Homology vs DNA |
Query= Contig-U10201-1 (Contig-U10201-1Q) /CSM_Contig/Contig-U10201-1Q.Seq.d (1179 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ435730) Dictyostelium discoideum cDNA clone:ddv28h01, 3' ... 940 0.0 3 (BJ431170) Dictyostelium discoideum cDNA clone:ddv13h05, 3' ... 940 0.0 3 (BJ433390) Dictyostelium discoideum cDNA clone:ddv21o14, 3' ... 894 0.0 2 (AU034000) Dictyostelium discoideum slug cDNA, clone SLB714. 842 0.0 3 (BJ432504) Dictyostelium discoideum cDNA clone:ddv18k20, 3' ... 813 0.0 4 (AU060847) Dictyostelium discoideum slug cDNA, clone SLB714. 545 0.0 3 (BJ431498) Dictyostelium discoideum cDNA clone:ddv14l07, 3' ... 940 0.0 3 (BJ413158) Dictyostelium discoideum cDNA clone:ddv14l07, 5' ... 545 0.0 3 (BJ415175) Dictyostelium discoideum cDNA clone:ddv21o14, 5' ... 545 0.0 4 (BJ414353) Dictyostelium discoideum cDNA clone:ddv18k20, 5' ... 545 0.0 4 (BJ412850) Dictyostelium discoideum cDNA clone:ddv13h05, 5' ... 545 0.0 4 (BJ417583) Dictyostelium discoideum cDNA clone:ddv28h01, 5' ... 545 0.0 3 (AU061305) Dictyostelium discoideum slug cDNA, clone SLD722. 272 e-103 2 (FC702649) CAXY1129.rev CAXY Lottia gigantea from male gonad... 196 7e-61 3 (FC713137) CAXY8179.rev CAXY Lottia gigantea from male gonad... 196 7e-61 3 (FC713138) CAXY8179.fwd CAXY Lottia gigantea from male gonad... 196 7e-61 3 (FC665452) CAXW4371.fwd CAXW Lottia gigantea from female gon... 196 7e-61 3 (FC747967) CBBI3587.rev CBBI Lottia gigantea 26h,37h,61h Lar... 196 7e-61 3 (FC751615) CBBI5870.rev CBBI Lottia gigantea 26h,37h,61h Lar... 196 7e-61 3 (FC776836) CBGB761.rev CBGB Lottia gigantea 3,6,9,12h embryo... 196 7e-61 3 (FC747459) CBBI3229.rev CBBI Lottia gigantea 26h,37h,61h Lar... 196 7e-61 3 (FC665451) CAXW4371.rev CAXW Lottia gigantea from female gon... 196 7e-61 3 (FC685264) CAXX18130.rev CAXX Lottia gigantea from male gona... 196 7e-61 3 (FC725398) CBBG2797.rev CBBG Lottia gigantea 12,15,18h embry... 196 7e-61 3 (FC569917) CAWF8657.fwd CAWF Lottia gigantea from mantle (H)... 196 7e-61 3 (FC682989) CAXX16768.fwd CAXX Lottia gigantea from male gona... 196 7e-61 3 (FE267783) CAZO6337.rev CAZO Naegleria gruberi Flagellate St... 214 3e-59 2 (FC740452) CBBI11844.fwd CBBI Lottia gigantea 26h,37h,61h La... 186 6e-58 3 (FC682988) CAXX16768.rev CAXX Lottia gigantea from male gona... 196 3e-56 2 (CP000083) Colwellia psychrerythraea 34H, complete genome. 196 1e-45 1 (EK112908) 1092963138963 Global-Ocean-Sampling_GS-31-01-01-1... 163 2e-35 1 (EJ282132) 1095366061383 Global-Ocean-Sampling_GS-27-01-01-1... 159 3e-34 1 (EJ058182) 1095456042805 Global-Ocean-Sampling_GS-26-01-01-1... 153 2e-32 1 (EK202940) 1095460063898 Global-Ocean-Sampling_GS-31-01-01-1... 151 7e-32 1 (EK031604) 1092955413723 Global-Ocean-Sampling_GS-31-01-01-1... 145 3e-31 2 (EJ249072) 1095344016390 Global-Ocean-Sampling_GS-27-01-01-1... 117 8e-31 2 (EK288325) 1095462320249 Global-Ocean-Sampling_GS-31-01-01-1... 147 1e-30 1 (EJ774660) 1092985200129 Global-Ocean-Sampling_GS-30-02-01-1... 147 1e-30 1 (EJ768165) 1092963336397 Global-Ocean-Sampling_GS-30-02-01-1... 147 1e-30 1 (EV847764) FMMCM75TF Tetrahymena thermophila SB210 cDNA libr... 127 3e-30 2 (EJ495009) 1095403565516 Global-Ocean-Sampling_GS-28-01-01-1... 145 4e-30 1 (EJ723791) 1092959476776 Global-Ocean-Sampling_GS-30-02-01-1... 143 2e-29 1 (EK429997) 1095516139961 Global-Ocean-Sampling_GS-31-01-01-1... 98 4e-28 3 (DY680240) TTDA632TG Tetrahymena thermophila EST library str... 119 7e-28 2 (DY680241) TTDA632TO Tetrahymena thermophila EST library str... 119 7e-28 2 (EK082756) 1092961117551 Global-Ocean-Sampling_GS-31-01-01-1... 86 3e-27 2 (ER525878) 1093015638917 Global-Ocean-Sampling_GS-35-01-01-1... 135 4e-27 1 (EK151803) 1095456055482 Global-Ocean-Sampling_GS-31-01-01-1... 135 4e-27 1 (DU747972) ASNC4090.g2 HF10_10-07-02 uncultured marine micro... 135 4e-27 1 (EK201607) 1095460058228 Global-Ocean-Sampling_GS-31-01-01-1... 133 2e-26 1 (EJ455335) 1093017439982 Global-Ocean-Sampling_GS-28-01-01-1... 133 2e-26 1 (FF664810) G826P5347FB4.T0 Acorn worm normalized juvenile pE... 133 2e-26 1 (FF625977) G825P5319RD1.T0 Acorn worm normalized gastrula pE... 70 3e-26 3 (EK062574) 1092960097458 Global-Ocean-Sampling_GS-31-01-01-1... 88 5e-26 4 (EK403428) 1095469552986 Global-Ocean-Sampling_GS-31-01-01-1... 131 7e-26 1 (EK366417) 1095469399934 Global-Ocean-Sampling_GS-31-01-01-1... 131 7e-26 1 (BW643605) Dugesia ryukyuensis mRNA, clone: Dr_sW_027_N17, 5... 131 7e-26 1 (BW640254) Dugesia ryukyuensis mRNA, clone: Dr_sW_017_J16, 5... 131 7e-26 1 (FF617806) G825P5210FH9.T0 Acorn worm normalized gastrula pE... 131 7e-26 1 (EJ144742) 1092343683956 Global-Ocean-Sampling_GS-27-01-01-1... 111 7e-26 2 (FF482072) G613P6322RF9.T0 Acorn worm blastula/gastrula pCMV... 94 2e-25 2 (FF608834) G825P5142RF12.T0 Acorn worm normalized gastrula p... 94 2e-25 2 (FF613813) G825P5176RB5.T0 Acorn worm normalized gastrula pE... 94 2e-25 2 (FF499275) G708P594RE2.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (FF513642) G709P568RE7.T0 Acorn worm normalized neurula pExp... 94 2e-25 2 (FF506887) G709P5211RA5.T0 Acorn worm normalized neurula pEx... 94 2e-25 2 (FF610150) G825P5150RG5.T0 Acorn worm normalized gastrula pE... 94 2e-25 2 (FF484844) G708P50FF3.T0 Acorn worm normalized gastrula pExp... 94 2e-25 2 (FF512409) G709P555RE8.T0 Acorn worm normalized neurula pExp... 94 2e-25 2 (FF484845) G708P50RF3.T0 Acorn worm normalized gastrula pExp... 94 2e-25 2 (FF493152) G708P5223RG12.T0 Acorn worm normalized gastrula p... 94 2e-25 2 (FF623801) G825P52RE11.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (FF486051) G708P5114RD2.T0 Acorn worm normalized gastrula pE... 94 2e-25 2 (FF639472) G825P59FE11.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (FF639337) G825P599RG1.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (FF603357) G825P5108FG5.T0 Acorn worm normalized gastrula pE... 94 2e-25 2 (FF513641) G709P568FE7.T0 Acorn worm normalized neurula pExp... 94 2e-25 2 (FF465288) G50P6267RG9.T0 Acorn worm gastrula/neurula pCMVSp... 94 2e-25 2 (FF613392) G825P5173FB5.T0 Acorn worm normalized gastrula pE... 94 2e-25 2 (FF518711) G710P5215RC11.T0 Acorn worm normalized juvenile p... 94 2e-25 2 (FF670142) G826P5383FE11.T0 Acorn worm normalized juvenile p... 94 2e-25 2 (FF623800) G825P52FE11.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (FF665482) G826P5350FF7.T0 Acorn worm normalized juvenile pE... 94 2e-25 2 (FF633336) G825P559FG3.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (FF518710) G710P5215FC11.T0 Acorn worm normalized juvenile p... 94 2e-25 2 (FF633091) G825P558FB9.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (FF510654) G709P531RB4.T0 Acorn worm normalized neurula pExp... 94 2e-25 2 (DB779151) Apis mellifera head cDNA, RIKEN full-length enric... 88 2e-25 2 (FF633310) G825P559RE8.T0 Acorn worm normalized gastrula pEx... 94 2e-25 2 (BI512993) BB160010B20C03.5 Bee Brain Normalized Library, BB... 88 2e-25 2 (EJ774672) 1092985200141 Global-Ocean-Sampling_GS-30-02-01-1... 113 3e-25 2 (EJ725447) 1092959496372 Global-Ocean-Sampling_GS-30-02-01-1... 129 3e-25 1 (EJ876074) 1093018370203 Global-Ocean-Sampling_GS-30-02-01-1... 105 3e-25 4 (FF622395) G825P5249RA2.T0 Acorn worm normalized gastrula pE... 94 6e-25 2 (FF527592) G710P5341RH9.T0 Acorn worm normalized juvenile pE... 92 6e-25 2 (EJ795564) 1093017399297 Global-Ocean-Sampling_GS-30-02-01-1... 98 1e-24 4 (EJ889131) 1093018433117 Global-Ocean-Sampling_GS-30-02-01-1... 98 1e-24 4 (EK396616) 1095469523910 Global-Ocean-Sampling_GS-31-01-01-1... 66 2e-24 3 (FF633092) G825P558RB9.T0 Acorn worm normalized gastrula pEx... 94 2e-24 2 (FF613812) G825P5176FB5.T0 Acorn worm normalized gastrula pE... 125 4e-24 1
>(BJ435730) Dictyostelium discoideum cDNA clone:ddv28h01, 3' end, single read. Length = 721
Score = 940 bits (474), Expect(3) = 0.0 Identities = 474/474 (100%) Strand = Plus / Minus
Query: 586 gttcgtacaacagctttcgataaagccccaacaagcggtggttcggcaaaggtcgtctct 645 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 525 gttcgtacaacagctttcgataaagccccaacaagcggtggttcggcaaaggtcgtctct 466
Query: 646 gccaacgattgggctgtaccattaattgagaaagcaatctctgaaacaaacattaaatgg 705 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 465 gccaacgattgggctgtaccattaattgagaaagcaatctctgaaacaaacattaaatgg 406
Query: 706 gaatcttctgaagttaaaaaatctgaacgtccagaattaacaagtgctcgtgttgtagta 765 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 405 gaatcttctgaagttaaaaaatctgaacgtccagaattaacaagtgctcgtgttgtagta 346
Query: 766 tctggtggtagaggtatgaaaaatggtgaaaactttaaaatgttagaagaattagctgat 825 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 345 tctggtggtagaggtatgaaaaatggtgaaaactttaaaatgttagaagaattagctgat 286
Query: 826 actttaggtggtgcagttggtgcatcaagagcagctgttgattcaggttttgtttcaaat 885 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 285 actttaggtggtgcagttggtgcatcaagagcagctgttgattcaggttttgtttcaaat 226
Query: 886 gatttacaagttggtcaaactggtaagattgtagcaccagaattatatattgctgttggt 945 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 225 gatttacaagttggtcaaactggtaagattgtagcaccagaattatatattgctgttggt 166
Query: 946 attagtggtgctattcaacatttagctggtatgaaagatagtaaagtaattgttgctatc 1005 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 165 attagtggtgctattcaacatttagctggtatgaaagatagtaaagtaattgttgctatc 106
Query: 1006 aataaagatccagaagcaccaatctttcaagttgctgatgttggtttagttggt 1059 |||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 105 aataaagatccagaagcaccaatctttcaagttgctgatgttggtttagttggt 52
Score = 375 bits (189), Expect(3) = 0.0 Identities = 189/189 (100%) Strand = Plus / Minus
Query: 397 ttacacacatcttcacaccagcatccaattttggtaaaaacttcttaccaagagtcgcag 456 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 713 ttacacacatcttcacaccagcatccaattttggtaaaaacttcttaccaagagtcgcag 654
Query: 457 cattattaaacgtttcacaaattagcgagattacaaaagtaaaagacgctgaaactttcc 516 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 653 cattattaaacgtttcacaaattagcgagattacaaaagtaaaagacgctgaaactttcc 594
Query: 517 aaagaccaatctacgctggcaatgcaatcgccaccgttaaatcaactgataaatgtaaag 576 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 593 aaagaccaatctacgctggcaatgcaatcgccaccgttaaatcaactgataaatgtaaag 534
Query: 577 ttggtactg 585 ||||||||| Sbjct: 533 ttggtactg 525
Score = 38.2 bits (19), Expect(3) = 0.0 Identities = 19/19 (100%) Strand = Plus / Minus
Query: 1061 atttattcaatgaagttcc 1079 ||||||||||||||||||| Sbjct: 51 atttattcaatgaagttcc 33
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,108,007,441 Number of extensions: 62692156 Number of successful extensions: 4880792 Number of sequences better than 10.0: 2318 Length of query: 1179 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1155 Effective length of database: 97,308,875,965 Effective search space: 112391751739575 Effective search space used: 112391751739575 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
Homology vs Protein |
Query= Contig-U10201-1 (Contig-U10201-1Q) /CSM_Contig/Contig-U10201-1Q.Seq.d (1179 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q54FD7) RecName: Full=Electron transfer flavoprotein subunit al... 328 2e-88 CP000094_4111(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 216 6e-87 CP000075_2172(CP000075|pid:none) Pseudomonas syringae pv. syring... 214 1e-86 CP000075_1995(CP000075|pid:none) Pseudomonas syringae pv. syring... 213 1e-86 CP000949_3502(CP000949|pid:none) Pseudomonas putida W619, comple... 213 2e-86 CP000926_3747(CP000926|pid:none) Pseudomonas putida GB-1, comple... 213 4e-86 CP000713_610(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 202 8e-86 (Q9HZP7) RecName: Full=Electron transfer flavoprotein subunit al... 216 1e-85 CP000744_2186(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 216 1e-85 CP001052_2925(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 210 2e-85 CU695242_197(CU695242|pid:none) Ralstonia solanacearum strain Mo... 211 3e-85 CP001157_1377(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 209 3e-85 CP000155_3749(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 212 4e-85 AM490468_1(AM490468|pid:none) Herbaspirillum seropedicae etfA ge... 205 4e-85 AY658876_1(AY658876|pid:none) Synthetic construct Peudomonas aer... 213 7e-85 CU459003_3033(CU459003|pid:none) Magnetospirillum gryphiswaldens... 217 7e-85 CP000058_1877(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 212 7e-85 CP000613_4023(CP000613|pid:none) Rhodospirillum centenum SW, com... 223 8e-85 DQ256399_1(DQ256399|pid:none) Periplaneta americana cxpwmw03 mRN... 218 2e-84 CP000614_967(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 208 5e-84 CP000440_935(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 207 7e-84 AP009385_981(AP009385|pid:none) Burkholderia multivorans ATCC 17... 207 9e-84 CP000680_2686(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 213 9e-84 CP000378_579(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 208 1e-83 AM747720_2928(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 208 1e-83 CP001025_931(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 207 1e-83 AM260479_810(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 204 1e-83 CU633749_777(CU633749|pid:none) Cupriavidus taiwanensis str. LMG... 201 2e-83 CP000958_1018(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 207 3e-83 BX640432_193(BX640432|pid:none) Bordetella parapertussis strain ... 212 3e-83 BX640447_206(BX640447|pid:none) Bordetella bronchiseptica strain... 212 3e-83 BX571965_2522(BX571965|pid:none) Burkholderia pseudomallei strai... 204 2e-82 CP000570_2830(CP000570|pid:none) Burkholderia pseudomallei 668 c... 204 4e-82 CP000542_2049(CP000542|pid:none) Verminephrobacter eiseniae EF01... 204 6e-82 CP000090_2528(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 204 6e-82 CP000086_1631(CP000086|pid:none) Burkholderia thailandensis E264... 203 6e-82 AM167904_1361(AM167904|pid:none) Bordetella avium 197N complete ... 207 8e-82 CP001016_1722(CP001016|pid:none) Beijerinckia indica subsp. indi... 215 2e-81 CP000269_586(CP000269|pid:none) Janthinobacterium sp. Marseille,... 201 5e-81 CP001013_854(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 197 2e-80 CP000272_247(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 206 3e-80 CP000157_2700(CP000157|pid:none) Erythrobacter litoralis HTCC259... 199 3e-80 CP000152_1463(CP000152|pid:none) Burkholderia sp. 383 chromosome... 205 6e-80 CP000082_533(CP000082|pid:none) Psychrobacter arcticus 273-4, co... 196 7e-80 CP000960_838(CP000960|pid:none) Burkholderia cenocepacia MC0-3 c... 209 1e-79 CP000323_527(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 194 6e-79 CP000529_1212(CP000529|pid:none) Polaromonas naphthalenivorans C... 191 1e-78 CP001068_2599(CP001068|pid:none) Ralstonia pickettii 12J chromos... 194 3e-78 CP001010_1083(CP001010|pid:none) Polynucleobacter necessarius su... 201 4e-78 CP000512_2129(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 196 7e-78 CP000512_4228(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 196 9e-78 CP000267_1921(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 194 9e-78 CP000555_1297(CP000555|pid:none) Methylibium petroleiphilum PM1,... 190 9e-78 BX640424_290(BX640424|pid:none) Bordetella parapertussis strain ... 197 1e-77 CR378678_196(CR378678|pid:none) Photobacterium profundum SS9 chr... 200 1e-77 BX897674_23(BX897674|pid:none) Neurospora crassa DNA linkage gro... 208 2e-77 AE016796_445(AE016796|pid:none) Vibrio vulnificus CMCP6 chromoso... 207 5e-77 CP000316_3089(CP000316|pid:none) Polaromonas sp. JS666, complete... 191 7e-77 CP001154_2894(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 190 9e-77 CP000449_2360(CP000449|pid:none) Maricaulis maris MCS10, complet... 209 1e-76 CP001013_3577(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 182 2e-76 CP001172_823(CP001172|pid:none) Acinetobacter baumannii AB307-02... 193 2e-75 CP000542_4596(CP000542|pid:none) Verminephrobacter eiseniae EF01... 189 2e-75 CP001150_3091(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 205 6e-75 CP000577_319(CP000577|pid:none) Rhodobacter sphaeroides ATCC 170... 205 6e-75 CP001013_2528(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 182 6e-75 CP001013_1188(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 180 8e-75 CR543861_2410(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 191 1e-74 AM933172_795(AM933172|pid:none) Salmonella enterica subsp. enter... 186 7e-74 CP000356_177(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 192 7e-74 CP000857_831(CP000857|pid:none) Salmonella enterica subsp. enter... 185 1e-73 CP000749_1562(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 213 3e-73 CP001144_867(CP001144|pid:none) Salmonella enterica subsp. enter... 183 6e-73 CP000880_2478(CP000880|pid:none) Salmonella enterica subsp. ariz... 189 1e-72 CP000381_2013(CP000381|pid:none) Neisseria meningitidis 053442, ... 186 3e-72 CP000158_3408(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 192 5e-72 CP001016_3173(CP001016|pid:none) Beijerinckia indica subsp. indi... 179 6e-72 CP000931_2089(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 200 8e-72 BC157774_1(BC157774|pid:none) Xenopus tropicalis hypothetical pr... 226 1e-71 AE002098_2057(AE002098|pid:none) Neisseria meningitidis MC58, co... 185 2e-71 AE008323_10(AE008323|pid:none) Agrobacterium tumefaciens str. C5... 183 1e-70 CP000462_1926(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 198 7e-70 CP001029_1667(CP001029|pid:none) Methylobacterium populi BJ001, ... 193 2e-69 CR382125_612(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 198 5e-69 CP000908_1513(CP000908|pid:none) Methylobacterium extorquens PA1... 191 8e-68 CP001298_1716(CP001298|pid:none) Methylobacterium chloromethanic... 191 8e-68 CP000009_845(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 202 4e-67 AY956411_3(AY956411|pid:none) Stenotrophomonas maltophilia phosp... 179 3e-65 CP000521_2888(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 193 8e-63 AM039952_3711(AM039952|pid:none) Xanthomonas campestris pv. vesi... 181 3e-60 CU459003_1213(CU459003|pid:none) Magnetospirillum gryphiswaldens... 217 3e-60 CU928178_195(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 186 5e-59 AM464178_1(AM464178|pid:none) Vitis vinifera contig VV78X021543.... 194 6e-59 (A2XNR6) RecName: Full=Electron transfer flavoprotein subunit al... 184 1e-58 CR380958_400(CR380958|pid:none) Candida glabrata strain CBS138 c... 185 1e-57 CP000251_49(CP000251|pid:none) Anaeromyxobacter dehalogenans 2CP... 187 4e-57 AM494965_122(AM494965|pid:none) Leishmania braziliensis chromoso... 194 7e-57 CP001131_53(CP001131|pid:none) Anaeromyxobacter sp. K, complete ... 184 2e-56 AK300044_1(AK300044|pid:none) Homo sapiens cDNA FLJ50859 complet... 221 4e-56 (P13804) RecName: Full=Electron transfer flavoprotein subunit al... 221 4e-56 AF160913_1(AF160913|pid:none) Drosophila melanogaster LD07532 fu... 221 5e-56 AK168321_1(AK168321|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 221 5e-56 AE013599_1392(AE013599|pid:none) Drosophila melanogaster chromos... 221 5e-56 (Q99LC5) RecName: Full=Electron transfer flavoprotein subunit al... 221 5e-56 AY374469_1(AY374469|pid:none) Sus scrofa electron transfer flavo... 220 7e-56 AK032830_1(AK032830|pid:none) Mus musculus 12 days embryo male w... 220 7e-56 AJ720662_1(AJ720662|pid:none) Gallus gallus mRNA for hypothetica... 219 1e-55 BT082646_1(BT082646|pid:none) Anoplopoma fimbria clone afim-evh-... 219 1e-55 BC003432_1(BC003432|pid:none) Mus musculus electron transferring... 219 1e-55 (Q8HXY0) RecName: Full=Electron transfer flavoprotein subunit al... 218 3e-55 AY398344_1(AY398344|pid:none) Danio rerio clone RK140A1B05 elect... 218 3e-55 AF542530_28(AF542530|pid:none) Cryptococcus neoformans var. neof... 200 3e-55 CP000697_146(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 218 4e-55 (Q5RC31) RecName: Full=Electron transfer flavoprotein subunit al... 217 6e-55 BT074919_1(BT074919|pid:none) Osmerus mordax clone omor-eva-509-... 217 6e-55 CP000282_1993(CP000282|pid:none) Saccharophagus degradans 2-40, ... 217 6e-55 AM889285_1280(AM889285|pid:none) Gluconacetobacter diazotrophicu... 217 7e-55 AP007255_3903(AP007255|pid:none) Magnetospirillum magneticum AMB... 216 1e-54 CP001103_991(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 216 2e-54 BT075175_1(BT075175|pid:none) Osmerus mordax clone omor-eva-520-... 216 2e-54 BT047075_1(BT047075|pid:none) Salmo salar clone ssal-sjb-012-038... 215 3e-54 BT078566_1(BT078566|pid:none) Lepeophtheirus salmonis clone lsal... 214 5e-54 AE017340_514(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 214 5e-54 CP000388_651(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 213 8e-54 CP000230_3068(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 213 1e-53 CR382131_552(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 213 1e-53 CP000089_1209(CP000089|pid:none) Dechloromonas aromatica RCB, co... 212 2e-53 BT081254_1(BT081254|pid:none) Caligus clemensi clone ccle-evs-51... 212 2e-53 FN392320_972(FN392320|pid:none) Pichia pastoris GS115 chromosome... 187 3e-53 CP000769_50(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, com... 180 4e-53 CP000113_5770(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 181 6e-53 CP000961_3204(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 210 7e-53 CP000563_2794(CP000563|pid:none) Shewanella baltica OS155, compl... 209 2e-52 CP000851_2843(CP000851|pid:none) Shewanella pealeana ATCC 700345... 209 2e-52 BT073076_1(BT073076|pid:none) Oncorhynchus mykiss clone omyk-evn... 208 3e-52 EU016585_48(EU016585|pid:none) Uncultured marine microorganism H... 208 3e-52 CP000749_3124(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 207 4e-52 CP001252_1473(CP001252|pid:none) Shewanella baltica OS223, compl... 207 6e-52 CP000821_1444(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 206 1e-51 (P38974) RecName: Full=Electron transfer flavoprotein subunit al... 206 1e-51 CR954246_1576(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 206 2e-51 (Q93615) RecName: Full=Probable electron transfer flavoprotein s... 205 2e-51 CP000447_2725(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 205 3e-51 AB284109_1(AB284109|pid:none) Shewanella livingstonensis fixB ge... 205 3e-51 CP000606_2576(CP000606|pid:none) Shewanella loihica PV-4, comple... 204 4e-51 CP000472_3318(CP000472|pid:none) Shewanella piezotolerans WP3, c... 204 6e-51 CP000353_1890(CP000353|pid:none) Ralstonia metallidurans CH34 me... 203 8e-51 CP000444_1411(CP000444|pid:none) Shewanella sp. MR-7, complete g... 203 8e-51 CP000931_2917(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 203 8e-51 CP000503_1483(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 203 8e-51 (Q8J112) RecName: Full=Probable electron transfer flavoprotein s... 203 1e-50 CP000141_1288(CP000141|pid:none) Carboxydothermus hydrogenoforma... 186 1e-50 CP000141_1555(CP000141|pid:none) Carboxydothermus hydrogenoforma... 186 2e-50 CP001196_742(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 202 2e-50 AE014299_3057(AE014299|pid:none) Shewanella oneidensis MR-1, com... 201 3e-50 (Q5Y223) RecName: Full=Probable electron transfer flavoprotein s... 201 3e-50 AM746676_626(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ... 183 5e-50 CR555306_3719(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 201 5e-50 CP000270_881(CP000270|pid:none) Burkholderia xenovorans LB400 ch... 199 2e-49 CP001096_5156(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 199 2e-49 CP000943_1882(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 199 2e-49 CP001349_451(CP001349|pid:none) Methylobacterium nodulans ORS 20... 197 5e-49 CP000463_4806(CP000463|pid:none) Rhodopseudomonas palustris BisA... 197 5e-49 CP000283_929(CP000283|pid:none) Rhodopseudomonas palustris BisB5... 197 5e-49 BX572608_103(BX572608|pid:none) Rhodopseudomonas palustris CGA00... 197 5e-49 CU234118_6131(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 197 6e-49 CP001392_2247(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 197 8e-49 CP000539_3583(CP000539|pid:none) Acidovorax sp. JS42, complete g... 196 2e-48 CP000084_1231(CP000084|pid:none) Candidatus Pelagibacter ubique ... 195 2e-48 CP000250_819(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 194 4e-48 AM902716_3805(AM902716|pid:none) Bordetella petrii strain DSM 12... 192 2e-47 CP000115_751(CP000115|pid:none) Nitrobacter winogradskyi Nb-255,... 192 3e-47 AL157959_218(AL157959|pid:none) Neisseria meningitidis serogroup... 191 4e-47 CU928171_708(CU928171|pid:none) Kluyveromyces thermotolerans str... 190 7e-47 AE016825_3817(AE016825|pid:none) Chromobacterium violaceum ATCC ... 189 2e-46 D89139_1(D89139|pid:none) Schizosaccharomyces pombe mRNA, partia... 189 2e-46 AP008230_3371(AP008230|pid:none) Desulfitobacterium hafniense Y5... 177 6e-46 CP001336_4465(CP001336|pid:none) Desulfitobacterium hafniense DC... 177 6e-46 BA000012_2685(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 186 1e-45 CP001077_586(CP001077|pid:none) Rhizobium etli CIAT 652 plasmid ... 186 1e-45 CP000781_2143(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 186 2e-45 CP000631_108(CP000631|pid:none) Agrobacterium radiobacter K84 pl... 185 2e-45 AM236080_4321(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 185 3e-45 CP000911_1715(CP000911|pid:none) Brucella suis ATCC 23445 chromo... 185 3e-45 AE014291_1908(AE014291|pid:none) Brucella suis 1330 chromosome I... 185 3e-45 AD3264(AD3264) electron transfer flavoprotein alpha-chain [impor... 185 3e-45 CP000133_3737(CP000133|pid:none) Rhizobium etli CFN 42, complete... 184 4e-45 AM236086_517(AM236086|pid:none) Rhizobium leguminosarum bv. vici... 184 4e-45 BX842646_20(BX842646|pid:none) Bdellovibrio bacteriovorus comple... 168 4e-45 CP000628_3155(CP000628|pid:none) Agrobacterium radiobacter K84 c... 184 5e-45 AE017220_849(AE017220|pid:none) Salmonella enterica subsp. enter... 184 7e-45 CP001389_2636(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 184 7e-45 AE008922_616(AE008922|pid:none) Xanthomonas campestris pv. campe... 183 1e-44 CP001191_3526(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 183 1e-44 CP001192_523(CP001192|pid:none) Rhizobium leguminosarum bv. trif... 183 1e-44 AE013598_776(AE013598|pid:none) Xanthomonas oryzae pv. oryzae KA... 182 2e-44 A95357(A95357) probable EtfA2 electron-transport flavoprotein, a... 182 3e-44 CP000738_2503(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 182 3e-44 AY316746_189(AY316746|pid:none) Rhizobium sp. NGR234 megaplasmid... 179 1e-43 AE017333_2875(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 169 2e-43 BT051844_1(BT051844|pid:none) Medicago truncatula clone MTYF5_F6... 179 2e-43 AP008230_1714(AP008230|pid:none) Desulfitobacterium hafniense Y5... 179 2e-43 CP000967_4380(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 179 2e-43 CP000284_725(CP000284|pid:none) Methylobacillus flagellatus KT, ... 179 2e-43 AE008923_3538(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 179 2e-43 AP006618_4294(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 179 2e-43 CP000511_2064(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 178 3e-43 CP000384_1858(CP000384|pid:none) Mycobacterium sp. MCS, complete... 177 6e-43 AY232145_1(AY232145|pid:none) Drosophila yakuba clone yak-ad_wal... 177 8e-43 AP008957_2374(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 177 8e-43 CP000850_1076(CP000850|pid:none) Salinispora arenicola CNS-205, ... 177 8e-43 AE016828_960(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 176 1e-42 CP000667_1196(CP000667|pid:none) Salinispora tropica CNB-440, co... 176 1e-42 CP000480_2272(CP000480|pid:none) Mycobacterium smegmatis str. MC... 176 1e-42 AP008230_4730(AP008230|pid:none) Desulfitobacterium hafniense Y5... 166 1e-42 CP000431_6402(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 176 1e-42 CP001336_3594(CP001336|pid:none) Desulfitobacterium hafniense DC... 175 2e-42 AP008230_2487(AP008230|pid:none) Desulfitobacterium hafniense Y5... 175 2e-42 CP000325_1600(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 175 3e-42 CT573213_5734(CT573213|pid:none) Frankia alni str. ACN14A chromo... 174 4e-42 CP000348_610(CP000348|pid:none) Leptospira borgpetersenii serova... 164 5e-42 CP001022_2129(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 158 5e-42 CP000820_1062(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 174 5e-42 AE010300_411(AE010300|pid:none) Leptospira interrogans serovar l... 163 7e-42 CP000249_3615(CP000249|pid:none) Frankia sp. CcI3, complete geno... 172 2e-41 CP000557_2571(CP000557|pid:none) Geobacillus thermodenitrificans... 171 6e-41 BA000043_2686(BA000043|pid:none) Geobacillus kaustophilus HTA426... 170 8e-41 AM420293_6014(AM420293|pid:none) Saccharopolyspora erythraea NRR... 170 8e-41 (O53275) RecName: Full=Electron transfer flavoprotein subunit al... 170 1e-40 CP001013_162(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 169 1e-40 CP000934_2542(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 169 2e-40 AM260525_1642(AM260525|pid:none) Bartonella tribocorum CIP 10547... 168 3e-40 (O33096) RecName: Full=Electron transfer flavoprotein subunit al... 168 3e-40 AE008691_506(AE008691|pid:none) Thermoanaerobacter tengcongensis... 162 5e-40 CP000524_974(CP000524|pid:none) Bartonella bacilliformis KC583, ... 167 5e-40 BX897699_1193(BX897699|pid:none) Bartonella henselae strain Hous... 167 5e-40 AP006627_2661(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 167 5e-40 CP000922_565(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 167 9e-40 CP000769_3141(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 166 1e-39 CP000817_3882(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 166 1e-39 CP001176_4462(CP001176|pid:none) Bacillus cereus B4264, complete... 166 1e-39 AP006840_3011(AP006840|pid:none) Symbiobacterium thermophilum IA... 165 3e-39 AE016879_4393(AE016879|pid:none) Bacillus anthracis str. Ames, c... 165 3e-39 CP000485_3896(CP000485|pid:none) Bacillus thuringiensis str. Al ... 165 3e-39 AM238663_1074(AM238663|pid:none) Streptomyces ambofaciens ATCC 2... 164 4e-39 AF263012_2(AF263012|pid:none) Streptomyces griseus subsp. griseu... 164 6e-39 CP000764_3066(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 164 7e-39 BA000030_1485(BA000030|pid:none) Streptomyces avermitilis MA-468... 163 1e-38 BA000004_3099(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 163 1e-38 BX897700_936(BX897700|pid:none) Bartonella quintana str. Toulous... 163 1e-38 CP000088_592(CP000088|pid:none) Thermobifida fusca YX, complete ... 162 2e-38 CP001615_2595(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 162 2e-38 CP000813_2471(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 161 4e-38 CP000481_682(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 161 4e-38 BA000028_2118(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 161 5e-38 AP008955_1671(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 160 6e-38 AM180355_825(AM180355|pid:none) Clostridium difficile 630 comple... 160 8e-38 CP000382_1969(CP000382|pid:none) Clostridium novyi NT, complete ... 150 9e-38 (P52039) RecName: Full=Electron transfer flavoprotein subunit al... 150 2e-37 CP001124_1344(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 159 2e-37 CP001390_245(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 159 2e-37 CP000612_1752(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 159 2e-37 CP000698_2376(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 158 4e-37 CP000560_2468(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 157 5e-37 CP000698_1198(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 157 7e-37 CP001124_2066(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 157 9e-37 CP000962_2234(CP000962|pid:none) Clostridium botulinum A3 str. L... 157 9e-37 CP000148_676(CP000148|pid:none) Geobacter metallireducens GS-15,... 157 9e-37 AM412317_2181(AM412317|pid:none) Clostridium botulinum A str. AT... 156 1e-36 CP000910_3387(CP000910|pid:none) Renibacterium salmoninarum ATCC... 156 1e-36 T47264(T47264) electron transfer flavoprotein alpha chain [impor... 147 1e-36 CP000728_2118(CP000728|pid:none) Clostridium botulinum F str. La... 156 2e-36 CP000509_615(CP000509|pid:none) Nocardioides sp. JS614, complete... 156 2e-36 CP001390_1788(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 155 2e-36 AM998794_5(AM998794|pid:none) Clostridium saccharobutylicum ORF1... 155 2e-36 CP000252_2643(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 155 3e-36 CP000853_166(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ... 155 3e-36 (P53578) RecName: Full=Protein fixB; &M91817_1(M91817|pid:none) 154 4e-36 CP000454_2719(CP000454|pid:none) Arthrobacter sp. FB24, complete... 154 4e-36 CP000909_3473(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 154 4e-36 M22030_1(M22030|pid:none) Rat electron transfer flavoprotein (ET... 154 6e-36 AM412317_3290(AM412317|pid:none) Clostridium botulinum A str. AT... 154 8e-36 CP000728_3262(CP000728|pid:none) Clostridium botulinum F str. La... 154 8e-36 CP000939_3283(CP000939|pid:none) Clostridium botulinum B1 str. O... 154 8e-36 CP001581_3489(CP001581|pid:none) Clostridium botulinum A2 str. K... 153 1e-35 CP000148_2233(CP000148|pid:none) Geobacter metallireducens GS-15... 153 1e-35 CP001337_403(CP001337|pid:none) Chloroflexus aggregans DSM 9485,... 153 1e-35 CP000812_1674(CP000812|pid:none) Thermotoga lettingae TMO, compl... 136 2e-35 AB190765_5(AB190765|pid:none) Butyrivibrio fibrisolvens thl, hbd... 152 2e-35 CP001124_1452(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 152 3e-35 AB086406_5(AB086406|pid:none) Butyrivibrio fibrisolvens thl, hbd... 151 3e-35 CP000474_2605(CP000474|pid:none) Arthrobacter aurescens TC1, com... 151 4e-35 AE015927_2175(AE015927|pid:none) Clostridium tetani E88, complet... 150 1e-34 CR522870_3051(CR522870|pid:none) Desulfotalea psychrophila LSv54... 150 1e-34 CP000726_3112(CP000726|pid:none) Clostridium botulinum A str. AT... 150 1e-34 CP000910_1252(CP000910|pid:none) Renibacterium salmoninarum ATCC... 149 2e-34 CP001089_559(CP001089|pid:none) Geobacter lovleyi SZ, complete g... 149 2e-34 CP001107_712(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 147 2e-34 AP008226_1146(AP008226|pid:none) Thermus thermophilus HB8 genomi... 149 2e-34 CP000962_3182(CP000962|pid:none) Clostridium botulinum A3 str. L... 149 2e-34 AP009049_402(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 149 2e-34 AE017221_779(AE017221|pid:none) Thermus thermophilus HB27, compl... 149 2e-34 CP001056_346(CP001056|pid:none) Clostridium botulinum B str. Ekl... 148 3e-34 CR931997_1324(CR931997|pid:none) Corynebacterium jeikeium K411 c... 148 3e-34 CP001078_332(CP001078|pid:none) Clostridium botulinum E3 str. Al... 148 3e-34 AP009044_1328(AP009044|pid:none) Corynebacterium glutamicum R DN... 148 4e-34 CP000812_1814(CP000812|pid:none) Thermotoga lettingae TMO, compl... 148 4e-34 CP001185_710(CP001185|pid:none) Thermosipho africanus TCF52B, co... 147 5e-34 CP001100_1784(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 147 7e-34 AM180355_408(AM180355|pid:none) Clostridium difficile 630 comple... 147 9e-34 CP000686_2234(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 147 9e-34 AB190764_6(AB190764|pid:none) Butyrivibrio fibrisolvens thl, crt... 145 1e-33 AE015927_1866(AE015927|pid:none) Clostridium tetani E88, complet... 146 1e-33 CP000853_93(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, c... 146 1e-33 AP010656_669(AP010656|pid:none) Candidatus Azobacteroides pseudo... 139 1e-33 CP000804_3082(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 146 2e-33 CP000875_1827(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 146 2e-33 CP000232_58(CP000232|pid:none) Moorella thermoacetica ATCC 39073... 146 2e-33 AF494018_4(AF494018|pid:none) Clostridium beijerinckii strain NR... 145 2e-33 CP000721_322(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 145 2e-33 CP000383_1338(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 145 4e-33 BA000035_1327(BA000035|pid:none) Corynebacterium efficiens YS-31... 144 6e-33 CP000141_2399(CP000141|pid:none) Carboxydothermus hydrogenoforma... 144 8e-33 EU003587_1(EU003587|pid:none) Fusobacterium necrophorum electron... 144 8e-33 CP000804_3507(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 144 8e-33 CP000721_2842(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 143 1e-32 AE000782_284(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,... 143 1e-32 AP009380_800(AP009380|pid:none) Porphyromonas gingivalis ATCC 33... 139 1e-32 AE000512_1504(AE000512|pid:none) Thermotoga maritima MSB8, compl... 142 2e-32 CP001083_3332(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 142 2e-32 AE009951_1361(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 142 2e-32 CP000916_1114(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 142 3e-32 CP001357_1869(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 141 4e-32 CP000969_1176(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 141 4e-32 AY236226_1(AY236226|pid:none) Uncultured bacterium cosmid IIIE5_... 141 5e-32 CP001097_312(CP001097|pid:none) Chlorobium limicola DSM 245, com... 141 5e-32 CP000724_3624(CP000724|pid:none) Alkaliphilus metalliredigens QY... 141 5e-32 CP000612_364(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 141 5e-32 AP009049_3103(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 141 5e-32 CP000473_1143(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 140 7e-32 CP001147_1526(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 140 7e-32 AE009951_39(AE009951|pid:none) Fusobacterium nucleatum subsp. nu... 140 9e-32 CP001472_728(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 140 1e-31 CP000096_1716(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 139 1e-31 CP000686_923(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 139 1e-31 (O85692) RecName: Full=Electron transfer flavoprotein subunit al... 139 2e-31 CP001365_383(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 139 2e-31 CP000271_1561(CP000271|pid:none) Burkholderia xenovorans LB400 c... 139 3e-31 BX248357_14(BX248357|pid:none) Corynebacterium diphtheriae gravi... 138 3e-31 CP000853_628(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ... 138 3e-31 CP001110_397(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 138 4e-31 CP000441_678(CP000441|pid:none) Burkholderia ambifaria AMMD chro... 137 6e-31 CP000148_2131(CP000148|pid:none) Geobacter metallireducens GS-15... 128 7e-31 CP001114_1395(CP001114|pid:none) Deinococcus deserti VCD115, com... 136 1e-30 CP001601_1085(CP001601|pid:none) Corynebacterium aurimucosum ATC... 136 1e-30 CP000922_1235(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 136 1e-30 AM398681_329(AM398681|pid:none) Flavobacterium psychrophilum JIP... 136 2e-30 CP000685_1467(CP000685|pid:none) Flavobacterium johnsoniae UW101... 135 2e-30 CU207366_287(CU207366|pid:none) Gramella forsetii KT0803 complet... 135 3e-30 AE015924_934(AE015924|pid:none) Porphyromonas gingivalis W83, co... 135 4e-30 CP001108_387(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 135 4e-30 CP001101_405(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 134 5e-30 CP001195_199(CP001195|pid:none) Rhizobium leguminosarum bv. trif... 134 5e-30 CR936257_1577(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 134 6e-30 CP000561_2107(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 134 6e-30 CP000557_776(CP000557|pid:none) Geobacillus thermodenitrificans ... 133 1e-29 CU459003_2786(CU459003|pid:none) Magnetospirillum gryphiswaldens... 133 1e-29 CP000148_1510(CP000148|pid:none) Geobacter metallireducens GS-15... 133 1e-29 (P53574) RecName: Full=Protein fixB; &S49188(S49188) &X65515_3(... 132 3e-29 CP000975_472(CP000975|pid:none) Methylacidiphilum infernorum V4,... 132 3e-29 CP001157_1016(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 132 3e-29 CP000529_2295(CP000529|pid:none) Polaromonas naphthalenivorans C... 131 5e-29 DQ845290_2(DQ845290|pid:none) Acetobacterium woodii putative ele... 131 5e-29 CP000492_2431(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 130 7e-29 AE017261_1383(AE017261|pid:none) Picrophilus torridus DSM 9790, ... 130 9e-29 CP000852_467(CP000852|pid:none) Caldivirga maquilingensis IC-167... 130 1e-28 CP000240_1893(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 129 2e-28 CP000504_639(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 129 2e-28 AL445063_209(AL445063|pid:none) Thermoplasma acidophilum complet... 129 3e-28 BA000023_1925(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 129 3e-28 CP001124_1320(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 128 3e-28 CP000698_2991(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 128 4e-28 CP000750_655(CP000750|pid:none) Kineococcus radiotolerans SRS302... 128 4e-28 CP000660_2298(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 128 4e-28 CP001403_2577(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 128 4e-28 CP000360_463(CP000360|pid:none) Acidobacteria bacterium Ellin345... 127 6e-28 CP001399_2447(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 127 6e-28 CP001390_92(CP001390|pid:none) Geobacter sp. FRC-32, complete ge... 126 1e-27 AP006841_3368(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 126 2e-27 CP000239_2597(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 126 2e-27 CP001275_145(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 125 2e-27 AP009510_596(AP009510|pid:none) Uncultured Termite group 1 bacte... 125 3e-27 CP001016_482(CP001016|pid:none) Beijerinckia indica subsp. indic... 125 4e-27 CP000716_636(CP000716|pid:none) Thermosipho melanesiensis BI429,... 124 5e-27 B72472(B72472) probable electron transfer flavoprotein alpha-sub... 124 6e-27 CP000382_719(CP000382|pid:none) Clostridium novyi NT, complete g... 124 6e-27 AB471639_21(AB471639|pid:none) Desulfotignum balticum genomic DN... 124 8e-27 AM889285_452(AM889285|pid:none) Gluconacetobacter diazotrophicus... 123 1e-26 AF030414_29(AF030414|pid:none) Gluconacetobacter diazotrophicus ... 123 1e-26 AP009389_1767(AP009389|pid:none) Pelotomaculum thermopropionicum... 123 1e-26 BA000011_1408(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 123 1e-26 CP001013_1361(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 123 1e-26 AE015928_1805(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 123 1e-26 AF489443_2(AF489443|pid:none) Azospirillum brasilense fix operon... 122 2e-26 CP001280_3515(CP001280|pid:none) Methylocella silvestris BL2, co... 122 2e-26 (P26483) RecName: Full=Protein fixB; &AP009384_3448(AP009384|pi... 122 3e-26 CP000478_3652(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 122 3e-26 CP000140_444(CP000140|pid:none) Parabacteroides distasonis ATCC ... 121 4e-26 CP000781_141(CP000781|pid:none) Xanthobacter autotrophicus Py2, ... 121 4e-26 AY362827_4(AY362827|pid:none) Rhodospirillum rubrum NifV (nifV) ... 120 7e-26 CP001322_3195(CP001322|pid:none) Desulfatibacillum alkenivorans ... 120 9e-26 CP000494_5509(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 120 9e-26 S14071(S14071) electron transfer flavoprotein alpha chain fixB h... 120 1e-25 CP000148_2241(CP000148|pid:none) Geobacter metallireducens GS-15... 120 1e-25 CU234118_5091(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 119 2e-25 BA000012_4556(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 119 2e-25 AL672114_105(AL672114|pid:none) Mesorhizobium loti R7A symbiosis... 119 2e-25 CP000740_1002(CP000740|pid:none) Sinorhizobium medicae WSM419 pl... 119 3e-25 CP000859_1413(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 118 5e-25 CP001096_5011(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 117 6e-25 (P10449) RecName: Full=Protein fixB; &AF322012_62(AF322012|pid:... 117 8e-25 CP001087_3507(CP001087|pid:none) Desulfobacterium autotrophicum ... 117 8e-25 BA000016_312(BA000016|pid:none) Clostridium perfringens str. 13 ... 117 1e-24 CP000077_277(CP000077|pid:none) Sulfolobus acidocaldarius DSM 63... 117 1e-24 U80928_218(U80928|pid:none) Rhizobium etli CFN 42 plasmid symbio... 117 1e-24 CP001349_3846(CP001349|pid:none) Methylobacterium nodulans ORS 2... 117 1e-24 CP000312_282(CP000312|pid:none) Clostridium perfringens SM101, c... 117 1e-24 CP000301_4391(CP000301|pid:none) Rhodopseudomonas palustris BisB... 116 1e-24 AE006470_2112(AE006470|pid:none) Chlorobium tepidum TLS, complet... 116 2e-24 CP000250_983(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 115 2e-24 CP000463_4476(CP000463|pid:none) Rhodopseudomonas palustris BisA... 115 2e-24 CP000283_1087(CP000283|pid:none) Rhodopseudomonas palustris BisB... 115 4e-24 CP001014_894(CP001014|pid:none) Thermoproteus neutrophilus V24St... 114 5e-24 AE009441_2533(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 114 7e-24 CP000885_1302(CP000885|pid:none) Clostridium phytofermentans ISD... 114 7e-24 AP008230_947(AP008230|pid:none) Desulfitobacterium hafniense Y51... 109 7e-24 CP001192_639(CP001192|pid:none) Rhizobium leguminosarum bv. trif... 113 1e-23 CP000561_1982(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 113 1e-23 AP008230_3787(AP008230|pid:none) Desulfitobacterium hafniense Y5... 112 2e-23 CP001393_1168(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 112 2e-23 AJ431175_7(AJ431175|pid:none) Rhizobium leguminosarum bv. viciae... 112 3e-23 AM236084_198(AM236084|pid:none) Rhizobium leguminosarum bv. vici... 112 3e-23 CP000880_2816(CP000880|pid:none) Salmonella enterica subsp. ariz... 112 3e-23 CP000660_2141(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 112 3e-23 CP000682_332(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 111 4e-23 CP001600_2856(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 111 6e-23 AP008230_3797(AP008230|pid:none) Desulfitobacterium hafniense Y5... 110 7e-23 AM942759_2628(AM942759|pid:none) Proteus mirabilis strain HI4320... 110 1e-22 BA000002_92(BA000002|pid:none) Aeropyrum pernix K1 DNA, complete... 109 2e-22 CP000660_518(CP000660|pid:none) Pyrobaculum arsenaticum DSM 1351... 109 2e-22 CP001336_1010(CP001336|pid:none) Desulfitobacterium hafniense DC... 109 2e-22 CP000473_3042(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 109 2e-22 AP009389_2002(AP009389|pid:none) Pelotomaculum thermopropionicum... 108 3e-22 EF165526_8(EF165526|pid:none) Rhizobium leguminosarum bv. trifol... 108 3e-22 (B7NHE6) RecName: Full=Protein fixB; &CU928164_43(CU928164|pid:... 108 4e-22 (B5YYD6) RecName: Full=Protein fixB; &(Q8XA27) RecName: Fu &AE0... 108 4e-22 (Q32K55) RecName: Full=Protein fixB; &CP000034_63(CP000034|pid:... 108 4e-22 (A1A792) RecName: Full=Protein fixB; &(B7MAG5) RecName: Fu &(Q1... 108 4e-22 CU928145_40(CU928145|pid:none) Escherichia coli 55989 chromosome... 108 4e-22 CP001399_2501(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 108 4e-22 (Q0TLU7) RecName: Full=Protein fixB; &CP000247_42(CP000247|pid:... 108 5e-22 CP000728_987(CP000728|pid:none) Clostridium botulinum F str. Lan... 108 5e-22 (P59674) RecName: Full=Protein fixB; &FM180568_43(FM180568|pid:... 108 5e-22 CP001083_979(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 108 5e-22 AM412317_1007(AM412317|pid:none) Clostridium botulinum A str. AT... 108 5e-22 CU928162_40(CU928162|pid:none) Escherichia coli ED1a chromosome,... 108 5e-22 CP000721_309(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 107 8e-22 AP008230_4303(AP008230|pid:none) Desulfitobacterium hafniense Y5... 107 8e-22 (B7LWN3) RecName: Full=Protein fixB; &CU928158_49(CU928158|pid:... 107 1e-21 AE006641_2524(AE006641|pid:none) Sulfolobus solfataricus P2, com... 106 1e-21 (A7ZHD5) RecName: Full=Protein fixB; &CP000800_45(CP000800|pid:... 106 1e-21 CP001336_309(CP001336|pid:none) Desulfitobacterium hafniense DCB... 106 2e-21 AM180355_1211(AM180355|pid:none) Clostridium difficile 630 compl... 106 2e-21 CP001056_334(CP001056|pid:none) Clostridium botulinum B str. Ekl... 106 2e-21 AM933173_76(AM933173|pid:none) Salmonella enterica subsp. enteri... 106 2e-21 CP001127_83(CP001127|pid:none) Salmonella enterica subsp. enteri... 106 2e-21 (P64095) RecName: Full=Protein fixB; &(P64096) RecName: Fu &(Q5... 105 2e-21 CP000857_79(CP000857|pid:none) Salmonella enterica subsp. enteri... 105 2e-21 CP001113_79(CP001113|pid:none) Salmonella enterica subsp. enteri... 105 3e-21 AM933172_76(AM933172|pid:none) Salmonella enterica subsp. enteri... 105 3e-21 CP001336_4536(CP001336|pid:none) Desulfitobacterium hafniense DC... 105 3e-21 CP001322_5142(CP001322|pid:none) Desulfatibacillum alkenivorans ... 104 5e-21 AE017283_2152(AE017283|pid:none) Propionibacterium acnes KPA1712... 103 9e-21 CP000448_255(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 103 1e-20 CP000968_223(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 102 2e-20 AP009389_2431(AP009389|pid:none) Pelotomaculum thermopropionicum... 102 2e-20 CP001087_4793(CP001087|pid:none) Desulfobacterium autotrophicum ... 102 3e-20 (P53571) RecName: Full=Electron transfer flavoprotein subunit al... 101 4e-20 CP000821_3222(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 101 6e-20 AP009240_1822(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 100 8e-20 CU928164_1353(CU928164|pid:none) Escherichia coli IAI39 chromoso... 100 8e-20 CP000728_2753(CP000728|pid:none) Clostridium botulinum F str. La... 100 8e-20 CU651637_1623(CU651637|pid:none) Escherichia coli LF82 chromosom... 100 8e-20 CP000243_1857(CP000243|pid:none) Escherichia coli UTI89, complet... 100 8e-20 CP000946_1891(CP000946|pid:none) Escherichia coli ATCC 8739, com... 100 8e-20 CP000962_2828(CP000962|pid:none) Clostridium botulinum A3 str. L... 100 1e-19 CP001322_4475(CP001322|pid:none) Desulfatibacillum alkenivorans ... 100 1e-19 AM412317_2852(AM412317|pid:none) Clostridium botulinum A str. AT... 100 2e-19 CU928162_1858(CU928162|pid:none) Escherichia coli ED1a chromosom... 100 2e-19 CP000800_1824(CP000800|pid:none) Escherichia coli E24377A, compl... 99 2e-19
>(Q54FD7) RecName: Full=Electron transfer flavoprotein subunit alpha, mitochondrial; Short=Alpha-ETF; Flags: Precursor; Length = 355
Score = 328 bits (842), Expect = 2e-88 Identities = 170/173 (98%), Positives = 171/173 (98%) Frame = +1
Query: 574 KLVLVRTTAFDKAPTSGGSAKVVSANDWAVPLIEKAISETNIKWESSEVKKSERPELTSA 753 K+ VRTTAFDKAPTSGGSAKVVSANDWAVPLIEKAISETNIKWESSEVKKSERPELTSA Sbjct: 177 KVGTVRTTAFDKAPTSGGSAKVVSANDWAVPLIEKAISETNIKWESSEVKKSERPELTSA 236
Query: 754 RVVVSGGRGMKNGENFKMLEELADTLGGAVGASRAAVDSGFVSNDLQVGQTGKIVAPELY 933 RVVVSGGRGMKNGENFKMLEELADTLGGAVGASRAAVDSGFVSNDLQVGQTGKIVAPELY Sbjct: 237 RVVVSGGRGMKNGENFKMLEELADTLGGAVGASRAAVDSGFVSNDLQVGQTGKIVAPELY 296
Query: 934 IAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFQVADVGLVGDLFNEVPKLTE 1092 IAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFQVADVGLVGDLFNEVPKLTE Sbjct: 297 IAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFQVADVGLVGDLFNEVPKLTE 349
Score = 202 bits (515), Expect = 1e-50 Identities = 108/124 (87%), Positives = 109/124 (87%) Frame = +2
Query: 44 MIGRLNLITKSXXXXXXXXXXXXXYYSTCLVIAEHDNNQLLNSTLNTITAASKLGVTNIS 223 MIGRLNLITKS YYSTCLVIAEHDNNQLLNSTLNTITAASKLGVTNIS Sbjct: 1 MIGRLNLITKSNLFKNVNNLNNKNYYSTCLVIAEHDNNQLLNSTLNTITAASKLGVTNIS 60
Query: 224 VLVAGSKCGPVADSVSKVSGVTNVVCVDHPTLEHSLAETITPIIVKLQSSSSKEGDEIYT 403 VLVAGSKCGPVADSVSKVSGVTNVVCVDHPTLEHSLAETITPIIVKLQSSSSKEGDEI T Sbjct: 61 VLVAGSKCGPVADSVSKVSGVTNVVCVDHPTLEHSLAETITPIIVKLQSSSSKEGDEI-T 119
Query: 404 HLHT 415 H+ T Sbjct: 120 HIFT 123
Score = 127 bits (319), Expect = 8e-28 Identities = 65/78 (83%), Positives = 68/78 (87%) Frame = +3
Query: 381 KRVTKFTHIFTPASNFGKNFLPRVAALLNVSQISEITKVKDAETFQRPIYAGNAIATVKS 560 K + THIFTPASNFGKNFLPRVAALLNVSQISEITKVKDAETFQRPIYAGNAIATVKS Sbjct: 113 KEGDEITHIFTPASNFGKNFLPRVAALLNVSQISEITKVKDAETFQRPIYAGNAIATVKS 172
Query: 561 TDKCKVGTGSYNSFR*SP 614 TDKCKVGT +F +P Sbjct: 173 TDKCKVGTVRTTAFDKAP 190
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 1,433,440,556 Number of extensions: 27554986 Number of successful extensions: 112055 Number of sequences better than 10.0: 588 Number of HSP's gapped: 111506 Number of HSP's successfully gapped: 1022 Length of query: 393 Length of database: 1,040,966,779 Length adjustment: 130 Effective length of query: 263 Effective length of database: 624,409,729 Effective search space: 164219758727 Effective search space used: 164219758727 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|