Homology vs DNA |
Query= Contig-U10246-1 (Contig-U10246-1Q) /CSM_Contig/Contig-U10246-1Q.Seq.d (1100 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ428034) Dictyostelium discoideum cDNA clone:ddv10d17, 3' ... 1174 0.0 1 (BJ415799) Dictyostelium discoideum cDNA clone:ddv23d23, 5' ... 1017 0.0 2 (BJ411424) Dictyostelium discoideum cDNA clone:ddv4i10, 5' e... 1017 0.0 2 (BJ415506) Dictyostelium discoideum cDNA clone:ddv22f20, 5' ... 1009 0.0 2 (BJ412117) Dictyostelium discoideum cDNA clone:ddv7c06, 5' e... 1017 0.0 2 (BJ413302) Dictyostelium discoideum cDNA clone:ddv15c02, 5' ... 940 0.0 2 (BJ430370) Dictyostelium discoideum cDNA clone:ddv7c06, 3' e... 991 0.0 1 (BJ414214) Dictyostelium discoideum cDNA clone:ddv18m11, 5' ... 890 0.0 3 (BJ412800) Dictyostelium discoideum cDNA clone:ddv9m19, 5' e... 914 0.0 2 (BJ432542) Dictyostelium discoideum cDNA clone:ddv19b03, 3' ... 954 0.0 1 (BJ432344) Dictyostelium discoideum cDNA clone:ddv18m11, 3' ... 914 0.0 3 (BJ434061) Dictyostelium discoideum cDNA clone:ddv23d23, 3' ... 914 0.0 1 (BJ430033) Dictyostelium discoideum cDNA clone:ddv5h19, 3' e... 702 0.0 2 (BJ433742) Dictyostelium discoideum cDNA clone:ddv22f20, 3' ... 892 0.0 1 (BJ409916) Dictyostelium discoideum cDNA clone:ddv10d17, 5' ... 833 0.0 2 (BJ431658) Dictyostelium discoideum cDNA clone:ddv15c02, 3' ... 888 0.0 1 (BJ431111) Dictyostelium discoideum cDNA clone:ddv9m19, 3' e... 884 0.0 1 (BJ414389) Dictyostelium discoideum cDNA clone:ddv19b03, 5' ... 882 0.0 2 (AU054118) Dictyostelium discoideum slug cDNA, clone SLK745. 807 0.0 2 (BJ429642) Dictyostelium discoideum cDNA clone:ddv4i10, 3' e... 686 0.0 1 (BJ411793) Dictyostelium discoideum cDNA clone:ddv5h19, 5' e... 609 0.0 2 (DY886241) CeleSEQ1813 Cunninghamella elegans pBluescript (E... 52 2e-19 4 (DY890069) CeleSEQ7115 Cunninghamella elegans pBluescript (E... 52 1e-18 4 (DY890940) CeleSEQ7432 Cunninghamella elegans pBluescript (E... 52 1e-18 4 (DY886638) CeleSEQ2374 Cunninghamella elegans pBluescript (E... 52 2e-18 4 (DY888871) CeleSEQ6250 Cunninghamella elegans pBluescript (E... 48 1e-15 4 (AX536836) Sequence 437 from Patent WO02064766. 44 3e-14 5 (AR941623) Sequence 437 from patent US 7101990. 44 3e-14 5 (DY891028) CeleSEQ7545 Cunninghamella elegans pBluescript (E... 48 2e-12 3 (DJ135198) Method for identification of useful proteins deri... 54 1e-11 4 (AR549002) Sequence 4133 from patent US 6747137. 40 1e-08 4 (AL419645) T3 end of clone XAX0AA002A05 of library XAX0AA fr... 48 2e-05 2 (CP000447) Shewanella frigidimarina NCIMB 400, complete genome. 62 5e-05 1 (AL440711) T3 end of clone BD0AA014C07 of library BD0AA from... 48 8e-05 2 (CP000939) Clostridium botulinum B1 str. Okra, complete genome. 38 6e-04 17 (FE256879) CAPH6337.rev CAPH Naegleria gruberi amoeba stage ... 52 7e-04 2 (FE256880) CAPH6337.fwd CAPH Naegleria gruberi amoeba stage ... 52 7e-04 2 (FE246746) CAPG9581.rev CAPG Naegleria gruberi amoeba stage ... 52 8e-04 2 (FE237760) CAPG4528.rev CAPG Naegleria gruberi amoeba stage ... 52 8e-04 2 (FE249384) CAPH2246.rev CAPH Naegleria gruberi amoeba stage ... 52 8e-04 2 (FE246139) CAPG9261.rev CAPG Naegleria gruberi amoeba stage ... 52 8e-04 2 (FE232307) CAPG1680.rev CAPG Naegleria gruberi amoeba stage ... 52 9e-04 2 (FE236957) CAPG4143.rev CAPG Naegleria gruberi amoeba stage ... 52 9e-04 2 (FE233203) CAPG2159.rev CAPG Naegleria gruberi amoeba stage ... 52 9e-04 2 (FE233532) CAPG2335.rev CAPG Naegleria gruberi amoeba stage ... 52 9e-04 2 (FE234656) CAPG2941.rev CAPG Naegleria gruberi amoeba stage ... 52 9e-04 2 (FE248805) CAPH1909.rev CAPH Naegleria gruberi amoeba stage ... 52 9e-04 2 (FE231252) CAPG10319.rev CAPG Naegleria gruberi amoeba stage... 52 9e-04 2 (FE251576) CAPH3526.rev CAPH Naegleria gruberi amoeba stage ... 52 0.001 2 (FE247287) CAPG9872.rev CAPG Naegleria gruberi amoeba stage ... 52 0.001 2 (FE251432) CAPH3441.rev CAPH Naegleria gruberi amoeba stage ... 52 0.001 2 (FE238903) CAPG509.rev CAPG Naegleria gruberi amoeba stage N... 52 0.001 2 (FE244185) CAPG8054.rev CAPG Naegleria gruberi amoeba stage ... 52 0.001 2 (FE244515) CAPG8242.rev CAPG Naegleria gruberi amoeba stage ... 52 0.001 2 (FE256595) CAPH6192.rev CAPH Naegleria gruberi amoeba stage ... 52 0.001 2 (FE254158) CAPH4911.rev CAPH Naegleria gruberi amoeba stage ... 52 0.001 2 (FE248546) CAPH1756.rev CAPH Naegleria gruberi amoeba stage ... 52 0.001 2 (AL110477) Caenorhabditis elegans YAC Y113G7B. 38 0.001 6 (AL423117) T3 end of clone AZ0AA006D05 of library AZ0AA from... 46 0.001 2 (EU795231) Uncultured bacterium ARCTIC02_G_04 genomic sequence. 50 0.001 6 (ER419328) 1092963693730 Global-Ocean-Sampling_GS-35-01-01-1... 44 0.004 2 (AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 34 0.004 12 (AE010300) Leptospira interrogans serovar lai str. 56601 chr... 40 0.007 2 (AE016823) Leptospira interrogans serovar Copenhageni str. F... 40 0.007 2 (AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 36 0.010 13 (CL408647) RPCI44_415F2.f RPCI-44 Sus scrofa genomic clone R... 42 0.011 2 (EK387129) 1095469487595 Global-Ocean-Sampling_GS-31-01-01-1... 54 0.011 1 (CP000681) Shewanella putrefaciens CN-32, complete genome. 54 0.011 1 (CP000503) Shewanella sp. W3-18-1, complete genome. 54 0.011 1 (AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 32 0.014 13 (CP000962) Clostridium botulinum A3 str. Loch Maree, complet... 40 0.033 17 (AE014852) Plasmodium falciparum 3D7 chromosome 12, section ... 34 0.038 12 (EE008565) ROE00006362 Rhizopus oryzae Company Rhizopus oryz... 44 0.043 2 (CU354286) Aphanomyces euteiches cDNA. 50 0.055 2 (CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 36 0.076 19 (CP000049) Borrelia turicatae 91E135, complete genome. 38 0.11 14 (AJ235272) Rickettsia prowazekii strain Madrid E, complete g... 34 0.12 14 (AM454860) Vitis vinifera contig VV78X113134.13, whole genom... 44 0.13 4 (FH017589) CHO_OF450xd24f2.ab1 CHO_OF Nicotiana tabacum geno... 44 0.17 2 (CU329672) Schizosaccharomyces pombe chromosome III. 50 0.18 1 (CU462842) H.melpomene DNA sequence from clone AEHM-22C5. 50 0.18 1 (FI029812) CHO_OF6943xc15r1.ab1 CHO_OF6 Nicotiana tabacum ge... 50 0.18 1 (ET895778) CHO_OF150xj18f1.ab1 CHO_OF Nicotiana tabacum geno... 38 0.20 2 (FH974806) CHO_OF6817xn07r1.ab1 CHO_OF6 Nicotiana tabacum ge... 38 0.20 2 (FH995530) CHO_OF6880xh16r1.ab1 CHO_OF6 Nicotiana tabacum ge... 38 0.20 2 (AZ550613) ENTEA30TRB Entamoeba histolytica Sheared DNA Enta... 46 0.21 2 (AC116032) Dictyostelium discoideum chromosome 2 map 4158743... 36 0.21 5 (AP009180) Candidatus Carsonella ruddii PV DNA, complete gen... 34 0.25 10 (ED806049) MG__Bb0096P13f MG__Bb Mimulus guttatus genomic, g... 48 0.29 2 (CP000083) Colwellia psychrerythraea 34H, complete genome. 48 0.32 2 (AC229705) Medicago truncatula clone mth2-49e17, WORKING DRA... 36 0.40 9 (AC165415) Mus musculus chromosome 15, clone RP23-17G19, com... 42 0.41 5 (CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 34 0.44 16 (CZ288994) cp61e02.r Candida parapsilosis Random Genomic Lib... 34 0.51 2 (CN739065) SM_A1400 Suidasia medanensis cDNA library Suidasi... 34 0.54 2 (CP000102) Methanosphaera stadtmanae DSM 3091, complete genome. 36 0.55 19 (CP000361) Arcobacter butzleri RM4018, complete genome. 36 0.56 15 (AC115592) Dictyostelium discoideum chromosome 2 map 1-12595... 34 0.57 9 (CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 32 0.61 19 (BZ046007) ljr36a07.b1 B.oleracea002 Brassica oleracea genom... 38 0.64 2
>(BJ428034) Dictyostelium discoideum cDNA clone:ddv10d17, 3' end, single read. Length = 596
Score = 1174 bits (592), Expect = 0.0 Identities = 595/596 (99%) Strand = Plus / Minus
Query: 450 gttgataatttgtgaaatcattacactttcaagaaaattaggagatagatcaactgagat 509 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 596 gttgatagtttgtgaaatcattacactttcaagaaaattaggagatagatcaactgagat 537
Query: 510 gcataataaaatttggagaaaggagtcggccaattgtcatgaaattcgtggtaaaacatt 569 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 536 gcataataaaatttggagaaaggagtcggccaattgtcatgaaattcgtggtaaaacatt 477
Query: 570 aggtatcattggttatggtcatattggtagccaagtgcaaattgtaaagattgggaatgt 629 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 476 aggtatcattggttatggtcatattggtagccaagtgcaaattgtaaagattgggaatgt 417
Query: 630 gaactccaaaaatgtccaaatacaattttaactccacatattggtggtagtactgaagaa 689 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 416 gaactccaaaaatgtccaaatacaattttaactccacatattggtggtagtactgaagaa 357
Query: 690 gcccaagaagcaatcggtttagaagttagtgatctcatcgttcaattcatcaatagtggt 749 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 356 gcccaagaagcaatcggtttagaagttagtgatctcatcgttcaattcatcaatagtggt 297
Query: 750 gcatctgctggttctgtcaatttccctgaaatcgctttaccagtttcaccttcaactcac 809 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 296 gcatctgctggttctgtcaatttccctgaaatcgctttaccagtttcaccttcaactcac 237
Query: 810 cgtattcttaatattcataataacaaacctggtgttttaagagatatcaataatatttta 869 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 236 cgtattcttaatattcataataacaaacctggtgttttaagagatatcaataatatttta 177
Query: 870 tcagaatttaatgtttcagcacaagtactctcaacaagaaaacaaattggttatattatt 929 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 176 tcagaatttaatgtttcagcacaagtactctcaacaagaaaacaaattggttatattatt 117
Query: 930 gcagatgtagattcagaagcatctaaagagattaaaaagaaaatttcttctttaccaaat 989 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 116 gcagatgtagattcagaagcatctaaagagattaaaaagaaaatttcttctttaccaaat 57
Query: 990 tcaatcaaaacaagagtactttattaagctgtaaccatataacctccacaaaaaca 1045 |||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 56 tcaatcaaaacaagagtactttattaagctgtaaccatataacctccacaaaaaca 1
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,491,045,883 Number of extensions: 97949122 Number of successful extensions: 8791652 Number of sequences better than 10.0: 293 Length of query: 1100 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1076 Effective length of database: 97,308,875,965 Effective search space: 104704350538340 Effective search space used: 104704350538340 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
Homology vs Protein |
Query= Contig-U10246-1 (Contig-U10246-1Q) /CSM_Contig/Contig-U10246-1Q.Seq.d (1100 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q54UH8) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 330 4e-89 FN392320_702(FN392320|pid:none) Pichia pastoris GS115 chromosome... 221 3e-56 FM992688_1109(FM992688|pid:none) Candida dubliniensis CD36 chrom... 221 3e-56 (P40510) RecName: Full=D-3-phosphoglycerate dehydrogenase 2; ... 216 1e-54 CR382132_421(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 212 2e-53 AM920435_53(AM920435|pid:none) Penicillium chrysogenum Wisconsin... 211 3e-53 CU928175_365(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 211 3e-53 CU928165_203(CU928165|pid:none) Kluyveromyces thermotolerans str... 211 5e-53 AE016816_174(AE016816|pid:none) Ashbya gossypii (= Eremothecium ... 207 5e-52 CP000350_1310(CP000350|pid:none) Leptospira borgpetersenii serov... 206 1e-51 CP000348_1531(CP000348|pid:none) Leptospira borgpetersenii serov... 206 1e-51 CP000777_1803(CP000777|pid:none) Leptospira biflexa serovar Pato... 204 3e-51 (P87228) RecName: Full=Putative D-3-phosphoglycerate dehydrogena... 199 1e-49 CP000383_979(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340... 195 2e-48 CP001103_3182(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 189 1e-46 AC125735_3(AC125735|pid:none) Leishmania major strain Friedlin c... 187 4e-46 CP000113_6194(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 186 1e-45 AM743169_2075(AM743169|pid:none) Stenotrophomonas maltophilia K2... 186 2e-45 CP000388_1149(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 186 2e-45 BX842654_19(BX842654|pid:none) Bdellovibrio bacteriovorus comple... 186 2e-45 CP001111_1786(CP001111|pid:none) Stenotrophomonas maltophilia R5... 186 2e-45 CP000967_2411(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 184 6e-45 CP000323_409(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 183 8e-45 CP000230_2451(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 183 8e-45 CP000503_802(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 183 1e-44 CP000644_1507(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 182 2e-44 AE008923_1814(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 182 2e-44 CP000753_819(CP000753|pid:none) Shewanella baltica OS185, comple... 181 3e-44 CP000891_868(CP000891|pid:none) Shewanella baltica OS195, comple... 181 4e-44 CP000469_3394(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 181 5e-44 CP000941_1276(CP000941|pid:none) Xylella fastidiosa M12, complet... 181 5e-44 CP000563_3442(CP000563|pid:none) Shewanella baltica OS155, compl... 180 7e-44 AE009442_1196(AE009442|pid:none) Xylella fastidiosa Temecula1, c... 180 9e-44 CP000444_3280(CP000444|pid:none) Shewanella sp. MR-7, complete g... 180 9e-44 AE003849_2192(AE003849|pid:none) Xylella fastidiosa 9a5c, comple... 179 2e-43 CP000931_722(CP000931|pid:none) Shewanella halifaxensis HAW-EB4,... 179 2e-43 CP000472_4242(CP000472|pid:none) Shewanella piezotolerans WP3, c... 178 3e-43 AE003852_2445(AE003852|pid:none) Vibrio cholerae O1 biovar eltor... 178 3e-43 CP001616_1351(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 178 3e-43 CP000083_1504(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 178 3e-43 AE016795_1426(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 177 4e-43 AE014299_851(AE014299|pid:none) Shewanella oneidensis MR-1, comp... 177 4e-43 CP000109_626(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 177 6e-43 AE008922_1795(AE008922|pid:none) Xanthomonas campestris pv. camp... 177 8e-43 CP001321_956(CP001321|pid:none) Haemophilus parasuis SH0165, com... 177 8e-43 CP000961_3846(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 177 8e-43 CP000687_1420(CP000687|pid:none) Actinobacillus pleuropneumoniae... 176 1e-42 FM178379_2543(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 176 1e-42 CP000447_556(CP000447|pid:none) Shewanella frigidimarina NCIMB 4... 176 1e-42 CP000789_3430(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 175 2e-42 CP000302_3077(CP000302|pid:none) Shewanella denitrificans OS217,... 175 3e-42 CP000020_2134(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 174 4e-42 BA000037_2852(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 174 5e-42 CP000509_3898(CP000509|pid:none) Nocardioides sp. JS614, complet... 174 6e-42 CP000937_1433(CP000937|pid:none) Francisella philomiragia subsp.... 173 8e-42 CP000076_5818(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 173 1e-41 CP000947_1966(CP000947|pid:none) Haemophilus somnus 2336, comple... 173 1e-41 CR378673_69(CR378673|pid:none) Photobacterium profundum SS9; seg... 172 1e-41 CP000094_5382(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 172 1e-41 CP000439_1219(CP000439|pid:none) Francisella tularensis subsp. n... 172 2e-41 (P43885) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 172 2e-41 CP000915_572(CP000915|pid:none) Francisella tularensis subsp. me... 172 2e-41 CP000605_170(CP000605|pid:none) Bifidobacterium longum DJO10A, c... 171 4e-41 CP000284_721(CP000284|pid:none) Methylobacillus flagellatus KT, ... 171 4e-41 AM286690_68(AM286690|pid:none) Alcanivorax borkumensis SK2, comp... 171 4e-41 CP000713_564(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 171 5e-41 AE016853_5168(AE016853|pid:none) Pseudomonas syringae pv. tomato... 170 9e-41 CP000282_3378(CP000282|pid:none) Saccharophagus degradans 2-40, ... 169 1e-40 FM211044_124(FM211044|pid:none) Photorhabdus asymbiotica subsp. ... 169 1e-40 CP000746_1838(CP000746|pid:none) Actinobacillus succinogenes 130... 169 1e-40 CP001095_811(CP001095|pid:none) Bifidobacterium longum subsp. in... 169 2e-40 BX571871_67(BX571871|pid:none) Photorhabdus luminescens subsp. l... 169 2e-40 CU928145_3135(CU928145|pid:none) Escherichia coli 55989 chromoso... 169 2e-40 AM889285_1874(AM889285|pid:none) Gluconacetobacter diazotrophicu... 169 2e-40 CP000247_2877(CP000247|pid:none) Escherichia coli 536, complete ... 169 2e-40 CP000034_2945(CP000034|pid:none) Shigella dysenteriae Sd197, com... 169 2e-40 CP001600_3236(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 169 2e-40 CP000539_849(CP000539|pid:none) Acidovorax sp. JS42, complete ge... 169 2e-40 CP001189_96(CP001189|pid:none) Gluconacetobacter diazotrophicus ... 169 2e-40 (P0A9T0) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 169 2e-40 CP000075_4851(CP000075|pid:none) Pseudomonas syringae pv. syring... 169 2e-40 CP000155_1577(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 168 3e-40 CP000926_5174(CP000926|pid:none) Pseudomonas putida GB-1, comple... 168 3e-40 CP000803_614(CP000803|pid:none) Francisella tularensis subsp. ho... 168 4e-40 CP000057_517(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 168 4e-40 AE015451_5086(AE015451|pid:none) Pseudomonas putida KT2440 compl... 167 5e-40 CU928158_2752(CU928158|pid:none) Escherichia fergusonii ATCC 354... 167 6e-40 CP000304_396(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 167 8e-40 CP000473_5847(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 166 1e-39 AE006468_2973(AE006468|pid:none) Salmonella enterica subsp. ente... 166 1e-39 AD0874(AD0874) D-3-phosphoglycerate dehydrogenase [imported] - S... 166 1e-39 AP009256_1112(AP009256|pid:none) Bifidobacterium adolescentis AT... 166 1e-39 CP001144_3086(CP001144|pid:none) Salmonella enterica subsp. ente... 166 1e-39 CP000653_3304(CP000653|pid:none) Enterobacter sp. 638, complete ... 166 2e-39 CP000857_3015(CP000857|pid:none) Salmonella enterica subsp. ente... 166 2e-39 AE017220_3003(AE017220|pid:none) Salmonella enterica subsp. ente... 166 2e-39 AP006725_4205(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 165 2e-39 AM233362_713(AM233362|pid:none) Francisella tularensis subsp. ho... 165 2e-39 CP001192_782(CP001192|pid:none) Rhizobium leguminosarum bv. trif... 165 2e-39 CP001213_773(CP001213|pid:none) Bifidobacterium animalis subsp. ... 165 3e-39 CP000783_405(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-... 165 3e-39 AE004091_317(AE004091|pid:none) Pseudomonas aeruginosa PAO1, com... 164 4e-39 CP000781_3787(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 164 4e-39 CP001349_2762(CP001349|pid:none) Methylobacterium nodulans ORS 2... 164 4e-39 CP000438_331(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA1... 164 4e-39 CP001154_2173(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 164 5e-39 CP000880_4407(CP000880|pid:none) Salmonella enterica subsp. ariz... 164 5e-39 CP000629_2329(CP000629|pid:none) Agrobacterium radiobacter K84 c... 164 5e-39 CP000912_420(CP000912|pid:none) Brucella suis ATCC 23445 chromos... 163 9e-39 CP000759_349(CP000759|pid:none) Ochrobactrum anthropi ATCC 49188... 163 9e-39 CP000884_346(CP000884|pid:none) Delftia acidovorans SPH-1, compl... 163 9e-39 AP008229_2012(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 162 2e-38 EF066650_4(EF066650|pid:none) Sinorhizobium meliloti strain SM11... 161 3e-38 AP009152_2056(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 161 3e-38 CP000542_1282(CP000542|pid:none) Verminephrobacter eiseniae EF01... 161 3e-38 CP001489_386(CP001489|pid:none) Brucella melitensis ATCC 23457 c... 161 3e-38 AP008232_2009(AP008232|pid:none) Sodalis glossinidius str. 'mors... 161 4e-38 CP000749_4262(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 160 6e-38 CP001618_2413(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 160 7e-38 CP000750_1509(CP000750|pid:none) Kineococcus radiotolerans SRS30... 159 1e-37 CP000512_3580(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 159 2e-37 BA000040_7965(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 159 2e-37 CU468135_2807(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 159 2e-37 BX950851_3879(BX950851|pid:none) Erwinia carotovora subsp. atros... 157 5e-37 AM286415_3245(AM286415|pid:none) Yersinia enterocolitica subsp. ... 157 6e-37 CR555306_3920(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 157 8e-37 AC0112(AC0112) phosphoglycerate dehydrogenase (EC 1.1.1.95) [imp... 154 4e-36 CP001001_2417(CP001001|pid:none) Methylobacterium radiotolerans ... 151 3e-35 CP001029_2938(CP001029|pid:none) Methylobacterium populi BJ001, ... 144 4e-33 CP000353_915(CP000353|pid:none) Ralstonia metallidurans CH34 meg... 143 9e-33 CP000086_2837(CP000086|pid:none) Burkholderia thailandensis E264... 143 1e-32 AF006000_1(AF006000|pid:none) Bordetella pertussis D-3-phosphogl... 141 4e-32 BX640411_154(BX640411|pid:none) Bordetella pertussis strain Toha... 141 4e-32 CP000449_150(CP000449|pid:none) Maricaulis maris MCS10, complete... 140 6e-32 CP000572_1332(CP000572|pid:none) Burkholderia pseudomallei 1106a... 139 2e-31 BX571965_1261(BX571965|pid:none) Burkholderia pseudomallei strai... 139 2e-31 AM260480_810(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 138 3e-31 AF037440_1(AF037440|pid:none) Edwardsiella ictaluri D-3-phosphog... 120 1e-25 AP006878_1967(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 118 4e-25 AP007150_597(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 117 5e-25 AJ248285_125(AJ248285|pid:none) Pyrococcus abyssi complete genom... 114 5e-24 BA000001_1428(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 113 1e-23 CP000575_547(CP000575|pid:none) Staphylothermus marinus F1, comp... 109 2e-22 CR378673_70(CR378673|pid:none) Photobacterium profundum SS9; seg... 108 4e-22 AE009950_1394(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 105 4e-21 (Q58424) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 104 6e-21 CP000099_1396(CP000099|pid:none) Methanosarcina barkeri str. Fus... 103 1e-20 BA000012_2991(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 103 1e-20 AE017223_1566(AE017223|pid:none) Brucella abortus biovar 1 str. ... 101 4e-20 AE008917_348(AE008917|pid:none) Brucella melitensis 16M chromoso... 101 4e-20 AE014291_1633(AE014291|pid:none) Brucella suis 1330 chromosome I... 101 4e-20 CP000390_3128(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 100 2e-19 CP001140_854(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 99 2e-19 CP001131_2583(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 99 2e-19 CP000830_3302(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 99 2e-19 CP001359_2670(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 99 2e-19 CP000248_2667(CP000248|pid:none) Novosphingobium aromaticivorans... 99 3e-19 CP000812_1749(CP000812|pid:none) Thermotoga lettingae TMO, compl... 99 3e-19 CP000628_2768(CP000628|pid:none) Agrobacterium radiobacter K84 c... 99 3e-19 CP000769_2487(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 99 3e-19 CP000743_559(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 98 4e-19 CP001074_3643(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 98 6e-19 CP000264_261(CP000264|pid:none) Jannaschia sp. CCS1, complete ge... 98 6e-19 CP000133_3406(CP000133|pid:none) Rhizobium etli CFN 42, complete... 97 8e-19 AP009384_985(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 97 8e-19 CP000115_2950(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 97 8e-19 CP000362_184(CP000362|pid:none) Roseobacter denitrificans OCh 11... 97 1e-18 CP000494_1724(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 97 1e-18 CP000489_809(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 96 2e-18 CP000246_52(CP000246|pid:none) Clostridium perfringens ATCC 1312... 96 2e-18 AM236080_3963(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 96 3e-18 CP000356_611(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 96 3e-18 CP000879_253(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 95 4e-18 CP001191_3156(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 94 6e-18 CP000781_1192(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 94 8e-18 CP001280_1356(CP001280|pid:none) Methylocella silvestris BL2, co... 89 9e-18 AE017125_135(AE017125|pid:none) Helicobacter hepaticus ATCC 5144... 94 1e-17 AP007255_3193(AP007255|pid:none) Magnetospirillum magneticum AMB... 94 1e-17 AE010299_582(AE010299|pid:none) Methanosarcina acetivorans str. ... 94 1e-17 X66836_1(X66836|pid:none) E.coli serA, iciA, sbm genes and two o... 94 1e-17 CP000875_1080(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 94 1e-17 CP000745_829(CP000745|pid:none) Methanococcus maripaludis C7, co... 94 1e-17 BX950229_1588(BX950229|pid:none) Methanococcus maripaludis strai... 93 1e-17 CP000716_107(CP000716|pid:none) Thermosipho melanesiensis BI429,... 93 1e-17 CP001185_344(CP001185|pid:none) Thermosipho africanus TCF52B, co... 93 1e-17 AE009439_297(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 93 1e-17 CP001251_36(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, c... 93 1e-17 CP000867_1070(CP000867|pid:none) Methanococcus maripaludis C6, c... 93 2e-17 CP000661_10(CP000661|pid:none) Rhodobacter sphaeroides ATCC 1702... 92 2e-17 CP001581_1177(CP001581|pid:none) Clostridium botulinum A2 str. K... 92 2e-17 CP000577_20(CP000577|pid:none) Rhodobacter sphaeroides ATCC 1702... 92 2e-17 CP000609_1801(CP000609|pid:none) Methanococcus maripaludis C5, c... 92 2e-17 CP000157_394(CP000157|pid:none) Erythrobacter litoralis HTCC2594... 92 2e-17 (Q5R7M2) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 92 3e-17 CP001100_220(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 92 4e-17 BA000016_54(BA000016|pid:none) Clostridium perfringens str. 13 D... 92 4e-17 CP001298_624(CP001298|pid:none) Methylobacterium chloromethanicu... 91 5e-17 CP000300_2212(CP000300|pid:none) Methanococcoides burtonii DSM 6... 91 5e-17 CP000908_645(CP000908|pid:none) Methylobacterium extorquens PA1,... 91 5e-17 CP001098_1143(CP001098|pid:none) Halothermothrix orenii H 168, c... 91 5e-17 BX572606_297(BX572606|pid:none) Rhodopseudomonas palustris CGA00... 91 5e-17 (Q60HD7) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 91 5e-17 CP001083_1099(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 91 5e-17 AB172378_1(AB172378|pid:none) Macaca fascicularis brain cDNA clo... 91 5e-17 (O43175) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 91 7e-17 CP001016_1251(CP001016|pid:none) Beijerinckia indica subsp. indi... 91 7e-17 CP001146_1665(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 91 7e-17 CP000319_1064(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 91 7e-17 (A5A6P1) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 91 7e-17 CP000702_1367(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 91 9e-17 BA000040_7401(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 91 9e-17 CP000728_1110(CP000728|pid:none) Clostridium botulinum F str. La... 91 9e-17 CP000726_1086(CP000726|pid:none) Clostridium botulinum A str. AT... 91 9e-17 CP001280_1721(CP001280|pid:none) Methylocella silvestris BL2, co... 91 9e-17 AM114193_1438(AM114193|pid:none) Uncultured methanogenic archaeo... 90 1e-16 CP000697_2612(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 90 1e-16 CP000301_4053(CP000301|pid:none) Rhodopseudomonas palustris BisB... 90 1e-16 CP001147_919(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 90 1e-16 (Q61753) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 90 1e-16 (O08651) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 90 1e-16 CP001078_3118(CP001078|pid:none) Clostridium botulinum E3 str. A... 90 2e-16 AL591688_2739(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 90 2e-16 CP000738_2588(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 90 2e-16 BC105479_1(BC105479|pid:none) Bos taurus phosphoglycerate dehydr... 90 2e-16 (A5GFY8) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 90 2e-16 CP000312_55(CP000312|pid:none) Clostridium perfringens SM101, co... 90 2e-16 (Q5EAD2) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 90 2e-16 CP000633_2630(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 89 3e-16 CP000969_1410(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 89 3e-16 CP000771_97(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1,... 89 3e-16 CP000939_1130(CP000939|pid:none) Clostridium botulinum B1 str. O... 89 3e-16 CP000283_3886(CP000283|pid:none) Rhodopseudomonas palustris BisB... 89 4e-16 AB169812_1(AB169812|pid:none) Macaca fascicularis brain cDNA, cl... 89 4e-16 CP001230_328(CP001230|pid:none) Persephonella marina EX-H1, comp... 88 5e-16 AM412317_1125(AM412317|pid:none) Clostridium botulinum A str. AT... 88 5e-16 CP000699_4649(CP000699|pid:none) Sphingomonas wittichii RW1, com... 88 6e-16 AP009049_3370(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 87 8e-16 CR926379_1(CR926379|pid:none) Xenopus tropicalis finished cDNA, ... 87 8e-16 AE015927_583(AE015927|pid:none) Clostridium tetani E88, complete... 87 8e-16 EU016562_12(EU016562|pid:none) Uncultured marine microorganism H... 87 1e-15 CP000360_115(CP000360|pid:none) Acidobacteria bacterium Ellin345... 87 1e-15 CP001279_874(CP001279|pid:none) Nautilia profundicola AmH, compl... 86 2e-15 BC130204_1(BC130204|pid:none) Xenopus laevis hypothetical protei... 86 2e-15 CP001056_3347(CP001056|pid:none) Clostridium botulinum B str. Ek... 86 2e-15 CP001080_252(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 86 2e-15 CP001349_6504(CP001349|pid:none) Methylobacterium nodulans ORS 2... 86 2e-15 CP001229_1658(CP001229|pid:none) Sulfurihydrogenibium azorense A... 86 2e-15 AB303390_1(AB303390|pid:none) Aphanothece halophytica ApPGDH gen... 85 4e-15 AP009178_664(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 85 5e-15 CP000859_2806(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 85 5e-15 AP008955_2422(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 84 7e-15 CP000852_773(CP000852|pid:none) Caldivirga maquilingensis IC-167... 84 9e-15 CU207366_1451(CU207366|pid:none) Gramella forsetii KT0803 comple... 84 9e-15 CP000487_1194(CP000487|pid:none) Campylobacter fetus subsp. fetu... 84 9e-15 CP000860_12(CP000860|pid:none) Candidatus Desulforudis audaxviat... 84 9e-15 CP000478_3615(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 84 9e-15 CP000923_1871(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 84 1e-14 (P73821) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 84 1e-14 CP000252_1173(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 83 1e-14 CP000964_252(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 83 1e-14 CP001357_555(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 83 1e-14 CP000682_1653(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 83 2e-14 AY752825_1(AY752825|pid:none) Culicoides sonorensis clone CsPGD1... 83 2e-14 CP000159_649(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 82 3e-14 CP001037_4745(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 82 3e-14 AB201308_39(AB201308|pid:none) Uncultured crenarchaeote 45-H-12 ... 82 3e-14 CP000806_2132(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 82 4e-14 AE005673_3189(AE005673|pid:none) Caulobacter crescentus CB15, co... 82 4e-14 AP009153_195(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 82 4e-14 CP000975_1249(CP000975|pid:none) Methylacidiphilum infernorum V4... 81 7e-14 AM920427_1055(AM920427|pid:none) Penicillium chrysogenum Wiscons... 81 7e-14 CP000241_996(CP000241|pid:none) Helicobacter pylori HPAG1, compl... 81 7e-14 AE000511_393(AE000511|pid:none) Helicobacter pylori 26695, compl... 80 1e-13 CP000386_824(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 80 1e-13 AM398681_64(AM398681|pid:none) Flavobacterium psychrophilum JIP0... 80 1e-13 CP001217_1016(CP001217|pid:none) Helicobacter pylori P12, comple... 80 1e-13 CP000721_4843(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 80 1e-13 CP000724_3483(CP000724|pid:none) Alkaliphilus metalliredigens QY... 80 1e-13 CP001287_2281(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 80 1e-13 AY312991_28(AY312991|pid:none) Alvinella pompejana epibiont 7G3 ... 80 1e-13 CP000382_2221(CP000382|pid:none) Clostridium novyi NT, complete ... 80 1e-13 CP001173_977(CP001173|pid:none) Helicobacter pylori G27, complet... 80 2e-13 AE001439_980(AE001439|pid:none) Helicobacter pylori J99, complet... 80 2e-13 BA000045_2139(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 80 2e-13 BA000035_1377(BA000035|pid:none) Corynebacterium efficiens YS-31... 80 2e-13 DQ314493_8(DQ314493|pid:none) Haloquadratum walsbyi clone 2B08 s... 80 2e-13 AK093306_1(AK093306|pid:none) Homo sapiens cDNA FLJ35987 fis, cl... 80 2e-13 CP000492_1053(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 80 2e-13 CP000393_3670(CP000393|pid:none) Trichodesmium erythraeum IMS101... 79 2e-13 AD2042(AD2042) phosphoglycerate dehydrogenase [imported] - Nosto... 79 2e-13 CP000117_3738(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 79 2e-13 AM942444_759(AM942444|pid:none) Corynebacterium urealyticum DSM ... 79 3e-13 CP000686_263(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 79 3e-13 CP000878_1410(CP000878|pid:none) Prochlorococcus marinus str. MI... 79 4e-13 CP001620_1181(CP001620|pid:none) Corynebacterium kroppenstedtii ... 79 4e-13 CP000153_871(CP000153|pid:none) Sulfurimonas denitrificans DSM 1... 79 4e-13 AP008231_2486(AP008231|pid:none) Synechococcus elongatus PCC 630... 78 5e-13 CP000776_446(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 78 5e-13 CP000553_1775(CP000553|pid:none) Prochlorococcus marinus str. NA... 78 5e-13 CP000110_2107(CP000110|pid:none) Synechococcus sp. CC9605, compl... 78 5e-13 AJ965256_483(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 78 5e-13 CP000102_1106(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 78 6e-13 CP000095_1730(CP000095|pid:none) Prochlorococcus marinus str. NA... 78 6e-13 CP000923_2245(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 78 6e-13 CP000804_257(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 78 6e-13 BA000043_2247(BA000043|pid:none) Geobacillus kaustophilus HTA426... 78 6e-13 AE008691_2416(AE008691|pid:none) Thermoanaerobacter tengcongensi... 78 6e-13 CP000077_1272(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 77 8e-13 BA000033_1666(BA000033|pid:none) Staphylococcus aureus subsp. au... 77 8e-13 CP001072_1026(CP001072|pid:none) Helicobacter pylori Shi470, com... 77 8e-13 AP009351_1623(AP009351|pid:none) Staphylococcus aureus subsp. au... 77 8e-13 CP000924_2017(CP000924|pid:none) Thermoanaerobacter pseudethanol... 77 8e-13 AE015929_1401(AE015929|pid:none) Staphylococcus epidermidis ATCC... 77 8e-13 CP000239_1282(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 77 8e-13 AM295250_1320(AM295250|pid:none) Staphylococcus carnosus subsp. ... 77 8e-13 CP001097_935(CP001097|pid:none) Chlorobium limicola DSM 245, com... 77 1e-12 AE004437_1867(AE004437|pid:none) Halobacterium sp. NRC-1, comple... 77 1e-12 CP001275_1719(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 77 1e-12 (Q9UYR1) RecName: Full=Glyoxylate reductase; EC=1.1.1.2... 77 1e-12 AP009324_1711(AP009324|pid:none) Staphylococcus aureus subsp. au... 77 1e-12 AM260522_417(AM260522|pid:none) Helicobacter acinonychis str. Sh... 77 1e-12 AE009439_320(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 77 1e-12 AE009441_2343(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 77 1e-12 CP000478_3105(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 77 1e-12 AP008226_952(AP008226|pid:none) Thermus thermophilus HB8 genomic... 77 1e-12 CR931997_1291(CR931997|pid:none) Corynebacterium jeikeium K411 c... 76 2e-12 AP006716_1200(AP006716|pid:none) Staphylococcus haemolyticus JCS... 76 2e-12 (Q8U3Y2) RecName: Full=Glyoxylate reductase; EC=1.1.1.2... 76 2e-12 CP001404_1436(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 76 2e-12 CP001399_1257(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 76 2e-12 AP009044_1383(AP009044|pid:none) Corynebacterium glutamicum R DN... 76 2e-12 CP000866_1254(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 76 2e-12 BX569690_179(BX569690|pid:none) Synechococcus sp. WH8102 complet... 76 2e-12 BA000028_2626(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 76 2e-12 (O33116) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 76 2e-12 CU633895_150(CU633895|pid:none) Podospora anserina genomic DNA c... 76 2e-12 CP000924_2025(CP000924|pid:none) Thermoanaerobacter pseudethanol... 76 2e-12 L21027_1(L21027|pid:none) Mus musculus A10 mRNA, partial cds. 76 2e-12 CP000478_3069(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 75 3e-12 AL009126_2397(AL009126|pid:none) Bacillus subtilis subsp. subtil... 75 3e-12 (P35136) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 75 3e-12 CP001601_1129(CP001601|pid:none) Corynebacterium aurimucosum ATC... 75 3e-12 EU016592_21(EU016592|pid:none) Uncultured Group I marine crenarc... 75 4e-12 CP000471_1405(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 75 4e-12 CP000551_1551(CP000551|pid:none) Prochlorococcus marinus str. AS... 75 4e-12 CP000474_2397(CP000474|pid:none) Arthrobacter aurescens TC1, com... 75 5e-12 (P0A544) RecName: Full=D-3-phosphoglycerate dehydrogenase; ... 75 5e-12 A71175(A71175) probable dehydrogenase - Pyrococcus horikoshii &... 75 5e-12 AE017333_2332(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 75 5e-12 CP000108_1356(CP000108|pid:none) Chlorobium chlorochromatii CaD3... 75 5e-12 AM849034_1405(AM849034|pid:none) Clavibacter michiganensis subsp... 74 7e-12 DQ440284_1(DQ440284|pid:none) Aedes aegypti clone AET-3626 phosp... 74 7e-12 AE017180_1189(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 74 7e-12 (O58320) RecName: Full=Glyoxylate reductase; EC=1.1.1.26; 74 9e-12 CP000511_2092(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 74 1e-11 CP000698_1713(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 74 1e-11 CP001338_417(CP001338|pid:none) Candidatus Methanosphaerula palu... 74 1e-11 CP000698_3792(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 73 2e-11 CP000813_2009(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 73 2e-11 CP001251_1706(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 73 2e-11 BX248357_47(BX248357|pid:none) Corynebacterium diphtheriae gravi... 73 2e-11 AM263198_76(AM263198|pid:none) Listeria welshimeri serovar 6b st... 73 2e-11 CT971583_1981(CT971583|pid:none) Synechococcus WH7803 complete g... 73 2e-11 AE016958_3033(AE016958|pid:none) Mycobacterium avium subsp. para... 73 2e-11 CP000922_1047(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 72 3e-11 BX842649_319(BX842649|pid:none) Bdellovibrio bacteriovorus compl... 72 3e-11 AL939124_21(AL939124|pid:none) Streptomyces coelicolor A3(2) com... 72 3e-11 BX640441_229(BX640441|pid:none) Bordetella bronchiseptica strain... 72 3e-11 AM420293_5973(AM420293|pid:none) Saccharopolyspora erythraea NRR... 72 3e-11 AY616055_1(AY616055|pid:none) Prototheca wickerhamii plastid pho... 72 3e-11 CP000480_2297(CP000480|pid:none) Mycobacterium smegmatis str. MC... 72 4e-11 CU207211_3170(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 72 4e-11 AP008937_159(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 72 4e-11 CP000825_1578(CP000825|pid:none) Prochlorococcus marinus str. MI... 72 4e-11 CP000854_1693(CP000854|pid:none) Mycobacterium marinum M, comple... 72 4e-11 CP001365_2687(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 72 4e-11 CP000724_2860(CP000724|pid:none) Alkaliphilus metalliredigens QY... 71 6e-11 AF183408_3(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 71 6e-11 AE014134_2126(AE014134|pid:none) Drosophila melanogaster chromos... 71 8e-11 CP000111_1574(CP000111|pid:none) Prochlorococcus marinus str. MI... 71 8e-11 CP001177_1417(CP001177|pid:none) Bacillus cereus AH187, complete... 71 8e-11 AP009493_1997(AP009493|pid:none) Streptomyces griseus subsp. gri... 70 1e-10 AE017126_1433(AE017126|pid:none) Prochlorococcus marinus subsp. ... 70 1e-10 CP000562_1841(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 70 1e-10 CP000411_24(CP000411|pid:none) Oenococcus oeni PSU-1, complete g... 70 1e-10 AP009552_3862(AP009552|pid:none) Microcystis aeruginosa NIES-843... 70 1e-10 CP000576_1541(CP000576|pid:none) Prochlorococcus marinus str. MI... 70 1e-10 CP000552_1514(CP000552|pid:none) Prochlorococcus marinus str. MI... 70 1e-10 CP001348_3325(CP001348|pid:none) Clostridium cellulolyticum H10,... 70 2e-10 AE016822_1043(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 70 2e-10 AE017221_431(AE017221|pid:none) Thermus thermophilus HB27, compl... 70 2e-10 AY210783_13(AY210783|pid:none) Nodularia spumigena strain NSOR10... 70 2e-10 AC144503_15(AC144503|pid:none) Medicago truncatula clone mth2-13... 69 2e-10 BT052881_1(BT052881|pid:none) Medicago truncatula clone MTYFL_FM... 69 2e-10 BX548174_1543(BX548174|pid:none) Prochlorococcus marinus MED4 co... 69 2e-10 CU207366_3459(CU207366|pid:none) Gramella forsetii KT0803 comple... 69 2e-10 CP000509_3336(CP000509|pid:none) Nocardioides sp. JS614, complet... 69 2e-10 AE001437_2900(AE001437|pid:none) Clostridium acetobutylicum ATCC... 69 3e-10 BX548175_1856(BX548175|pid:none) Prochlorococcus marinus MIT9313... 69 3e-10 AJ536156_4(AJ536156|pid:none) Anabaena sp. 90 microcystin synthe... 69 3e-10 CP001001_3356(CP001001|pid:none) Methylobacterium radiotolerans ... 69 3e-10 CP000554_520(CP000554|pid:none) Prochlorococcus marinus str. MIT... 69 4e-10 CP000667_1221(CP000667|pid:none) Salinispora tropica CNB-440, co... 69 4e-10 AP006725_984(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 68 5e-10 CP000414_447(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 68 5e-10 AP008937_1801(AP008937|pid:none) Lactobacillus fermentum IFO 395... 68 5e-10 CP000559_799(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 68 6e-10 AM920427_268(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 68 6e-10 CP000448_9(CP000448|pid:none) Syntrophomonas wolfei subsp. wolfe... 68 6e-10 AP006618_4237(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 68 6e-10 (Q54DP1) RecName: Full=Probable 2-ketogluconate reductase; ... 67 8e-10 CP000249_3594(CP000249|pid:none) Frankia sp. CcI3, complete geno... 67 8e-10 CP000431_6428(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 67 8e-10 (Q5JEZ2) RecName: Full=Glyoxylate reductase; EC=1.1.1.2... 67 1e-09 CP001130_832(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 67 1e-09 CP000964_4383(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 67 1e-09 CP000544_560(CP000544|pid:none) Halorhodospira halophila SL1, co... 67 1e-09 CP000764_3343(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 67 1e-09 CP000001_1279(CP000001|pid:none) Bacillus cereus E33L, complete ... 67 1e-09 CP000716_871(CP000716|pid:none) Thermosipho melanesiensis BI429,... 67 1e-09 EF086058_1(EF086058|pid:none) Picea sitchensis clone WS02721_C23... 67 1e-09 CP000885_1448(CP000885|pid:none) Clostridium phytofermentans ISD... 66 2e-09 AL442007_14(AL442007|pid:none) Oryza sativa genomic DNA, chromos... 66 2e-09 AY084236_1(AY084236|pid:none) Arabidopsis thaliana clone 100571 ... 62 2e-09 CP000411_630(CP000411|pid:none) Oenococcus oeni PSU-1, complete ... 66 2e-09 AE017355_1272(AE017355|pid:none) Bacillus thuringiensis serovar ... 66 2e-09 CP000301_2696(CP000301|pid:none) Rhodopseudomonas palustris BisB... 66 2e-09 AF027868_5(AF027868|pid:none) Bacillus subtilis chromosome regio... 66 2e-09 CP001175_2568(CP001175|pid:none) Listeria monocytogenes HCC23, c... 66 2e-09 CP001215_3059(CP001215|pid:none) Bacillus anthracis str. CDC 684... 66 2e-09 BA000028_2286(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 65 3e-09 AJ248287_296(AJ248287|pid:none) Pyrococcus abyssi complete genom... 65 3e-09 FM242711_86(FM242711|pid:none) Listeria monocytogenes Clip81459 ... 65 3e-09 A72390(A72390) hypothetical protein TM0327 - Thermotoga maritima... 65 3e-09 CP000721_1926(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 65 3e-09 AK243399_1(AK243399|pid:none) Oryza sativa Japonica Group cDNA, ... 65 3e-09 AE017262_93(AE017262|pid:none) Listeria monocytogenes str. 4b F2... 65 3e-09 (Q6LNU2) RecName: Full=Erythronate-4-phosphate dehydrogenase; ... 65 3e-09 CP000852_827(CP000852|pid:none) Caldivirga maquilingensis IC-167... 65 3e-09 AP009240_272(AP009240|pid:none) Escherichia coli SE11 DNA, compl... 65 3e-09 AL021961_20(AL021961|pid:none) Arabidopsis thaliana DNA chromoso... 62 4e-09 (A6WQ07) RecName: Full=Erythronate-4-phosphate dehydrogenase; ... 65 4e-09 CP000485_1198(CP000485|pid:none) Bacillus thuringiensis str. Al ... 65 4e-09 CP001131_3027(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 65 4e-09 AG1084(AG1084) phosphoglycerate dehydrogenase homolog lmo0078 [i... 65 4e-09 EU686631_12(EU686631|pid:none) Uncultured marine crenarchaeote K... 65 5e-09 CP000503_3132(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 65 5e-09 (Q49ZM5) RecName: Full=Putative 2-hydroxyacid dehydrogenase SSP0... 65 5e-09 CP000903_4606(CP000903|pid:none) Bacillus weihenstephanensis KBA... 65 5e-09 CP000140_2743(CP000140|pid:none) Parabacteroides distasonis ATCC... 65 5e-09 CP000681_990(CP000681|pid:none) Shewanella putrefaciens CN-32, c... 65 5e-09 AP011115_512(AP011115|pid:none) Rhodococcus opacus B4 DNA, compl... 64 7e-09 CP001390_1034(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 64 7e-09 BA000028_2357(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 64 7e-09 CP000931_922(CP000931|pid:none) Shewanella halifaxensis HAW-EB4,... 64 7e-09 AE017194_5007(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 64 7e-09 CP000542_2848(CP000542|pid:none) Verminephrobacter eiseniae EF01... 64 7e-09 CP000851_1608(CP000851|pid:none) Shewanella pealeana ATCC 700345... 64 7e-09 CP000227_4597(CP000227|pid:none) Bacillus cereus Q1, complete ge... 64 7e-09 CP000001_4589(CP000001|pid:none) Bacillus cereus E33L, complete ... 64 7e-09 AY182034_1(AY182034|pid:none) Bacillus coagulans phosphoglycerat... 64 9e-09 CP000682_1047(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 64 9e-09 AL954747_1689(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 64 9e-09 CP001186_1305(CP001186|pid:none) Bacillus cereus G9842, complete... 64 9e-09 AL935254_47(AL935254|pid:none) Lactobacillus plantarum strain WC... 64 9e-09 CP001139_1748(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 64 9e-09 CP001176_1342(CP001176|pid:none) Bacillus cereus B4264, complete... 64 9e-09 CP000820_1080(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 64 1e-08 CP000903_1315(CP000903|pid:none) Bacillus weihenstephanensis KBA... 64 1e-08 CP000148_2663(CP000148|pid:none) Geobacter metallireducens GS-15... 64 1e-08 (A9KTV0) RecName: Full=Erythronate-4-phosphate dehydrogenase; ... 64 1e-08 CP000091_67(CP000091|pid:none) Ralstonia eutropha JMP134 chromos... 64 1e-08 CP000916_341(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 64 1e-08 CP001196_3501(CP001196|pid:none) Oligotropha carboxidovorans OM5... 64 1e-08 BA000001_543(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, c... 64 1e-08 AE016827_68(AE016827|pid:none) Mannheimia succiniciproducens MBE... 64 1e-08 AP008937_769(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 63 2e-08 (A0KV91) RecName: Full=Erythronate-4-phosphate dehydrogenase; ... 63 2e-08 (A4Y882) RecName: Full=Erythronate-4-phosphate dehydrogenase; ... 63 2e-08 AJ810519_5(AJ810519|pid:none) Escherichia coli genetic island Gi... 63 2e-08 AP009493_3241(AP009493|pid:none) Streptomyces griseus subsp. gri... 63 2e-08 CP000733_259(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1... 63 2e-08 CP000472_2982(CP000472|pid:none) Shewanella piezotolerans WP3, c... 63 2e-08 CU928161_3700(CU928161|pid:none) Escherichia coli S88 chromosome... 63 2e-08 (A1RYE4) RecName: Full=Glyoxylate reductase; EC=1.1.1.2... 63 2e-08 AE017285_1406(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 63 2e-08 AL954747_334(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 63 2e-08 CP000444_3085(CP000444|pid:none) Shewanella sp. MR-7, complete g... 63 2e-08 AE017354_241(AE017354|pid:none) Legionella pneumophila subsp. pn... 63 2e-08 CU466930_1347(CU466930|pid:none) Candidatus Cloacamonas acidamin... 63 2e-08 CP000251_2952(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 62 3e-08 CP000821_970(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 62 3e-08 AP010656_743(AP010656|pid:none) Candidatus Azobacteroides pseudo... 62 3e-08 CP001020_255(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 62 3e-08 AE008691_1808(AE008691|pid:none) Thermoanaerobacter tengcongensi... 62 3e-08 CP000317_200(CP000317|pid:none) Polaromonas sp. JS666 plasmid 1,... 62 3e-08 CP000482_2907(CP000482|pid:none) Pelobacter propionicus DSM 2379... 62 3e-08 CP001185_1126(CP001185|pid:none) Thermosipho africanus TCF52B, c... 62 3e-08 AE016828_1492(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 62 4e-08 CP000482_1999(CP000482|pid:none) Pelobacter propionicus DSM 2379... 62 4e-08
>(Q54UH8) RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH; EC=1.1.1.95; Length = 407
Score = 330 bits (847), Expect = 4e-89 Identities = 165/169 (97%), Positives = 168/169 (99%) Frame = +1
Query: 109 MDPTTSFPKDKIKILLLENIHIAAIKQFEEQGFQVESISSSLPEDKIIEKIKDVHVLGLR 288 MDPTTSFPKDKIKILLLENIHIAAIKQFEEQGFQVESISSSLPEDKIIEKIKDVHVLGLR Sbjct: 1 MDPTTSFPKDKIKILLLENIHIAAIKQFEEQGFQVESISSSLPEDKIIEKIKDVHVLGLR 60
Query: 289 SKTKVTEKILSEAKRLLAIGCFCIGTDQVDLIEAEKRGVPVFNSPFCNSRSVAELIICEI 468 SKTKVTEKILSEAKRLLAIGCFCIGTDQVDLIEAEKRGVPVFNSPFCNSRSVAELIICEI Sbjct: 61 SKTKVTEKILSEAKRLLAIGCFCIGTDQVDLIEAEKRGVPVFNSPFCNSRSVAELIICEI 120
Query: 469 ITLSRKLGDRSTEMHNKIWRKESANCHEIRGKTLGIIGYGHIGSQVQIV 615 ITLSRKLGDRSTEMHNKIWRKESANCHEIRGKTLGIIGYGHIGSQ+ ++ Sbjct: 121 ITLSRKLGDRSTEMHNKIWRKESANCHEIRGKTLGIIGYGHIGSQLSVL 169
Score = 247 bits (631), Expect = 5e-64 Identities = 125/138 (90%), Positives = 125/138 (90%) Frame = +3
Query: 600 PSANCKDWECELQKCPNTILTPHIGGSTEEAQEAIGLEVSDLIVQFINSGASAGSVNFPE 779 PSANCKDWECELQKCPNTILTPHIGGSTEEAQEAIGLEVSDLIVQFINSGASAGSVNFPE Sbjct: 270 PSANCKDWECELQKCPNTILTPHIGGSTEEAQEAIGLEVSDLIVQFINSGASAGSVNFPE 329
Query: 780 IALPVSPSTHRILNIHNNKPGVLRDINNILSEFNVSAQVLSTRKQIGYIIADVDXXXXXX 959 IALPVSPSTHRILNIHNNKPGVLRDINNILSEFNVSAQVLSTRKQIGYIIADVD Sbjct: 330 IALPVSPSTHRILNIHNNKPGVLRDINNILSEFNVSAQVLSTRKQIGYIIADVDSEASKE 389
Query: 960 XXXXXXXLPNSIKTRVLY 1013 LPNSIKTRVLY Sbjct: 390 IKKKISSLPNSIKTRVLY 407
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 1,638,742,655 Number of extensions: 31382623 Number of successful extensions: 78874 Number of sequences better than 10.0: 1710 Number of HSP's gapped: 77938 Number of HSP's successfully gapped: 2142 Length of query: 366 Length of database: 1,040,966,779 Length adjustment: 130 Effective length of query: 236 Effective length of database: 624,409,729 Effective search space: 147360696044 Effective search space used: 147360696044 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|