattgatgga 197
||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 61 gagacttcagtaaatatgactagtgttgattataaaaataaaaatataactattgatgga 120


Query: 198 agaacatttaatttacaaatttgggatacagcaggacaagagagattcagaacaattaca 257
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 agaacatttaatttacaaatttgggatacagcaggacaagagagattcagaacaattaca 180


Query: 258 tcatctttttatagaggagcacatggtgttttagtatgttatgatgtcactgatcaactt 317
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tcatctttttatagaggagcacatggtgttttagtatgttatgatgtcactgatcaactt 240


Query: 318 acatataataacgttgggttatggatgcaagaaattcaaagatatggagtacttggcgtt 377
|||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||
Sbjct: 241 acatataataacgttgggttatggatgcaagaaattcaaagatatggagtacttggagtt 300


Query: 378 agt 380
|||
Sbjct: 301 agt 303

Score = 367 bits (185), Expect(6) = 0.0
Identities = 185/185 (100%)
Strand = Plus / Plus


Query: 432 ttaacgcttcaattgcccaagaatacgctgatattctcggtattccattcattgaaactt 491
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 350 ttaacgcttcaattgcccaagaatacgctgatattctcggtattccattcattgaaactt 409


Query: 492 ctgctacaactggtgttaatgtagaagaggctttcatggcaatggcagatgaaatttata 551
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 410 ctgctacaactggtgttaatgtagaagaggctttcatggcaatggcagatgaaatttata 469


Query: 552 gaaatcatataggtggctcaaaaccttctgttgtaaaaccagtatgtggaagtcctcccc 611
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 470 gaaatcatataggtggctcaaaaccttctgttgtaaaaccagtatgtggaagtcctcccc 529


Query: 612 gcacg 616
|||||
Sbjct: 530 gcacg 534

Score = 83.8 bits (42), Expect(6) = 0.0
Identities = 48/50 (96%)
Strand = Plus / Plus


Query: 382 agagtttgagttggaaacaaatgcgatctcgaagatagaaaattggttaa 431
||||||| ||||||||||||||| ||||||||||||||||||||||||||
Sbjct: 304 agagttttagttggaaacaaatgtgatctcgaagatagaaaattggttaa 353

Score = 71.9 bits (36), Expect(6) = 0.0
Identities = 36/36 (100%)
Strand = Plus / Plus


Query: 625 tatttgctaattttaaagaagagtggatagaagaag 660
||||||||||||||||||||||||||||||||||||
Sbjct: 543 tatttgctaattttaaagaagagtggatagaagaag 578

Score = 36.2 bits (18), Expect(6) = 0.0
Identities = 21/22 (95%)
Strand = Plus / Plus


Query: 665 gggtttttgccaattgttttaa 686
||||||||||||||| ||||||
Sbjct: 581 gggtttttgccaattattttaa 602

Score = 36.2 bits (18), Expect(6) = 0.0
Identities = 21/22 (95%)
Strand = Plus / Plus


Query: 688 agttttatataattgcaacatc 709
||||| ||||||||||||||||
Sbjct: 603 agtttcatataattgcaacatc 624

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 933,736,837
Number of extensions: 65320813
Number of successful extensions: 6633307
Number of sequences better than 10.0: 4152
Length of query: 773
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 749
Effective length of database: 97,308,875,965
Effective search space: 72884348097785
Effective search space used: 72884348097785
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 6.27
Homology vs Protein
Query= Contig-U10248-1 (Contig-U10248-1Q) /CSM_Contig/Contig-U10248-1Q.Seq.d
(773 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(Q54E92) RecName: Full=Ras-related protein RabG1; 231 5e-99
(P34140) RecName: Full=Ras-related protein Rab-1B; 140 3e-44
EF103367_1(EF103367|pid:none) Haliotis discus discus Ras-related... 140 1e-42
BT057068_1(BT057068|pid:none) Salmo salar clone ssal-eve-570-039... 140 1e-42
BC097013_1(BC097013|pid:none) Danio rerio zgc:86773, mRNA (cDNA ... 139 1e-42
BT059700_1(BT059700|pid:none) Salmo salar clone ssal-rgf-002-342... 140 3e-42
(Q05974) RecName: Full=Ras-related protein Rab-1A; &S38339(S383... 140 5e-42
DQ214474_1(DQ214474|pid:none) Taeniopygia guttata clone 0063P003... 140 9e-42
(P62820) RecName: Full=Ras-related protein Rab-1A; AltName: Full... 140 9e-42
AL606522_3(AL606522|pid:none) Mouse DNA sequence from clone RP23... 140 9e-42
(P22125) RecName: Full=Ras-related protein ORAB-1; &M38393_1(M3... 140 9e-42
L21010_1(L21010|pid:none) Dictyostelium discoideum Rab1B mRNA, 3... 134 1e-41
BC045014_1(BC045014|pid:none) Xenopus laevis RAB1, member RAS on... 140 1e-41
(Q52NJ2) RecName: Full=Ras-related protein Rab-1A; &AY996813_1(... 139 1e-41
AC183496_25(AC183496|pid:none) Brassica oleracea, *** SEQUENCING... 134 1e-41
AK151085_1(AK151085|pid:none) Mus musculus bone marrow macrophag... 139 2e-41
BT078127_1(BT078127|pid:none) Lepeophtheirus salmonis clone lsal... 139 2e-41
J02998_1(J02998|pid:none) Rat ras-related protein mRNA, clone NT... 140 3e-41
DQ214475_1(DQ214475|pid:none) Taeniopygia guttata clone 0058P004... 137 4e-41
BT077899_1(BT077899|pid:none) Lepeophtheirus salmonis clone lsal... 137 4e-41
AK129477_1(AK129477|pid:none) Mus musculus mRNA for mKIAA3012 pr... 137 6e-41
AF101310_4(AF101310|pid:none) Caenorhabditis elegans cosmid C39F... 141 6e-41
CR382124_213(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 141 6e-41
AF244545_1(AF244545|pid:none) Aspergillus awamori YptA (yptA) ge... 139 6e-41
BT077861_1(BT077861|pid:none) Lepeophtheirus salmonis clone lsal... 138 6e-41
BT076429_1(BT076429|pid:none) Caligus rogercresseyi clone crog-e... 140 7e-41
AJ278659_1(AJ278659|pid:none) Aspergillus niger srgB gene for a ... 139 7e-41
(Q9D1G1) RecName: Full=Ras-related protein Rab-1B; &AB232584_1(... 138 8e-41
(Q39571) RecName: Full=GTP-binding protein YPTC1; &DQ222936_1(D... 135 8e-41
AJ277108_1(AJ277108|pid:none) Trichoderma reesei ypt1 gene for s... 139 1e-40
D38625(D38625)GTP-binding protein o-rab1 - electric ray (Discopy... 140 1e-40
S06147(S06147;S03189)GTP-binding protein rab1B - rat 139 1e-40
(Q5RE13) RecName: Full=Ras-related protein Rab-1B; &(Q9H0U4) Re... 138 1e-40
CR533462_1(CR533462|pid:none) Homo sapiens full open reading fra... 138 1e-40
AK042020_1(AK042020|pid:none) Mus musculus 3 days neonate thymus... 137 1e-40
CR382130_329(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 138 2e-40
BT051367_1(BT051367|pid:none) Medicago truncatula clone MTYF1_F2... 134 2e-40
GN106077_1(GN106077|pid:none) Sequence 10858 from Patent WO20090... 134 2e-40
(Q2HJH2) RecName: Full=Ras-related protein Rab-1B; &BC105393_1(... 138 2e-40
AE017352_188(AE017352|pid:none) Cryptococcus neoformans var. neo... 142 2e-40
(P33723) RecName: Full=GTP-binding protein ypt1; &AL356324_15(A... 139 3e-40
GN106121_1(GN106121|pid:none) Sequence 10902 from Patent WO20090... 139 3e-40
EF146669_1(EF146669|pid:none) Populus trichocarpa clone WS01211_... 135 3e-40
AE014297_3082(AE014297|pid:none) Drosophila melanogaster chromos... 138 3e-40
(P10536) RecName: Full=Ras-related protein Rab-1B; &X13905_1(X1... 138 3e-40
Z73932_1(Z73932|pid:none) L.japonicus mRNA for small GTP-binding... 134 3e-40
EF086613_1(EF086613|pid:none) Picea sitchensis clone WS02920_I20... 133 4e-40
GN106013_1(GN106013|pid:none) Sequence 10794 from Patent WO20090... 134 4e-40
GN105983_1(GN105983|pid:none) Sequence 10764 from Patent WO20090... 134 5e-40
AC183493_34(AC183493|pid:none) Brassica oleracea Contig B, compl... 134 5e-40
GM977155_1(GM977155|pid:none) Sequence 63 from Patent WO20081456... 132 5e-40
GN105857_1(GN105857|pid:none) Sequence 10638 from Patent WO20090... 135 6e-40
Y08425_1(Y08425|pid:none) N.plumbaginifolia mRNA for small GTP-b... 135 6e-40
AM494964_85(AM494964|pid:none) Leishmania braziliensis chromosom... 128 6e-40
(P11620) RecName: Full=GTP-binding protein ypt1; &AL136536_10(A... 140 7e-40
D12548_1(D12548|pid:none) Pisum sativum mRNA for GTP-binding pro... 134 7e-40
AE016815_434(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 139 8e-40
DQ414556_1(DQ414556|pid:none) Suberites domuncula Rab1 gene, com... 135 8e-40
AJ810707_1(AJ810707|pid:none) Poa pratensis mRNA for RAB1-like (... 134 8e-40
AF013572_1(AF013572|pid:none) Bombyx mori small GTP-binding prot... 132 8e-40
AC140549_18(AC140549|pid:none) Medicago truncatula clone mth2-28... 133 1e-39
AP007162_533(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 139 1e-39
CP000497_244(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 138 1e-39
FM992688_325(FM992688|pid:none) Candida dubliniensis CD36 chromo... 138 1e-39
AF330211_1(AF330211|pid:none) Candida albicans small GTP-binding... 138 1e-39
AY060495_1(AY060495|pid:none) Arabidopsis thaliana AT4g17530/dl4... 132 1e-39
(P34139) RecName: Full=Ras-related protein Rab-1A; 137 2e-39
CU928171_789(CU928171|pid:none) Kluyveromyces thermotolerans str... 137 2e-39
BT070553_1(BT070553|pid:none) Picea sitchensis clone WS02735_N04... 137 2e-39
GM977161_1(GM977161|pid:none) Sequence 69 from Patent WO20081456... 135 2e-39
AC183498_22(AC183498|pid:none) Brassica oleracea, *** SEQUENCING... 134 3e-39
GN106103_1(GN106103|pid:none) Sequence 10884 from Patent WO20090... 127 3e-39
FN392321_231(FN392321|pid:none) Pichia pastoris GS115 chromosome... 139 3e-39
GN106155_1(GN106155|pid:none) Sequence 10936 from Patent WO20090... 134 3e-39
BT081293_1(BT081293|pid:none) Caligus clemensi clone ccle-evs-51... 133 3e-39
D12547_1(D12547|pid:none) Pisum sativum mRNA for GTP-binding pro... 130 3e-39
GM977167_1(GM977167|pid:none) Sequence 75 from Patent WO20081456... 127 3e-39
BT070586_1(BT070586|pid:none) Picea sitchensis clone WS02737_M21... 135 4e-39
EU284879_1(EU284879|pid:none) TSA: Elaeis guineensis EgEfMPOB000... 135 4e-39
GN105977_1(GN105977|pid:none) Sequence 10758 from Patent WO20090... 132 4e-39
L12031_1(L12031|pid:none) Leishmania major V121 GTP-binding prot... 126 4e-39
EF147099_1(EF147099|pid:none) Populus trichocarpa clone WS01227_... 129 4e-39
GN106117_1(GN106117|pid:none) Sequence 10898 from Patent WO20090... 134 5e-39
DQ397201_1(DQ397201|pid:none) Saccharum officinarum small GTP bi... 128 6e-39
GM977145_1(GM977145|pid:none) Sequence 53 from Patent WO20081456... 135 6e-39
(P40392) RecName: Full=Ras-related protein RIC1; &AK243597_1(AK... 135 6e-39
AF324990_1(AF324990|pid:none) Arabidopsis thaliana AT5g47200 (AT... 132 8e-39
GM977163_1(GM977163|pid:none) Sequence 71 from Patent WO20081456... 131 1e-38
EF144402_1(EF144402|pid:none) Populus trichocarpa clone PX0019_E... 135 1e-38
AF108883_1(AF108883|pid:none) Capsicum annuum small GTP-binding ... 134 1e-38
AK059888_1(AK059888|pid:none) Oryza sativa Japonica Group cDNA c... 134 1e-38
GN105859_1(GN105859|pid:none) Sequence 10640 from Patent WO20090... 134 1e-38
(Q92928) RecName: Full=Putative Ras-related protein Rab-1C; ... 131 1e-38
GN080089_1(GN080089|pid:none) Sequence 692 from Patent WO2009027... 134 1e-38
BT039522_1(BT039522|pid:none) Zea mays full-length cDNA clone ZM... 134 2e-38
AP008208_2028(AP008208|pid:none) Oryza sativa (japonica cultivar... 134 2e-38
S34253(S34253) GTP-binding protein, ras-related - common tobacco... 137 2e-38
AJ307662_21(AJ307662|pid:none) Oryza sativa genomic DNA fragment... 134 2e-38
GN105853_1(GN105853|pid:none) Sequence 10634 from Patent WO20090... 134 2e-38
(Q01890) RecName: Full=Ras-like GTP-binding protein YPT1; &JC53... 138 3e-38
GN106061_1(GN106061|pid:none) Sequence 10842 from Patent WO20090... 130 3e-38
GN106197_1(GN106197|pid:none) Sequence 10978 from Patent WO20090... 134 4e-38
GN106151_1(GN106151|pid:none) Sequence 10932 from Patent WO20090... 135 4e-38
BT034664_1(BT034664|pid:none) Zea mays full-length cDNA clone ZM... 134 4e-38
EF145603_1(EF145603|pid:none) Populus trichocarpa clone WS01126_... 135 5e-38
GM977157_1(GM977157|pid:none) Sequence 65 from Patent WO20081456... 134 5e-38
GN106059_1(GN106059|pid:none) Sequence 10840 from Patent WO20090... 133 5e-38
CS560194_1(CS560194|pid:none) Sequence 781 from Patent WO2006032... 134 6e-38
CS559708_1(CS559708|pid:none) Sequence 295 from Patent WO2006032... 134 6e-38
B86153(B86153) ARA-5 [imported] - Arabidopsis thaliana &U89959_... 134 8e-38
CP001323_241(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 133 8e-38
(P01123) RecName: Full=GTP-binding protein YPT1; AltName: Full=R... 133 9e-38
X00209_2(X00209|pid:none) Yeast YP2 gene The YP2 protein shows h... 133 9e-38
D01027_1(D01027|pid:none) Arabidopsis thaliana mRNA for small GT... 134 1e-37
D12549_1(D12549|pid:none) Pisum sativum mRNA for GTP-binding pro... 133 1e-37
GN106111_1(GN106111|pid:none) Sequence 10892 from Patent WO20090... 130 1e-37
DQ372931_1(DQ372931|pid:none) Pinus pinaster Rab1 mRNA, complete... 130 1e-37
AC159407_36(AC159407|pid:none) Trypanosoma brucei chromosome 8 c... 130 2e-37
CR380957_540(CR380957|pid:none) Candida glabrata strain CBS138 c... 133 2e-37
AC104285_6(AC104285|pid:none) Oryza sativa (japonica cultivar-gr... 135 2e-37
GN106165_1(GN106165|pid:none) Sequence 10946 from Patent WO20090... 133 2e-37
EF091876_1(EF091876|pid:none) Solanum tuberosum ras-related GTP ... 133 3e-37
GM977149_1(GM977149|pid:none) Sequence 57 from Patent WO20081456... 134 4e-37
AY321327_1(AY321327|pid:none) Rattus norvegicus Ac2-048 mRNA, co... 124 4e-37
Z73931_1(Z73931|pid:none) L.japonicus mRNA for small GTP-binding... 130 5e-37
BT071594_1(BT071594|pid:none) Picea sitchensis clone WS02926_J12... 129 7e-37
CP000587_71(CP000587|pid:none) Ostreococcus lucimarinus CCE9901 ... 126 7e-37
EU069503_1(EU069503|pid:none) Gymnochlora stellata Rab1B mRNA, c... 130 7e-37
BC150404_1(BC150404|pid:none) Danio rerio zgc:171927, mRNA (cDNA... 136 9e-37
BT052509_1(BT052509|pid:none) Medicago truncatula clone MTYFD_FE... 132 9e-37
GN105981_1(GN105981|pid:none) Sequence 10762 from Patent WO20090... 128 3e-36
GN080095_1(GN080095|pid:none) Sequence 698 from Patent WO2009027... 132 1e-35
GN080135_1(GN080135|pid:none) Sequence 738 from Patent WO2009027... 132 1e-35
L48181_1(L48181|pid:none) Brassica campestris L. pekinensis ypt-... 127 2e-35
(Q9ZRE2) RecName: Full=Ras-related protein RABD1; AltName: Full=... 127 2e-35
FN357538_13(FN357538|pid:none) Schistosoma mansoni genome sequen... 126 2e-35
DQ393575_1(DQ393575|pid:none) Metarhizium anisopliae RAB/GTPase ... 120 3e-34
AY223134_1(AY223134|pid:none) Schistosoma japonicum SJCHGC02833 ... 130 3e-34
AB241242_1(AB241242|pid:none) Symbiotic protist of Reticuliterme... 122 5e-34
AB054578_1(AB054578|pid:none) Entamoeba histolytica EhRab1A mRNA... 127 7e-34
FN320591_1(FN320591|pid:none) Schistosoma japonicum isolate Anhu... 130 7e-34
AB241243_1(AB241243|pid:none) Symbiotic protist of Reticuliterme... 127 2e-33
FN359283_3(FN359283|pid:none) Schistosoma mansoni genome sequenc... 125 1e-32
CR954205_238(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 115 2e-32
CR932686_1(CR932686|pid:none) Paramecium tetraurelia, Small GTPa... 124 2e-32
AB241241_1(AB241241|pid:none) Symbiotic protist of Reticuliterme... 121 2e-32
AF542024_1(AF542024|pid:none) Griffithsia japonica GTP-binding p... 134 2e-32
(P34141) RecName: Full=Ras-related protein RabA; 121 3e-32
L21011_1(L21011|pid:none) Dictyostelium discoideum RabA mRNA, 3'... 121 3e-32
FN315276_1(FN315276|pid:none) Schistosoma japonicum isolate Anhu... 123 3e-32
(P20790) RecName: Full=Ras-related protein Rab-8A; AltName: Full... 115 3e-32
AY324134_1(AY324134|pid:none) Babesia bovis Rab1a mRNA, complete... 121 1e-31
AC183495_42(AC183495|pid:none) Brassica oleracea Contig A, compl... 106 1e-31
AF389109_1(AF389109|pid:none) Entamoeba histolytica small GTP-bi... 112 2e-31
AM910992_200(AM910992|pid:none) Plasmodium knowlesi strain H chr... 124 2e-31
AY232027_1(AY232027|pid:none) Drosophila yakuba clone yak-ad_Rab... 138 2e-31
DQ286060_1(DQ286060|pid:none) Hydra vulgaris RAS related GTP-bin... 121 3e-31
(P20791) RecName: Full=Ras-related protein Rab-8B; AltName: Full... 112 3e-31
CR933412_1(CR933412|pid:none) Paramecium tetraurelia, Small GTPa... 122 5e-31
CR933446_1(CR933446|pid:none) Paramecium tetraurelia, Small GTPa... 122 6e-31
AC139707_26(AC139707|pid:none) Medicago truncatula clone mth2-16... 122 6e-31
BT076103_1(BT076103|pid:none) Caligus rogercresseyi clone crog-e... 112 8e-31
AL162751_30(AL162751|pid:none) Arabidopsis thaliana DNA chromoso... 120 8e-31
EF144772_1(EF144772|pid:none) Populus trichocarpa clone WS01118_... 120 8e-31
AB015475_6(AB015475|pid:none) Arabidopsis thaliana genomic DNA, ... 119 8e-31
BT070448_1(BT070448|pid:none) Picea sitchensis clone WS0272_O15 ... 115 1e-30
AY231907_1(AY231907|pid:none) Drosophila yakuba clone yak-em_Rab... 135 1e-30
DQ414563_1(DQ414563|pid:none) Suberites domuncula Rab10 gene, co... 117 1e-30
AY087058_1(AY087058|pid:none) Arabidopsis thaliana clone 3115 mR... 119 1e-30
GN106091_1(GN106091|pid:none) Sequence 10872 from Patent WO20090... 119 1e-30
GN106033_1(GN106033|pid:none) Sequence 10814 from Patent WO20090... 119 1e-30
S57478(S57478) GTP-binding protein GTP13 - garden pea &Z49902_1... 119 1e-30
CR932510_1(CR932510|pid:none) Paramecium tetraurelia, Small GTPa... 117 1e-30
GN105821_1(GN105821|pid:none) Sequence 10602 from Patent WO20090... 117 1e-30
DQ414573_1(DQ414573|pid:none) Suberites domuncula Rab35 gene, co... 121 2e-30
AB079020_1(AB079020|pid:none) Nicotiana tabacum mRNA for ras-rel... 119 2e-30
AC125368_16(AC125368|pid:none) Medicago truncatula clone mth2-13... 119 2e-30
CR932639_1(CR932639|pid:none) Paramecium tetraurelia, Small GTPa... 116 2e-30
DQ440351_1(DQ440351|pid:none) Aedes aegypti clone AET-452 RAB pr... 120 2e-30
DQ222937_1(DQ222937|pid:none) Chlamydomonas incerta YptC1 (yptC1... 107 2e-30
(O76173) RecName: Full=Ras-related protein Rab-1C; &AB015237_1(... 115 2e-30
AB241220_1(AB241220|pid:none) Pyrsonympha grandis RsSmRab1_1 mRN... 120 2e-30
(Q9TVU5) RecName: Full=Ras-related protein Rab-1; AltName: Full=... 124 2e-30
AB241230_1(AB241230|pid:none) Dinenympha exilis RsSmRab1_2 mRNA ... 121 2e-30
BC103436_1(BC103436|pid:none) Bos taurus RAB1A, member RAS oncog... 101 3e-30
(Q504M8) RecName: Full=Ras-related protein Rab-26; &AB232621_1(... 115 3e-30
GM977153_1(GM977153|pid:none) Sequence 61 from Patent WO20081456... 119 3e-30
AE017343_437(AE017343|pid:none) Cryptococcus neoformans var. neo... 120 3e-30
CR932696_1(CR932696|pid:none) Paramecium tetraurelia, Small GTPa... 116 3e-30
GN106009_1(GN106009|pid:none) Sequence 10790 from Patent WO20090... 119 4e-30
AY896243_1(AY896243|pid:none) Trichomonas vaginalis strain G3 sm... 120 4e-30
EU960755_1(EU960755|pid:none) Zea mays clone 228324 unknown mRNA. 134 4e-30
BT070243_1(BT070243|pid:none) Picea sitchensis clone WS02711_M12... 119 5e-30
GM977111_1(GM977111|pid:none) Sequence 19 from Patent WO20081456... 119 5e-30
AY576526_1(AY576526|pid:none) Oryza sativa (japonica cultivar-gr... 118 5e-30
BC060015_1(BC060015|pid:none) Xenopus laevis hypothetical protei... 112 6e-30
AC117265_12(AC117265|pid:none) Oryza sativa (japonica cultivar-g... 119 7e-30
GN105943_1(GN105943|pid:none) Sequence 10724 from Patent WO20090... 119 7e-30
GN106127_1(GN106127|pid:none) Sequence 10908 from Patent WO20090... 117 7e-30
GN106051_1(GN106051|pid:none) Sequence 10832 from Patent WO20090... 117 7e-30
BT035355_1(BT035355|pid:none) Zea mays full-length cDNA clone ZM... 116 7e-30
GN106011_1(GN106011|pid:none) Sequence 10792 from Patent WO20090... 119 7e-30
GN106049_1(GN106049|pid:none) Sequence 10830 from Patent WO20090... 117 7e-30
AY439005_1(AY439005|pid:none) Fucus distichus Rab family GTPase ... 120 7e-30
AJ278658_1(AJ278658|pid:none) Aspergillus niger srgA gene for a ... 115 7e-30
S51495(S51495;S70850)GTP-binding protein RYL1 - yeast (Yarrowia ... 114 7e-30
S33900(S33900;JQ2233) GTP-binding protein ypt2 - tomato &X69980... 117 9e-30
AB079024_1(AB079024|pid:none) Nicotiana tabacum mRNA for ras-rel... 116 9e-30
Z73946_1(Z73946|pid:none) L.japonicus mRNA for small GTP-binding... 116 9e-30
GN106021_1(GN106021|pid:none) Sequence 10802 from Patent WO20090... 115 1e-29
S57474(S57474) GTP-binding protein - garden pea &Z49899_1(Z4989... 116 1e-29
BC077124_1(BC077124|pid:none) Danio rerio zgc:100812, mRNA (cDNA... 117 1e-29
BC066913_1(BC066913|pid:none) Homo sapiens RAB26, member RAS onc... 113 1e-29
AK104346_1(AK104346|pid:none) Oryza sativa Japonica Group cDNA c... 118 2e-29
BC124978_1(BC124978|pid:none) Xenopus laevis hypothetical protei... 118 2e-29
(P24409) RecName: Full=Ras-related protein Rab-10; &D36364(D363... 112 2e-29
CR859178_1(CR859178|pid:none) Pongo abelii mRNA; cDNA DKFZp459K2... 112 2e-29
AL136650_1(AL136650|pid:none) Homo sapiens mRNA; cDNA DKFZp564L1... 112 2e-29
(P61026) RecName: Full=Ras-related protein Rab-10; &(P61027) Re... 112 2e-29
AK008725_1(AK008725|pid:none) Mus musculus adult male stomach cD... 112 2e-29
AL117202_29(AL117202|pid:none) Caenorhabditis elegans YAC Y47D3A... 124 3e-29
BT080552_1(BT080552|pid:none) Caligus clemensi clone ccle-evs-51... 113 3e-29
BT081291_1(BT081291|pid:none) Caligus clemensi clone ccle-evs-51... 113 3e-29
BT044760_1(BT044760|pid:none) Salmo salar clone ssal-rgf-502-322... 112 3e-29
(Q9ULW5) RecName: Full=Ras-related protein Rab-26; &AY646153_1(... 113 3e-29
AF096249_1(AF096249|pid:none) Lycopersicon esculentum ethylene-r... 116 3e-29
BC061274_1(BC061274|pid:none) Xenopus tropicalis hypothetical pr... 119 3e-29
EF145933_1(EF145933|pid:none) Populus trichocarpa clone WS0114_G... 107 4e-29
T33855(T33855)hypothetical protein D1037.4 - Caenorhabditis eleg... 115 5e-29
AB112929_1(AB112929|pid:none) Caenorhabditis elegans rab8 mRNA f... 115 5e-29
(P22127) RecName: Full=Ras-related protein Rab-10; Shor... 112 5e-29
BC129421_1(BC129421|pid:none) Danio rerio zgc:158741, mRNA (cDNA... 112 5e-29
GM977141_1(GM977141|pid:none) Sequence 49 from Patent WO20081456... 115 6e-29
AB197097_1(AB197097|pid:none) Entamoeba histolytica gene for sma... 108 6e-29
AB232608_1(AB232608|pid:none) Mus musculus mRNA for Rab13, compl... 120 7e-29
(Q9DD03) RecName: Full=Ras-related protein Rab-13; &AK002303_1(... 120 7e-29
AY893660_1(AY893660|pid:none) Synthetic construct Homo sapiens c... 119 7e-29
FN357316_32(FN357316|pid:none) Schistosoma mansoni genome sequen... 115 1e-28
BX538352_67(BX538352|pid:none) Cryptosporidium parvum chromosome... 115 1e-28
AB197057_1(AB197057|pid:none) Entamoeba histolytica gene for sma... 104 1e-28
(P07560) RecName: Full=Ras-related protein SEC4; AltName: Full=S... 112 1e-28
AY813938_1(AY813938|pid:none) Schistosoma japonicum SJCHGC06150 ... 116 1e-28
AC116984_79(AC116984|pid:none) Dictyostelium discoideum chromoso... 109 2e-28
EU954271_1(EU954271|pid:none) Zea mays clone 1460642 ras-related... 107 2e-28
(Q558I0) RecName: Full=Ras-related protein RabF1; 109 2e-28
BC134059_1(BC134059|pid:none) Danio rerio RAB8A, member RAS onco... 115 2e-28
BT023070_1(BT023070|pid:none) Drosophila melanogaster IP08619 fu... 115 2e-28
(Q96AX2) RecName: Full=Ras-related protein Rab-37; &AK098068_1(... 105 3e-28
(Q39572) RecName: Full=Ras-related protein YPTC6; &JC4108(JC410... 110 3e-28
AK296062_1(AK296062|pid:none) Homo sapiens cDNA FLJ61124 complet... 105 3e-28
CR762386_2(CR762386|pid:none) Zebrafish DNA sequence from clone ... 110 3e-28
EF125738_1(EF125738|pid:none) Nyctotherus ovalis Rab A61 gene, c... 121 3e-28
AF127669_1(AF127669|pid:none) Mus musculus small GTPase (Rab11a)... 111 4e-28
BC081187_1(BC081187|pid:none) Xenopus laevis MGC84419 protein, m... 111 4e-28
CR933429_1(CR933429|pid:none) Paramecium tetraurelia, Small GTPa... 110 4e-28
AB018117_6(AB018117|pid:none) Arabidopsis thaliana genomic DNA, ... 96 4e-28
DQ414564_1(DQ414564|pid:none) Suberites domuncula Rab11 gene, co... 111 4e-28
EU069500_1(EU069500|pid:none) Karlodinium micrum Rab1D mRNA, com... 116 5e-28
U18771_1(U18771|pid:none) Rattus norvegicus Rab26 mRNA, complete... 110 5e-28
CR932504_1(CR932504|pid:none) Paramecium tetraurelia, Small GTPa... 115 6e-28
AC140549_17(AC140549|pid:none) Medicago truncatula clone mth2-28... 107 6e-28
AM910992_188(AM910992|pid:none) Plasmodium knowlesi strain H chr... 112 6e-28
CR932581_1(CR932581|pid:none) Paramecium tetraurelia, Small GTPa... 116 8e-28
AY894025_1(AY894025|pid:none) Synthetic construct Homo sapiens c... 111 8e-28
(Q2TA29) RecName: Full=Ras-related protein Rab-11A; &BC111143_1... 111 8e-28
AJ851582_1(AJ851582|pid:none) Gallus gallus mRNA for hypothetica... 111 8e-28
BC082421_1(BC082421|pid:none) Xenopus laevis hypothetical LOC494... 111 8e-28
EU244432_1(EU244432|pid:none) Capra hircus RAB11B (rab11b) mRNA,... 111 8e-28
EF560724_1(EF560724|pid:none) Homo sapiens clone DKFZp564C1023 R... 111 8e-28
(P46638) RecName: Full=Ras-related protein Rab-11B; &A55005(A55... 111 8e-28
(P22129) RecName: Full=Ras-related protein Rab-11B; AltName: Ful... 111 8e-28
BC152630_1(BC152630|pid:none) Danio rerio zgc:92772, mRNA (cDNA ... 111 8e-28
CR541691_1(CR541691|pid:none) Homo sapiens full open reading fra... 111 8e-28
BC076247_1(BC076247|pid:none) Danio rerio zgc:92772, mRNA (cDNA ... 111 8e-28
(O35509) RecName: Full=Ras-related protein Rab-11B; &(Q15907) R... 111 8e-28
AJ851375_1(AJ851375|pid:none) Gallus gallus mRNA for hypothetica... 119 8e-28
BT080187_1(BT080187|pid:none) Caligus clemensi clone ccle-evs-50... 108 9e-28
AC023628_1(AC023628|pid:none) Arabidopsis thaliana chromosome I ... 115 1e-27
JC2487(JC2487) GTP-binding protein H-YPT3 - human &X79780_1(X79... 111 1e-27
AB035354_1(AB035354|pid:none) Drosophila melanogaster mRNA for D... 111 1e-27
BT056265_1(BT056265|pid:none) Drosophila melanogaster FI09227 fu... 111 1e-27
JC2528(JC2528)GTP-binding protein Rab26 - rat 108 1e-27
BC057747_1(BC057747|pid:none) Xenopus laevis hypothetical protei... 119 1e-27
BT049157_1(BT049157|pid:none) Salmo salar clone ssal-rgb2-591-24... 111 1e-27
BC048889_1(BC048889|pid:none) Danio rerio RAB11B, member RAS onc... 110 1e-27
BT001785_1(BT001785|pid:none) Drosophila melanogaster RH21315 fu... 111 1e-27
AB027137_1(AB027137|pid:none) Homo sapiens v46133 mRNA for RAB-2... 107 1e-27
AE014296_1491(AE014296|pid:none) Drosophila melanogaster chromos... 110 1e-27
BC068969_1(BC068969|pid:none) Xenopus laevis similar to RAB35, m... 119 2e-27
BC099268_1(BC099268|pid:none) Xenopus laevis similar to RAB35, m... 119 2e-27
BC041759_1(BC041759|pid:none) Xenopus laevis similar to RAB35, m... 119 2e-27
BT078096_1(BT078096|pid:none) Lepeophtheirus salmonis clone lsal... 115 2e-27
BC087498_1(BC087498|pid:none) Xenopus laevis hypothetical LOC496... 111 2e-27
AY220456_1(AY220456|pid:none) Limulus polyphemus rab11-2 mRNA, c... 111 2e-27
BC075268_1(BC075268|pid:none) Xenopus tropicalis RAB11B, member ... 111 2e-27
CR536494_1(CR536494|pid:none) Homo sapiens full open reading fra... 111 2e-27
AJ237914_1(AJ237914|pid:none) Plasmodium falciparum putative rab... 116 2e-27
AF201953_1(AF201953|pid:none) Plasmodium falciparum isolate FCC1... 116 2e-27
DQ157704_1(DQ157704|pid:none) Aiptasia pulchella Rab11 protein m... 111 2e-27
BC041250_1(BC041250|pid:none) Xenopus laevis RAB11B, member RAS ... 110 2e-27
AK046260_1(AK046260|pid:none) Mus musculus adult male corpora qu... 103 2e-27
EF678326_1(EF678326|pid:none) Picea sitchensis clone WS02914_M23... 109 2e-27
AF003139_1(AF003139|pid:none) Caenorhabditis elegans cosmid F53G... 109 2e-27
EU069501_1(EU069501|pid:none) Gymnochlora stellata Rab1A1 mRNA, ... 112 2e-27
CR382138_325(CR382138|pid:none) Debaryomyces hansenii strain CBS... 107 3e-27
AY896281_1(AY896281|pid:none) Trichomonas vaginalis strain G3 sm... 109 3e-27
AF014120_1(AF014120|pid:none) Strongylocentrotus purpuratus GTP-... 106 3e-27
BT077510_1(BT077510|pid:none) Lepeophtheirus salmonis clone lsal... 110 4e-27
U41269_1(U41269|pid:none) Plasmodium falciparum Rab1 protein (Pf... 116 5e-27
AY220749_1(AY220749|pid:none) Limulus polyphemus Rab11-1a mRNA, ... 111 6e-27
AB006189_1(AB006189|pid:none) Drosophila melanogaster mRNA for R... 112 6e-27
AB076904_1(AB076904|pid:none) Ciona intestinalis Ci-rab2 mRNA fo... 105 7e-27
AY220748_1(AY220748|pid:none) Limulus polyphemus Rab11-1c mRNA, ... 111 8e-27
BC055141_1(BC055141|pid:none) Danio rerio zgc:63565, mRNA (cDNA ... 109 8e-27
(Q8K386) RecName: Full=Ras-related protein Rab-15; &AB232610_1(... 112 8e-27
(P59190) RecName: Full=Ras-related protein Rab-15; &AX399903_1(... 112 8e-27
(P35289) RecName: Full=Ras-related protein Rab-15; &BC094954_1(... 112 8e-27
(P28187) RecName: Full=Ras-related protein ARA-4; &AC004450_5(A... 111 9e-27
(Q550H6) RecName: Full=Ras-related protein Rab-11C; 110 1e-26
EF085830_1(EF085830|pid:none) Picea sitchensis clone WS0286_P20 ... 105 1e-26
EF083999_1(EF083999|pid:none) Picea sitchensis clone WS0281_E05 ... 103 1e-26
(P35281) RecName: Full=Ras-related protein Rab-10; &M83677_1(M8... 112 1e-26
(Q39570) RecName: Full=GTP-binding protein YPTC4; &JC4106(JC410... 103 2e-26
AY904354_1(AY904354|pid:none) Gracilariopsis lemaneiformis small... 101 2e-26
EU244427_1(EU244427|pid:none) Capra hircus RAB1A-like protein mR... 122 2e-26
CR382125_525(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 112 2e-26
CR933456_1(CR933456|pid:none) Paramecium tetraurelia, Small GTPa... 107 2e-26
BT045814_1(BT045814|pid:none) Salmo salar clone ssal-rgf-532-060... 109 2e-26
AE014297_3785(AE014297|pid:none) Drosophila melanogaster chromos... 110 2e-26
AM269968_23(AM269968|pid:none) Aspergillus niger contig An01c021... 108 2e-26
BX649327_6(BX649327|pid:none) Zebrafish DNA sequence from clone ... 106 2e-26
BT051415_1(BT051415|pid:none) Medicago truncatula clone MTYF1_F2... 105 3e-26
L35845_1(L35845|pid:none) Oryza sativa small GTP-binding protein... 102 3e-26
DQ525204_1(DQ525204|pid:none) Bombyx mori ras-related GTP-bindin... 103 3e-26
AL161545_36(AL161545|pid:none) Arabidopsis thaliana DNA chromoso... 102 3e-26
CR932657_1(CR932657|pid:none) Paramecium tetraurelia, Small GTPa... 110 3e-26
EU958646_1(EU958646|pid:none) Zea mays clone 1707478 ras-related... 111 3e-26
AC130603_13(AC130603|pid:none) Oryza sativa (japonica cultivar-g... 111 3e-26
EU810302_1(EU810302|pid:none) Gymnochlora stellata Ras-related s... 99 3e-26
DQ019037_1(DQ019037|pid:none) Trichomonas vaginalis strain G3 sm... 110 3e-26
D12542_1(D12542|pid:none) Pisum sativum mRNA for GTP-binding pro... 105 3e-26
(P25228) RecName: Full=Ras-related protein Rab-3; &AB112932_1(A... 103 3e-26
CP000499_197(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 108 3e-26
(P25766) RecName: Full=Ras-related protein RGP1; AltName: Full=G... 104 4e-26
AC069472_3(AC069472|pid:none) Arabidopsis thaliana chromosome 3 ... 105 4e-26
BT064760_1(BT064760|pid:none) Zea mays full-length cDNA clone ZM... 114 4e-26
CR932534_1(CR932534|pid:none) Paramecium tetraurelia, Small GTPa... 105 4e-26
AY099331_1(AY099331|pid:none) Periplaneta americana Rab11 mRNA, ... 105 4e-26
(Q40191) RecName: Full=Ras-related protein Rab11A; &Z73949_1(Z7... 105 4e-26
L49400_1(L49400|pid:none) Loligo pealii Rab3 gene, complete cds. 103 4e-26
AY815497_1(AY815497|pid:none) Schistosoma japonicum SJCHGC05511 ... 108 4e-26
AY552054_1(AY552054|pid:none) Aedes aegypti RAB-like GTP binding... 120 5e-26
D12541_1(D12541|pid:none) Pisum sativum mRNA for GTP-binding pro... 109 5e-26
FN357326_31(FN357326|pid:none) Schistosoma mansoni genome sequen... 117 5e-26
AY893729_1(AY893729|pid:none) Synthetic construct Homo sapiens c... 120 6e-26
GM977117_1(GM977117|pid:none) Sequence 25 from Patent WO20081456... 120 6e-26
(Q5KTJ6) RecName: Full=Ras-related protein Rab-13; &AB158369_1(... 120 6e-26
BC094846_1(BC094846|pid:none) Homo sapiens RAB13, member RAS onc... 120 6e-26
(P51153) RecName: Full=Ras-related protein Rab-13; AltName: Full... 120 6e-26
CR932579_1(CR932579|pid:none) Paramecium tetraurelia, Small GTPa... 104 7e-26
(Q39222) RecName: Full=Ras-related protein RABA1b; AltName: Full... 108 7e-26
AE014298_1101(AE014298|pid:none) Drosophila melanogaster chromos... 100 7e-26
AY071340_1(AY071340|pid:none) Drosophila melanogaster RE37651 fu... 100 7e-26
(Q39434) RecName: Full=Ras-related protein Rab2BV; &T14566(T145... 105 7e-26
AE013599_198(AE013599|pid:none) Drosophila melanogaster chromoso... 104 7e-26
AB035352_1(AB035352|pid:none) Drosophila melanogaster mRNA for D... 104 7e-26
EF710656_1(EF710656|pid:none) Glyptapanteles indiensis clone BAC... 104 7e-26
(O14462) RecName: Full=Ras-related protein SEC4; &AF015306_1(AF... 107 7e-26
AM920437_2206(AM920437|pid:none) Penicillium chrysogenum Wiscons... 108 7e-26
AY809861_1(AY809861|pid:none) Schistosoma japonicum SJCHGC02927 ... 118 7e-26
AK297498_1(AK297498|pid:none) Homo sapiens cDNA FLJ61134 complet... 111 7e-26
BC009227_1(BC009227|pid:none) Homo sapiens RAB13, member RAS onc... 119 8e-26
AP008213_447(AP008213|pid:none) Oryza sativa (japonica cultivar-... 105 9e-26
(Q01111) RecName: Full=Ras-related protein YPT3; &S23523(S23523... 109 9e-26
AM471469_2(AM471469|pid:none) Vitis vinifera contig VV78X014719.... 108 9e-26
AB016890_5(AB016890|pid:none) Arabidopsis thaliana genomic DNA, ... 106 9e-26
EU162609_23(EU162609|pid:none) Cleome spinosa clone contig83 BAC... 105 9e-26
(Q05975) RecName: Full=Ras-related protein Rab-2; &S38341(S3834... 104 9e-26
CR933420_1(CR933420|pid:none) Paramecium tetraurelia, Small GTPa... 103 9e-26
EU090128_1(EU090128|pid:none) Aiptasia pulchella Rab3 mRNA, comp... 101 1e-25
EF144593_1(EF144593|pid:none) Populus trichocarpa clone WS01111_... 103 1e-25
CP000582_359(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 101 1e-25
BT051484_1(BT051484|pid:none) Medicago truncatula clone MTYF1_F2... 119 1e-25
AK060095_1(AK060095|pid:none) Oryza sativa Japonica Group cDNA c... 107 1e-25
U00986_1(U00986|pid:none) Aplysia californica Rab3 mRNA, complet... 100 1e-25
FN314406_1(FN314406|pid:none) Schistosoma japonicum isolate Anhu... 103 1e-25
AJ518934_1(AJ518934|pid:none) Hordeum vulgare subsp. vulgare mRN... 102 1e-25
(P49104) RecName: Full=Ras-related protein Rab-2-B; &BT068076_1... 102 1e-25
DQ397202_1(DQ397202|pid:none) Saccharum officinarum small GTP bi... 102 1e-25
AF083256_1(AF083256|pid:none) Sporobolus stapfianus small GTP bi... 102 1e-25
AK304620_1(AK304620|pid:none) Homo sapiens cDNA FLJ57783 complet... 119 1e-25
AJ272025_1(AJ272025|pid:none) Colletotrichum lindemuthianum pt1 ... 119 1e-25
(Q58DS5) RecName: Full=Ras-related protein Rab-13; &BT021522_1(... 119 1e-25
BT035582_1(BT035582|pid:none) Zea mays full-length cDNA clone ZM... 109 2e-25
AK102491_1(AK102491|pid:none) Oryza sativa Japonica Group cDNA c... 108 2e-25
T28972(T28972)hypothetical protein T23H2.6 - Caenorhabditis eleg... 112 2e-25
BT038097_1(BT038097|pid:none) Zea mays full-length cDNA clone ZM... 107 2e-25
(Q40723) RecName: Full=Ras-related protein RGP2; AltName: Full=G... 105 2e-25
AC093018_9(AC093018|pid:none) Oryza sativa chromosome 3 BAC OSJN... 105 2e-25
AC090485_17(AC090485|pid:none) Genomic Sequence for Oryza sativa... 111 2e-25
T28971(T28971) hypothetical protein T23H2.5 - Caenorhabditis ele... 112 2e-25
AC161399_25(AC161399|pid:none) Medicago truncatula chromosome 2 ... 102 2e-25
AJ001367_1(AJ001367|pid:none) Daucus carota mRNA for Rab8-like s... 118 2e-25
AB197096_1(AB197096|pid:none) Entamoeba histolytica gene for sma... 107 2e-25
AC084818_20(AC084818|pid:none) Oryza sativa (japonica cultivar-g... 101 2e-25
(P36409) RecName: Full=Ras-related protein Rab-2A; 101 2e-25
AK051218_1(AK051218|pid:none) Mus musculus 12 days embryo spinal... 115 2e-25
AY815772_1(AY815772|pid:none) Schistosoma japonicum SJCHGC09130 ... 103 2e-25
(A4D1S5) RecName: Full=Ras-related protein Rab-19; &BC140796_1(... 110 2e-25
FN314407_1(FN314407|pid:none) Schistosoma japonicum isolate Anhu... 103 2e-25
AJ308736_1(AJ308736|pid:none) Plasmodium falciparum mRNA for put... 98 2e-25
(P61019) RecName: Full=Ras-related protein Rab-2A; &(P61105) Re... 103 2e-25
(Q90965) RecName: Full=Ras-related protein Rab-2A; &S52325(S523... 103 2e-25
BT043649_1(BT043649|pid:none) Salmo salar clone HM5_0924 RAB2A, ... 103 2e-25
(P53994) RecName: Full=Ras-related protein Rab-2A; &AB232585_1(... 103 2e-25
Z73937_1(Z73937|pid:none) L.japonicus mRNA for small GTP-binding... 102 2e-25
AL161545_37(AL161545|pid:none) Arabidopsis thaliana DNA chromoso... 102 2e-25
E71440(E71440)GTP-binding protein RAB2A - Arabidopsis thaliana 102 2e-25
CR932630_1(CR932630|pid:none) Paramecium tetraurelia, Small GTPa... 112 3e-25
EU951907_1(EU951907|pid:none) Zea mays clone 1062297 ras-related... 100 3e-25
GN080113_1(GN080113|pid:none) Sequence 716 from Patent WO2009027... 111 3e-25
AL670003_2(AL670003|pid:none) Neurospora crassa DNA linkage grou... 107 3e-25
BT033192_1(BT033192|pid:none) Zea mays full-length cDNA clone ZM... 105 3e-25
(Q54GY8) RecName: Full=Ras-related protein Rab-18; 112 3e-25
AF363067_1(AF363067|pid:none) Entamoeba histolytica small GTP-bi... 112 3e-25
BC159385_1(BC159385|pid:none) Xenopus tropicalis hypothetical pr... 112 3e-25
BT006190_1(BT006190|pid:none) Arabidopsis thaliana clone C00163 ... 106 3e-25
(P19892) RecName: Full=Ras-related protein ARA-1; &AC009999_8(A... 106 3e-25
EF084887_1(EF084887|pid:none) Picea sitchensis clone WS0292_K24 ... 100 3e-25
BC122421_1(BC122421|pid:none) Danio rerio zgc:153788, mRNA (cDNA... 107 3e-25
BX647601_1(BX647601|pid:none) Homo sapiens mRNA; cDNA DKFZp313C1... 101 3e-25
AF532625_1(AF532625|pid:none) Glycine max GTP-binding protein mR... 108 3e-25
GN080103_1(GN080103|pid:none) Sequence 706 from Patent WO2009027... 105 3e-25
BT037150_1(BT037150|pid:none) Zea mays full-length cDNA clone ZM... 105 3e-25
BC058341_1(BC058341|pid:none) Danio rerio RAB14, member RAS onco... 97 3e-25
AY069563_1(AY069563|pid:none) Drosophila melanogaster LD29476 fu... 94 3e-25
CR932703_1(CR932703|pid:none) Paramecium tetraurelia, Small GTPa... 108 3e-25
BC071068_1(BC071068|pid:none) Xenopus laevis MGC78967 protein, m... 100 4e-25
AY851657_1(AY851657|pid:none) Triticum aestivum small GTP-bindin... 102 4e-25
S71559(S71559) GTP-binding protein rab2 - soybean &U32185_1(U32... 102 4e-25
BT037824_1(BT037824|pid:none) Zea mays full-length cDNA clone ZM... 101 4e-25
T23530(T23530) hypothetical protein K09A9.2 - Caenorhabditis ele... 96 4e-25
AJ245570_1(AJ245570|pid:none) Lycopersicon esculentum mRNA for R... 108 4e-25
(Q40195) RecName: Full=Ras-related protein Rab11E; &Z73953_1(Z7... 108 4e-25
AC138015_11(AC138015|pid:none) Medicago truncatula clone mth2-34... 107 4e-25
AC124143_12(AC124143|pid:none) Oryza sativa (japonica cultivar-g... 107 4e-25
BT039216_1(BT039216|pid:none) Zea mays full-length cDNA clone ZM... 107 4e-25
(Q40193) RecName: Full=Ras-related protein Rab11C; &Z73951_1(Z7... 105 4e-25
(P36412) RecName: Full=Ras-related protein Rab-11A; &U02925_1(U... 102 4e-25
CU638743_340(CU638743|pid:none) Podospora anserina genomic DNA c... 108 4e-25
BC086715_1(BC086715|pid:none) Danio rerio RAB25, member RAS onco... 104 4e-25
BX890617_2(BX890617|pid:none) Zebrafish DNA sequence from clone ... 104 4e-25
AF169950_1(AF169950|pid:none) Tetrahymena thermophila putative i... 102 4e-25
CR932610_1(CR932610|pid:none) Paramecium tetraurelia, Small GTPa... 106 4e-25
AM432734_2(AM432734|pid:none) Vitis vinifera contig VV78X219500.... 107 5e-25
AC159435_18(AC159435|pid:none) Trypanosoma brucei chromosome 8 c... 103 5e-25
BT037200_1(BT037200|pid:none) Zea mays full-length cDNA clone ZM... 101 5e-25
AY891305_1(AY891305|pid:none) Synthetic construct Homo sapiens c... 102 5e-25
(P49103) RecName: Full=Ras-related protein Rab-2-A; &T02242(T02... 100 5e-25
FN357335_32(FN357335|pid:none) Schistosoma mansoni genome sequen... 99 5e-25
Z73950_1(Z73950|pid:none) L.japonicus mRNA for small GTP-binding... 101 6e-25
GN080127_1(GN080127|pid:none) Sequence 730 from Patent WO2009027... 111 6e-25
GN080133_1(GN080133|pid:none) Sequence 736 from Patent WO2009027... 111 6e-25
GN106149_1(GN106149|pid:none) Sequence 10930 from Patent WO20090... 106 6e-25
GN106097_1(GN106097|pid:none) Sequence 10878 from Patent WO20090... 109 6e-25
AB241229_1(AB241229|pid:none) Pyrsonympha grandis RsSmRab11_1 mR... 103 6e-25
BC054719_1(BC054719|pid:none) Mus musculus RAB2B, member RAS onc... 101 6e-25
AY891536_1(AY891536|pid:none) Synthetic construct Homo sapiens c... 100 6e-25
(O95716) RecName: Full=Ras-related protein Rab-3D; &AF081353_1(... 100 6e-25
(P59279) RecName: Full=Ras-related protein Rab-2B; &AB232586_1(... 101 6e-25
CR954202_213(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 101 6e-25
EF457937_1(EF457937|pid:none) Lolium temulentum GTP-binding prot... 102 6e-25
AC034107_21(AC034107|pid:none) Sequence of BAC T10F20 from Arabi... 105 7e-25
BT063103_1(BT063103|pid:none) Zea mays full-length cDNA clone ZM... 108 7e-25
AK228658_1(AK228658|pid:none) Arabidopsis thaliana mRNA for hypo... 105 7e-25
BT084300_1(BT084300|pid:none) Zea mays full-length cDNA clone ZM... 106 7e-25
GN106119_1(GN106119|pid:none) Sequence 10900 from Patent WO20090... 106 7e-25
AY815506_1(AY815506|pid:none) Schistosoma japonicum SJCHGC02859 ... 103 7e-25
BT087588_1(BT087588|pid:none) Zea mays full-length cDNA clone ZM... 110 7e-25
AE014298_1596(AE014298|pid:none) Drosophila melanogaster chromos... 110 7e-25
AJ968959_1(AJ968959|pid:none) Mus musculus mRNA for RAB14 protei... 96 7e-25
BT045578_1(BT045578|pid:none) Salmo salar clone ssal-rgf-525-209... 96 7e-25
E42148(E42148)GTP-binding protein rab14 - rat 96 7e-25
(P61107) RecName: Full=Ras-related protein Rab-14; &(Q52NJ6) Re... 96 7e-25
AF030183_1(AF030183|pid:none) Entamoeba histolytica GTP-binding ... 100 7e-25
CR933405_1(CR933405|pid:none) Paramecium tetraurelia, Small GTPa... 100 7e-25
AL137068_10(AL137068|pid:none) Human DNA sequence from clone RP1... 96 7e-25
AC155344_30(AC155344|pid:none) Brassica rapa subsp. pekinensis c... 97 8e-25
AP008215_340(AP008215|pid:none) Oryza sativa (japonica cultivar-... 107 1e-24
DQ810282_29(DQ810282|pid:none) Oryza brachyantha BAC 0002C07, co... 103 1e-24
AK071461_1(AK071461|pid:none) Oryza sativa Japonica Group cDNA c... 107 1e-24
AM462529_1(AM462529|pid:none) Vitis vinifera contig VV78X101776.... 106 1e-24
BT064711_1(BT064711|pid:none) Zea mays full-length cDNA clone ZM... 106 1e-24
BC045374_1(BC045374|pid:none) Danio rerio RAB14, member RAS onco... 96 1e-24
GM977151_2(GM977151|pid:none) Sequence 59 from Patent WO20081456... 108 1e-24
BT077156_1(BT077156|pid:none) Caligus rogercresseyi clone crog-e... 107 1e-24
BT075660_1(BT075660|pid:none) Osmerus mordax clone omor-eva-509-... 103 1e-24
CR932644_1(CR932644|pid:none) Paramecium tetraurelia, Small GTPa... 108 1e-24
AB470307_1(AB470307|pid:none) Nicotiana tabacum NtRab11D mRNA fo... 100 1e-24
BT043430_1(BT043430|pid:none) Zea mays full-length cDNA clone ZM... 101 1e-24

>(Q54E92) RecName: Full=Ras-related protein RabG1;
Length = 196

Score = 231 bits (588), Expect(3) = 5e-99
Identities = 113/117 (96%), Positives = 114/117 (97%)
Frame = +3

Query: 39 MSDPDVFKILLIGDSAVGKTSLLLRFTDPNNFQETSVNMTSVDYKNKNITIDGRTFNLQI 218
M+D DVFKILLIGDSAVGKTSLLLRFTDPNNFQETSVNMTSVDYKNKNITIDGRTFNLQI
Sbjct: 1 MNDSDVFKILLIGDSAVGKTSLLLRFTDPNNFQETSVNMTSVDYKNKNITIDGRTFNLQI 60

Query: 219 WDTAGQERFRTITSSFYRGAHGVLVCYDVTDQLTYNNVGLWMQEIQRYGVLGVSESL 389
WDTAGQERFRTITSSFYRGAHGVLVCYDVTDQLTYNNVGLWMQEIQRYGVLGVS L
Sbjct: 61 WDTAGQERFRTITSSFYRGAHGVLVCYDVTDQLTYNNVGLWMQEIQRYGVLGVSRVL 117

Score = 139 bits (350), Expect(3) = 5e-99
Identities = 67/68 (98%), Positives = 68/68 (100%)
Frame = +2

Query: 428 LINASIAQEYADILGIPFIETSATTGVNVEEAFMAMADEIYRNHIGGSKPSVVKPVCGSP 607
L+NASIAQEYADILGIPFIETSATTGVNVEEAFMAMADEIYRNHIGGSKPSVVKPVCGSP
Sbjct: 129 LVNASIAQEYADILGIPFIETSATTGVNVEEAFMAMADEIYRNHIGGSKPSVVKPVCGSP 188

Query: 608 PRTKKNIC 631
PRTKKNIC
Sbjct: 189 PRTKKNIC 196

Score = 36.6 bits (83), Expect(3) = 5e-99
Identities = 17/21 (80%), Positives = 18/21 (85%)
Frame = +1

Query: 370 LALVRV*VGNKCDLEDRKLVN 432
L + RV VGNKCDLEDRKLVN
Sbjct: 111 LGVSRVLVGNKCDLEDRKLVN 131

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,216,504,568
Number of extensions: 23392425
Number of successful extensions: 74521
Number of sequences better than 10.0: 3687
Number of HSP's gapped: 71943
Number of HSP's successfully gapped: 5801
Length of query: 257
Length of database: 1,040,966,779
Length adjustment: 126
Effective length of query: 131
Effective length of database: 637,226,869
Effective search space: 83476719839
Effective search space used: 83476719839
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)

PSORT

psg: 0.58 gvh: 0.43 alm: 0.42 top: 0.53 tms: 0.00 mit: 0.20 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

40.0 %: cytoplasmic
28.0 %: nuclear
24.0 %: mitochondrial
4.0 %: vacuolar
4.0 %: vesicles of secretory system

>> prediction for Contig-U10248-1 is cyt

VS (DIR, S) 2
VH (FL, L) 0
VF (FL, S) 1
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 10
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0