| Contig-U10221-1 |
| Contig ID |
Contig-U10221-1 |
| Contig update |
2002. 9.13 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1070 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
4475414 |
| End point |
4474374 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
28 |
| Number of EST |
32 |
| Link to clone list |
U10221 |
| List of clone(s) |
est1=VFJ356E,1,1005
est2=VFL637E,1,996
est3=VFC569E,2,1025
est4=VFI128E,12,967
est5=VFE227F,13,277
est6=VFM339E,14,1031
est7=VFL148E,17,996
est8=VFF107F,18,421
est9=VSF707E,32,1008
est10=VSG136E,33,992
est11=VSI822F,33,469
est12=VSF210E,36,1044
est13=VSG692F,38,521
est14=VSF774E,40,973
est15=VSD626E,41,1031
est16=SLD763F,67,347
est17=VSH532E,72,1018
est18=VSF386E,161,1008
est19=VFL832Z,255,996
est20=VFJ708Z,303,982
est21=VSA648Z,351,1027
est22=VSB758Z,371,1042
est23=VSB302Z,372,1037
est24=VFF107Z,412,1017
est25=VSB120Z,438,1046
est26=VFM152Z,467,1006
est27=VFE227Z,468,1053
est28=VSE668Z,507,1071
est29=VSC568Z,515,1059
est30=VSI822Z,525,1002
est31=VFG576Z,777,990
est32=SLD763Z,783,1026
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.18 |
| Homology vs DNA |
Query= Contig-U10221-1 (Contig-U10221-1Q) /CSM_Contig/Contig-U10221-1Q.Seq.d
(1070 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AU267583) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 9
(AU264330) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 9
(AU261630) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 8
(BJ434919) Dictyostelium discoideum cDNA clone:ddv25n09, 3' ... 579 0.0 9
(BJ434624) Dictyostelium discoideum cDNA clone:ddv24p08, 3' ... 579 0.0 7
(BJ434594) Dictyostelium discoideum cDNA clone:ddv24i10, 3' ... 579 0.0 9
(BJ432760) Dictyostelium discoideum cDNA clone:ddv19p13, 3' ... 579 0.0 6
(BJ432010) Dictyostelium discoideum cDNA clone:ddv17g07, 3' ... 579 0.0 9
(BJ430256) Dictyostelium discoideum cDNA clone:ddv6i17, 3' e... 579 0.0 9
(BJ432908) Dictyostelium discoideum cDNA clone:ddv20p01, 3' ... 505 0.0 10
(BJ433952) Dictyostelium discoideum cDNA clone:ddv23o11, 3' ... 579 0.0 7
(AU262226) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 7
(AU261939) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 7
(AU265771) Dictyostelium discoideum vegetative cDNA clone:VS... 563 0.0 7
(BJ428220) Dictyostelium discoideum cDNA clone:ddv11m01, 3' ... 579 0.0 7
(AU264329) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 5
(AU265155) Dictyostelium discoideum vegetative cDNA clone:VS... 343 0.0 8
(AU261827) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 6
(AU265652) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 6
(AU265156) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 5
(AU266020) Dictyostelium discoideum vegetative cDNA clone:VS... 573 0.0 6
(BJ413895) Dictyostelium discoideum cDNA clone:ddv17g07, 5' ... 488 0.0 7
(BJ415707) Dictyostelium discoideum cDNA clone:ddv23o11, 5' ... 488 0.0 7
(BJ430926) Dictyostelium discoideum cDNA clone:ddv9e08, 3' e... 579 0.0 5
(BJ416246) Dictyostelium discoideum cDNA clone:ddv25n09, 5' ... 488 0.0 7
(AU267582) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 7
(AU264871) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 7
(AU263282) Dictyostelium discoideum vegetative cDNA clone:VS... 579 0.0 5
(AU262648) Dictyostelium discoideum vegetative cDNA clone:VS... 581 0.0 3
(AU269283) Dictyostelium discoideum vegetative cDNA clone:VS... 607 0.0 2
(AU266731) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 5
(BJ412001) Dictyostelium discoideum cDNA clone:ddv6i17, 5' e... 488 0.0 5
(AU264872) Dictyostelium discoideum vegetative cDNA clone:VS... 519 0.0 4
(AU266019) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 4
(BJ434960) Dictyostelium discoideum cDNA clone:ddv25g13, 3' ... 579 0.0 3
(AU269282) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 4
(AU265651) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 4
(AU265770) Dictyostelium discoideum vegetative cDNA clone:VS... 488 0.0 4
(BJ414583) Dictyostelium discoideum cDNA clone:ddv19p13, 5' ... 476 0.0 3
(BJ410088) Dictyostelium discoideum cDNA clone:ddv11m01, 5' ... 482 e-176 3
(BJ415967) Dictyostelium discoideum cDNA clone:ddv24i10, 5' ... 482 e-167 3
(AU061325) Dictyostelium discoideum slug cDNA, clone SLD763. 468 e-131 2
(BJ412629) Dictyostelium discoideum cDNA clone:ddv9e08, 5' e... 367 6e-97 1
(AU052688) Dictyostelium discoideum slug cDNA, clone SLD763. 335 2e-87 1
(BJ431609) Dictyostelium discoideum cDNA clone:ddv14g19, 3' ... 333 8e-87 1
(AU222300) Caenorhabditis elegans cDNA clone:yk1014e05 : 3' ... 119 3e-30 2
(EC760800) PSE00003445 rw_mgpallid Polysphondylium pallidum ... 52 0.044 1
(AC147012) Medicago truncatula clone mth2-151j16, WORKING DR... 50 0.17 1
(CR351410) mte1-86J16FM1 BAC end, cultivar Jemalong A17 of M... 50 0.17 1
(CR350901) mte1-86I15FM1 BAC end, cultivar Jemalong A17 of M... 50 0.17 1
(CR319866) mte1-45B24FM1 BAC end, cultivar Jemalong A17 of M... 50 0.17 1
(AC213020) Zea mays chromosome 3 clone CH201-458F20; ZMMBBc0... 38 0.38 2
(AC204633) Zea mays chromosome 6 clone CH201-22K15; ZMMBBc00... 38 0.38 2
(BZ419660) if57d10.b1 WGS-ZmaysF (DH5a methyl filtered) Zea ... 38 0.50 2
(ED074633) AUAC-aaz55g08.g1 Ascaris suum whole genome shotgu... 48 0.69 1
(EX566360) AIAE-aaa79b11.b1 Ancylostoma_caninum_EST_Female_p... 48 0.69 1
(AC202074) Zea mays chromosome 3 clone CH201-307O18; ZMMBBc0... 46 2.7 1
(CC176948) ZMMBBc0304C12r ZMMBBc Zea mays subsp. mays genomi... 46 2.7 1
(AC160196) Bos taurus clone CH240-83N23, WORKING DRAFT SEQUE... 34 5.1 2
(AC166537) Bos taurus clone CH240-40G12, WORKING DRAFT SEQUE... 34 5.1 2
(EH645587) AU_Cv_EST_008B_F01 Oyster mixed tissue normalized... 32 7.0 2
(CC763710) CH240_41I9.TJ CHORI-240 Bos taurus genomic clone ... 34 7.3 2
(BX038766) Single read from an extremity of a full-length cD... 30 8.6 3
>(AU267583) Dictyostelium discoideum vegetative cDNA clone:VSH532,
3' end single read.
Length = 690
Score = 579 bits (292), Expect(9) = 0.0
Identities = 295/296 (99%)
Strand = Plus / Plus
Query: 659 tacaatacattgtctgtagattattcaaaagtatttgaacaattcaaactctctgtattc 718
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 332 tacaatacattgtctgtagattattcaaaagtatttgaacaattcaaactctctgtattc 391
Query: 719 gatatctttgctcaaacttactctcgttccgttcaagagacccttttcctcattgccaaa 778
|||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||
Sbjct: 392 gatatctttgctcaaacttactctcgttccgttcaagagaccctcttcctcattgccaaa 451
Query: 779 gatgtcatctccaaagtaccacaagttgaacaagtccacctttcccttccaaataaacat 838
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 452 gatgtcatctccaaagtaccacaagttgaacaagtccacctttcccttccaaataaacat 511
Query: 839 gcttttggtttcgatttctcacgtttaaatattgaaaataatcaaactgttttccaacca 898
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 512 gcttttggtttcgatttctcacgtttaaatattgaaaataatcaaactgttttccaacca 571
Query: 899 gttgaagaaccatcaggtttaatcgaaggtacaattaaaagatcacattcaagatt 954
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 572 gttgaagaaccatcaggtttaatcgaaggtacaattaaaagatcacattcaagatt 627
Score = 220 bits (111), Expect(9) = 0.0
Identities = 111/111 (100%)
Strand = Plus / Plus
Query: 524 ctctggtattgacgatcttttgattatgaaaaccactcaaagcggattcgaaggtttcca 583
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 199 ctctggtattgacgatcttttgattatgaaaaccactcaaagcggattcgaaggtttcca 258
Query: 584 ccgtgacaaatacacctcattgaaagagaccaaagatagagtctttgcaac 634
|||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 259 ccgtgacaaatacacctcattgaaagagaccaaagatagagtctttgcaac 309
Score = 180 bits (91), Expect(9) = 0.0
Identities = 93/94 (98%)
Strand = Plus / Plus
Query: 349 tttttagccacctattcatgggtaaacggagttgaggttgtcatgcgtgagaatcaatgg 408
|||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||
Sbjct: 29 tttttagccacctattcatgggtaaacgnagttgaggttgtcatgcgtgagaatcaatgg 88
Query: 409 cgtcgtattaagacctccaatggcaaggaacaag 442
||||||||||||||||||||||||||||||||||
Sbjct: 89 cgtcgtattaagacctccaatggcaaggaacaag 122
Score = 73.8 bits (37), Expect(9) = 0.0
Identities = 37/37 (100%)
Strand = Plus / Plus
Query: 443 gctcattcattccaacgtgatagagagatccattcgg 479
|||||||||||||||||||||||||||||||||||||
Sbjct: 122 gctcattcattccaacgtgatagagagatccattcgg 158
Score = 44.1 bits (22), Expect(9) = 0.0
Identities = 22/22 (100%)
Strand = Plus / Plus
Query: 331 ttttattgggtaaacacttttt 352
||||||||||||||||||||||
Sbjct: 12 ttttattgggtaaacacttttt 33
Score = 44.1 bits (22), Expect(9) = 0.0
Identities = 22/22 (100%)
Strand = Plus / Plus
Query: 635 ctgtagttactgcaaattggac 656
||||||||||||||||||||||
Sbjct: 309 ctgtagttactgcaaattggac 330
Score = 36.2 bits (18), Expect(9) = 0.0
Identities = 18/18 (100%)
Strand = Plus / Plus
Query: 506 aaatcaccagtggttgtc 523
||||||||||||||||||
Sbjct: 182 aaatcaccagtggttgtc 199
Score = 34.2 bits (17), Expect(9) = 0.0
Identities = 17/17 (100%)
Strand = Plus / Plus
Query: 479 ggttacagtgacatcat 495
|||||||||||||||||
Sbjct: 157 ggttacagtgacatcat 173
Score = 30.2 bits (15), Expect(9) = 0.0
Identities = 15/15 (100%)
Strand = Plus / Plus
Query: 319 agagtatggtatttt 333
|||||||||||||||
Sbjct: 1 agagtatggtatttt 15
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 938,386,334
Number of extensions: 50468525
Number of successful extensions: 3847450
Number of sequences better than 10.0: 63
Length of query: 1070
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1046
Effective length of database: 97,308,875,965
Effective search space: 101785084259390
Effective search space used: 101785084259390
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.27 |
| Homology vs Protein |
Query= Contig-U10221-1 (Contig-U10221-1Q) /CSM_Contig/Contig-U10221-1Q.Seq.d
(1070 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CP000454_3401(CP000454|pid:none) Arthrobacter sp. FB24, complete... 67 1e-32
CP001341_3166(CP001341|pid:none) Arthrobacter chlorophenolicus A... 67 1e-32
DQ365935_1(DQ365935|pid:none) Pinus taeda urate oxidase mRNA, co... 62 2e-31
AP009152_1977(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 80 1e-30
AP011115_1269(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 72 2e-30
CP000750_2064(CP000750|pid:none) Kineococcus radiotolerans SRS30... 68 3e-29
CU928179_388(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 74 3e-29
CP000820_2209(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 63 7e-29
CP000249_1891(CP000249|pid:none) Frankia sp. CcI3, complete geno... 64 1e-28
BA000030_2025(BA000030|pid:none) Streptomyces avermitilis MA-468... 68 2e-28
CT573213_4408(CT573213|pid:none) Frankia alni str. ACN14A chromo... 61 6e-28
CP000496_80(CP000496|pid:none) Pichia stipitis CBS 6054 chromoso... 60 1e-24
AM746676_4028(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 111 4e-23
AM420293_6547(AM420293|pid:none) Saccharopolyspora erythraea NRR... 110 8e-23
(P11645) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 69 1e-22
FN392320_1033(FN392320|pid:none) Pichia pastoris GS115 chromosom... 108 4e-22
DQ165080_1(DQ165080|pid:none) Protopterus annectens urate oxidas... 69 5e-22
AX069397_1(AX069397|pid:none) Sequence 61 from Patent WO0102600.... 65 9e-22
CP000474_3264(CP000474|pid:none) Arthrobacter aurescens TC1, com... 72 2e-21
(P25689) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 65 2e-21
(Q5FZI9) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 65 2e-21
(Q3MHG7) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 64 3e-21
BC061935_1(BC061935|pid:none) Xenopus laevis urate oxidase, mRNA... 69 3e-21
(Q8MKJ2) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 65 4e-21
(Q8MKJ3) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 65 6e-21
AP011115_4429(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 76 1e-20
FJ826531_1(FJ826531|pid:none) Perca flavescens urate oxidase mRN... 62 2e-19
J03959_1(J03959|pid:none) Rat uricase mRNA, 3' end. 62 2e-18
CU458896_2904(CU458896|pid:none) Mycobacterium abscessus chromos... 65 2e-18
CR382125_479(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 92 3e-17
AP006618_5262(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 66 6e-17
(O74409) RecName: Full=Probable uricase; EC=1.7.3.3; Al... 91 9e-17
AE017349_244(AE017349|pid:none) Cryptococcus neoformans var. neo... 63 1e-16
CP001349_5589(CP001349|pid:none) Methylobacterium nodulans ORS 2... 69 1e-16
CP001001_198(CP001001|pid:none) Methylobacterium radiotolerans J... 64 3e-15
CP000358_397(CP000358|pid:none) Deinococcus geothermalis DSM 113... 71 4e-15
(O04420) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 56 5e-15
Y11120_1(Y11120|pid:none) A.thaliana mRNA for nodulin-35 homolog... 55 5e-15
(O04104) RecName: Full=Uricase-2 isozyme 2; EC=1.7.3.3;... 56 1e-14
A25776(A25776)urate oxidase (EC 1.7.3.3) - soybean 56 1e-14
L00353_1(L00353|pid:none) Soybean nodulin-35 mRNA encoding a sub... 58 1e-14
(P04670) RecName: Full=Uricase-2 isozyme 1; EC=1.7.3.3;... 57 1e-14
D86929_1(D86929|pid:none) Glycine max mRNA for uricase, complete... 57 1e-14
A35892(A35892)probable urate oxidase pseudogene - human (fragment) 60 4e-14
(P22673) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 60 5e-14
(P78609) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 81 7e-14
(Q00511) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 57 1e-13
(P16163) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 57 4e-13
BT044508_1(BT044508|pid:none) Drosophila melanogaster FI07606 fu... 57 4e-13
AB038708_1(AB038708|pid:none) Tolypocladium inflatum gene for ur... 56 7e-13
BT077389_1(BT077389|pid:none) Lepeophtheirus salmonis clone lsal... 64 9e-13
DQ189992_1(DQ189992|pid:none) Bombyx mori uricase mRNA, complete... 60 1e-12
EU963783_1(EU963783|pid:none) Zea mays clone 272624 uricase mRNA... 76 2e-12
FM992689_15(FM992689|pid:none) Candida dubliniensis CD36 chromos... 75 4e-12
AM920437_2096(AM920437|pid:none) Penicillium chrysogenum Wiscons... 50 6e-12
AJ698901_1(AJ698901|pid:none) Fusarium fujikuroi mRNA for uricas... 50 1e-11
X07497_1(X07497|pid:none) Rat mRNA for uricase (EC 1.7.3.3). 62 3e-11
(P33282) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 55 5e-11
AB038707_1(AB038707|pid:none) Beauveria bassiana gene for uricas... 70 1e-10
BT077117_1(BT077117|pid:none) Caligus rogercresseyi clone crog-e... 69 2e-10
AB038699_1(AB038699|pid:none) Laodelphax striatellus yeast-like ... 50 3e-10
AB038706_1(AB038706|pid:none) Cerataphis fransseni yeast-like sy... 50 3e-10
AY754580_1(AY754580|pid:none) Drosophila miranda strain MSH22 ur... 55 4e-10
AB027293_1(AB027293|pid:none) Nilaparvata lugens yeast-like symb... 50 5e-10
AB161978_1(AB161978|pid:none) Aspergillus oryzae UOX mRNA for ur... 44 2e-08
AY754581_1(AY754581|pid:none) Drosophila miranda strain 0101.3 u... 55 2e-08
AB043134_1(AB043134|pid:none) Lotus japonicus LjUr mRNA for uric... 60 1e-07
DQ165081_1(DQ165081|pid:none) Gadus morhua urate oxidase mRNA, p... 59 2e-07
(P53763) RecName: Full=Uricase-2; EC=1.7.3.3; AltName: ... 59 3e-07
DQ365934_1(DQ365934|pid:none) Solanum tuberosum urate oxidase mR... 58 5e-07
DQ365936_1(DQ365936|pid:none) Saccharum officinarum urate oxidas... 57 8e-07
AB043137_1(AB043137|pid:none) Astragalus sinicus AsUr5 mRNA for ... 56 2e-06
AP003270_7(AP003270|pid:none) Oryza sativa Japonica Group genomi... 55 3e-06
DQ365939_1(DQ365939|pid:none) Hordeum vulgare subsp. vulgare ura... 55 3e-06
S75621_1(S75621|pid:none) uricase II [Phaseolus vulgaris, cv. Te... 55 4e-06
AB028149_1(AB028149|pid:none) Medicago sativa MsU2 mRNA for uric... 55 4e-06
(P34798) RecName: Full=Uricase-2 isozyme 1; EC=1.7.3.3;... 55 5e-06
DQ365931_1(DQ365931|pid:none) Medicago truncatula urate oxidase ... 54 9e-06
AM458438_1(AM458438|pid:none) Vitis vinifera contig VV78X022290.... 54 9e-06
AB043135_1(AB043135|pid:none) Pisum sativum PsUr mRNA for uricas... 54 9e-06
T34865(T34865)probable oxidoreductase - Streptomyces coelicolor ... 54 1e-05
EU068003_1(EU068003|pid:none) Taeniopygia guttata urate oxidase ... 51 1e-05
AP006627_3724(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 35 2e-05
BT043285_1(BT043285|pid:none) Zea mays full-length cDNA clone ZM... 52 3e-05
BT040342_1(BT040342|pid:none) Zea mays full-length cDNA clone ZM... 52 3e-05
BT036005_1(BT036005|pid:none) Zea mays full-length cDNA clone ZM... 51 6e-05
AB002807_1(AB002807|pid:none) Glycine max DNA for nodulin 35, pa... 48 5e-04
CP000473_355(CP000473|pid:none) Solibacter usitatus Ellin6076, c... 46 0.003
(Q45697) RecName: Full=Uricase; EC=1.7.3.3; AltName: Fu... 35 0.008
D49974_1(D49974|pid:none) Bacillus sp. TB-90 uao gene for uricas... 35 0.008
CP000413_25(CP000413|pid:none) Lactobacillus gasseri ATCC 33323,... 35 3.4
CP000033_46(CP000033|pid:none) Lactobacillus acidophilus NCFM, c... 34 7.6
>CP000454_3401(CP000454|pid:none) Arthrobacter sp. FB24, complete
genome.
Length = 302
Score = 67.4 bits (163), Expect(4) = 1e-32
Identities = 30/90 (33%), Positives = 54/90 (60%)
Frame = +2
Query: 671 SVDYSKVFEQFKLSVFDIFAQTYSRSVQETLFLIAKDVISKVPQVEQVHLSLPNKHAFGF 850
++D++K +E K + + F + YS ++Q+TLF + V+ +++++ S+PNKH F
Sbjct: 196 ALDFNKSYEDVKSLLLEGFTEKYSHALQQTLFDMGAKVLEAHSEIDEIKFSMPNKHHFLV 255
Query: 851 DFSRLNIENNQTVFQPVEEPSGLIEGTIKR 940
D S ++N VF + P GLIE T++R
Sbjct: 256 DLSPFGLDNPNEVFFAADRPYGLIEATVQR 285
Score = 59.3 bits (142), Expect(4) = 1e-32
Identities = 30/65 (46%), Positives = 45/65 (69%)
Frame = +2
Query: 104 NRYGKARVRVLRVFKGPNEYHKVFDFDCRVLLRGAEFSETYLTGDNSKVVATDTMKNTVY 283
N+YGKA VRV+++ + + H++ D + LRG +F+ +L GDNS VVATDT KNT+Y
Sbjct: 10 NQYGKAEVRVVKITRDTDR-HEIEDLNVTSQLRG-DFAAAHLQGDNSHVVATDTQKNTIY 67
Query: 284 VIAQK 298
A++
Sbjct: 68 AFARE 72
Score = 53.9 bits (128), Expect(4) = 1e-32
Identities = 24/39 (61%), Positives = 31/39 (79%)
Frame = +3
Query: 519 LSSGIDDLLIMKTTQSGFEGFHRDKYTSLKETKDRVFAT 635
L SG+ DL ++K+TQSGF G+ RDKYT+L ET DR+ AT
Sbjct: 142 LISGLKDLTVLKSTQSGFVGYPRDKYTTLPETTDRILAT 180
Score = 23.9 bits (50), Expect(4) = 1e-32
Identities = 9/35 (25%), Positives = 15/35 (42%)
Frame = +1
Query: 349 FLATYSWVNGVEVVMRENQWRRIKTSNGKEQGSFI 453
F +++ WV G W RI+ + SF+
Sbjct: 88 FTSSFDWVTGGRWEAESYSWDRIQAHGAEHDHSFV 122
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,647,396,315
Number of extensions: 32372684
Number of successful extensions: 81879
Number of sequences better than 10.0: 92
Number of HSP's gapped: 81676
Number of HSP's successfully gapped: 271
Length of query: 356
Length of database: 1,040,966,779
Length adjustment: 129
Effective length of query: 227
Effective length of database: 627,614,014
Effective search space: 142468381178
Effective search space used: 142468381178
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
15 |
| VH (FL, L) |
0 |
| VF (FL, S) |
12 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |