List of clone(s) |
|
Homology vs DNA |
Query= Contig-U09878-1 (Contig-U09878-1Q) /CSM_Contig/Contig-U09878-1Q.Seq.d (1270 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ398555) Dictyostelium discoideum cDNA clone:dds12m21, 3' ... 1342 0.0 2 (BJ435886) Dictyostelium discoideum cDNA clone:ddv28f23, 3' ... 1338 0.0 1 (BJ399722) Dictyostelium discoideum cDNA clone:dds7n04, 3' e... 1273 0.0 2 (BJ436119) Dictyostelium discoideum cDNA clone:ddv30d04, 3' ... 1263 0.0 4 (BJ429515) Dictyostelium discoideum cDNA clone:ddv3d23, 3' e... 1263 0.0 3 (BJ429219) Dictyostelium discoideum cDNA clone:ddv2b20, 3' e... 1233 0.0 3 (AU034091) Dictyostelium discoideum slug cDNA, clone SLB732. 1203 0.0 2 (BJ432038) Dictyostelium discoideum cDNA clone:ddv17m09, 3' ... 1193 0.0 1 (BJ340669) Dictyostelium discoideum cDNA clone:dda3c09, 3' e... 1185 0.0 1 (BJ433588) Dictyostelium discoideum cDNA clone:ddv22h10, 3' ... 1181 0.0 1 (BJ402076) Dictyostelium discoideum cDNA clone:dds20l10, 3' ... 1179 0.0 1 (AU261565) Dictyostelium discoideum vegetative cDNA clone:VS... 1138 0.0 1 (C25556) Dictyostelium discoideum slug cDNA, clone SLA291. 1136 0.0 2 (BJ373322) Dictyostelium discoideum cDNA clone:ddc2e21, 3' e... 1108 0.0 2 (BJ401455) Dictyostelium discoideum cDNA clone:dds23f08, 3' ... 1106 0.0 3 (BJ434284) Dictyostelium discoideum cDNA clone:ddv16m09, 3' ... 1094 0.0 1 (BJ411030) Dictyostelium discoideum cDNA clone:ddv2b20, 5' e... 785 0.0 2 (AU060095) Dictyostelium discoideum slug cDNA, clone SLA291. 771 0.0 3 (BJ417792) Dictyostelium discoideum cDNA clone:ddv28f23, 5' ... 771 0.0 3 (BJ415368) Dictyostelium discoideum cDNA clone:ddv22h10, 5' ... 771 0.0 3 (BJ413925) Dictyostelium discoideum cDNA clone:ddv17m09, 5' ... 771 0.0 3 (BJ412224) Dictyostelium discoideum cDNA clone:ddv7o09, 5' e... 771 0.0 3 (BJ411295) Dictyostelium discoideum cDNA clone:ddv3d23, 5' e... 771 0.0 4 (BJ387969) Dictyostelium discoideum cDNA clone:dds7n04, 5' e... 771 0.0 3 (BJ387223) Dictyostelium discoideum cDNA clone:dds12m21, 5' ... 771 0.0 3 (BJ416943) Dictyostelium discoideum cDNA clone:ddv27i21, 5' ... 763 0.0 5 (BJ389874) Dictyostelium discoideum cDNA clone:dds20l10, 5' ... 747 0.0 3 (BJ390671) Dictyostelium discoideum cDNA clone:dds23f08, 5' ... 668 0.0 2 (BJ413624) Dictyostelium discoideum cDNA clone:ddv16m09, 5' ... 387 0.0 3 (BJ430492) Dictyostelium discoideum cDNA clone:ddv7o09, 3' e... 575 e-159 1 (AU053839) Dictyostelium discoideum slug cDNA, clone SLJ778. 525 e-144 1 (BJ325981) Dictyostelium discoideum cDNA clone:dda3c09, 5' e... 188 1e-49 3 (AM826240) Nicotiana tabacum EST, clone nt005126051. 143 2e-43 5 (DY680406) TTDA737TG Tetrahymena thermophila EST library str... 54 3e-39 7 (EH014525) USDA-FP_187217 Lysiphlebus testaceipes adult whol... 94 3e-37 6 (FC654450) CAXW13643.fwd CAXW Lottia gigantea from female go... 119 8e-37 3 (FC808015) CBGC9379.fwd CBGC Lottia gigantea 15h 18h embryos... 119 9e-37 3 (EE670913) SAAH-aac52f03.g1 Agen 0058 Schmidtea mediterranea... 98 3e-36 3 (EG349043) SAAH-aad01g03.g1 Agen 0058 Schmidtea mediterranea... 98 3e-36 3 (FC681030) CAXX1486.fwd CAXX Lottia gigantea from male gonad... 119 7e-35 2 (FC658514) CAXW16005.fwd CAXW Lottia gigantea from female go... 119 8e-35 2 (FC744683) CBBI14449.fwd CBBI Lottia gigantea 26h,37h,61h La... 119 8e-35 2 (FC782942) CBGC14030.fwd CBGC Lottia gigantea 15h 18h embryo... 119 9e-35 2 (EC615748) SAAH-aaa68f10.g1 Agen 0058 Schmidtea mediterranea... 98 7e-34 3 (BM167590) EST570113 PyBS Plasmodium yoelii yoelii cDNA clon... 155 5e-33 1 (EC272943) TT1CN95TH Tetrahymena thermophila SB210 cDNA libr... 54 4e-32 6 (CX578330) TTE00023297 Amplicon Express - Conjugative Form T... 54 4e-32 6 (CX581997) TTE00022510 Amplicon Express - Conjugative Form T... 54 4e-32 6 (FE236987) CAPG4157.fwd CAPG Naegleria gruberi amoeba stage ... 90 6e-32 6 (CX585761) TTE00020511 Amplicon Express - Conjugative Form T... 54 6e-32 6 (FF563576) TT1B586TH Tetrahymena thermophila SB210 cDNA libr... 54 6e-32 6 (CX591007) TTE00028924 Amplicon Express - Conjugative Form T... 54 7e-32 6 (EV834105) TT1D563TH Tetrahymena thermophila SB210 cDNA libr... 54 9e-32 6 (EG343524) SAAH-aac64c08.g1 Agen 0058 Schmidtea mediterranea... 98 1e-31 3 (BM398238) 5009-0-42-F11.t.1 Chilcoat/Turkewitz cDNA (large ... 54 2e-31 7 (CX586207) TTE00023990 Amplicon Express - Conjugative Form T... 64 7e-31 6 (EV845781) TTSAX40TH Tetrahymena thermophila SB210 cDNA libr... 54 9e-30 6 (DY678572) TT1AW24TH Tetrahymena thermophila EST library str... 62 8e-29 5 (EV846855) FTSB722TF Tetrahymena thermophila SB210 cDNA libr... 64 3e-28 6 (EE116689) G708P534RE11.T0 Acorn worm normalized gastrula pE... 119 8e-28 2 (FF632654) G825P555RC7.T0 Acorn worm normalized gastrula pEx... 119 8e-28 2 (FF605906) G825P5125RB12.T0 Acorn worm normalized gastrula p... 119 8e-28 2 (FF605905) G825P5125FB12.T0 Acorn worm normalized gastrula p... 119 8e-28 2 (DN294005) PL030015B10H12 cDNA from sexually mature hermapho... 82 2e-25 2 (DY679984) TTDA465TG Tetrahymena thermophila EST library str... 62 4e-25 4 (EC618141) SAAH-aaa77g04.g1 Agen 0058 Schmidtea mediterranea... 98 1e-24 3 (AQ854898) CpG2108B CpIOWAgDNA1 Cryptosporidium parvum genom... 125 4e-24 1 (EV847615) FMMCF67TF Tetrahymena thermophila SB210 cDNA libr... 62 7e-24 4 (CK250070) EST733707 potato callus cDNA library, normalized ... 44 1e-23 6 (BM401388) 5009-0-9-H05.t.1 Chilcoat/Turkewitz cDNA (large f... 52 2e-23 5 (DY887246) CeleSEQ3178 Cunninghamella elegans pBluescript (E... 82 1e-22 5 (DY887765) CeleSEQ4425 Cunninghamella elegans pBluescript (E... 82 2e-22 5 (C25696) Dictyostelium discoideum gamete cDNA, clone FC-AY10. 64 1e-21 4 (AR547777) Sequence 2908 from patent US 6747137. 50 6e-21 6 (EL577946) Physarum00969 Physarum polycephalum starvation st... 70 2e-20 4 (CK272276) EST718354 potato abiotic stress cDNA library Sola... 44 3e-20 6 (AM910992) Plasmodium knowlesi strain H chromosome 10, compl... 94 9e-20 2 (CT796885) Paramecium tetraurelia 5-PRIME EST from clone LK0... 46 2e-19 6 (CU425500) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 90 5e-19 2 (ES514292) BIG_AF_22110 Brine Shrimp embryos, 10 hours after... 52 2e-17 4 (DR396534) USDA-FP_156473 Adult Alate Aphis gossypii (WHAGA)... 92 4e-17 2 (DR393873) USDA-FP_153807 Adult Alate Aphis gossypii (WHAGA)... 92 4e-17 2 (DB708360) Solanum lycopersicum cDNA, clone: LEFL1097AH02, 5... 48 1e-16 4 (CR932517) Paramecium tetraurelia, Small GTPase drg, putativ... 52 1e-16 5 (CP000496) Pichia stipitis CBS 6054 chromosome 2, complete s... 92 1e-16 2 (FE860099) CAFY454.fwd CAFY Pichia stipitis oxygen limited x... 92 1e-16 2 (DB714374) Solanum lycopersicum cDNA, clone: LEFL2017A17, 5'... 48 1e-16 4 (EE005739) ROE00009992 Rhizopus oryzae Company Rhizopus oryz... 60 2e-16 4 (CU441586) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 2e-16 3 (CU430582) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 2e-16 3 (CU432832) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 3e-16 3 (CU431878) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 3e-16 3 (CU433027) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 3e-16 3 (CU424869) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 3e-16 3 (CU428805) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 82 3e-16 3 (BP878710) Solanum lycopersicum cDNA, clone: FA12CD10, 5' en... 48 4e-16 4 (DN309620) PL06005A1H11 cDNA from juvenile hermaphodites Sch... 90 5e-16 2 (AY066984) Schmidtea mediterranea clone H.96.1e(T3) unknown ... 90 5e-16 2 (AM685792) Entamoeba terrapinae GSS, clone terra144b01.p1k. 52 6e-16 4 (CQ809052) Sequence 355 from Patent WO2003097790. 42 2e-15 6
>(BJ398555) Dictyostelium discoideum cDNA clone:dds12m21, 3' end, single read. Length = 731
Score = 1342 bits (677), Expect(2) = 0.0 Identities = 680/681 (99%) Strand = Plus / Minus
Query: 566 ggatgcaatgaaaccattggtacataaaaagattatagagagagagttggatggttttgg 625 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 690 ggatgcaatgaaaccattggtacataaaaagattatagagagagagttggatggttttgg 631
Query: 626 tattagattgaataaacaaccaccaccaatcacattcaaaaagaaggagaagggtggtat 685 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 630 tattagattgaataaacaaccaccaccaatcacattcaaaaagaaggagaagggtggtat 571
Query: 686 taacttttcacatacaccaaatgtcaatccaacccaattggatagtgaaactgtgaaagc 745 |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| Sbjct: 570 taacttttcacatacaccaaatgttaatccaacccaattggatagtgaaactgtgaaagc 511
Query: 746 aatctgtgcagaatataaaattcacaatgcagatgtgattttacgtggaaattgtacagt 805 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 510 aatctgtgcagaatataaaattcacaatgcagatgtgattttacgtggaaattgtacagt 451
Query: 806 ggatgaattcatcgatgtcattgaaggcaatcgtatctacgttccatgtatttacgtttt 865 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 450 ggatgaattcatcgatgtcattgaaggcaatcgtatctacgttccatgtatttacgtttt 391
Query: 866 aaataagatcgatgctatctctatcgaagagttggaccttttagataaaattcctcatta 925 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 390 aaataagatcgatgctatctctatcgaagagttggaccttttagataaaattcctcatta 331
Query: 926 tgttccaatctcttctcatttggaatggaatttagatgccctcctcgataaaatttggga 985 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 330 tgttccaatctcttctcatttggaatggaatttagatgccctcctcgataaaatttggga 271
Query: 986 atacttaaaattgattagagtttacactaaaccaaaaggtctcattccagattacaatga 1045 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 270 atacttaaaattgattagagtttacactaaaccaaaaggtctcattccagattacaatga 211
Query: 1046 accagtcgtcattagaggtggtgaagaagcttcaattgaaactttttgtaatcatattca 1105 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 210 accagtcgtcattagaggtggtgaagaagcttcaattgaaactttttgtaatcatattca 151
Query: 1106 taattcaattattagacaatttagatatgctttggtttggggttcttcagctaaacataa 1165 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 150 taattcaattattagacaatttagatatgctttggtttggggttcttcagctaaacataa 91
Query: 1166 ccctcaacgttgtggtaaggatcacgttttagcagatgaagatattgttcaaattgttaa 1225 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 90 ccctcaacgttgtggtaaggatcacgttttagcagatgaagatattgttcaaattgttaa 31
Query: 1226 aaaataagatcacattttaat 1246 ||||||||||||||||||||| Sbjct: 30 aaaataagatcacattttaat 10
Score = 85.7 bits (43), Expect(2) = 0.0 Identities = 43/43 (100%) Strand = Plus / Minus
Query: 524 attgcagttggtagaacatgtaatcttattttaattgtattgg 566 ||||||||||||||||||||||||||||||||||||||||||| Sbjct: 731 attgcagttggtagaacatgtaatcttattttaattgtattgg 689
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,560,271,843 Number of extensions: 94610289 Number of successful extensions: 7939759 Number of sequences better than 10.0: 1651 Length of query: 1270 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1246 Effective length of database: 97,308,875,965 Effective search space: 121246859452390 Effective search space used: 121246859452390 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
Homology vs Protein |
Query= Contig-U09878-1 (Contig-U09878-1Q) /CSM_Contig/Contig-U09878-1Q.Seq.d (1270 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AK066361_1(AK066361|pid:none) Oryza sativa Japonica Group cDNA c... 321 e-144 EU964619_1(EU964619|pid:none) Zea mays clone 280387 developmenta... 318 e-142 AC146748_16(AC146748|pid:none) Medicago truncatula clone mth2-65... 320 e-142 EU236700_1(EU236700|pid:none) Pisum sativum developmentally regu... 319 e-142 BC053264_1(BC053264|pid:none) Danio rerio developmentally regula... 312 e-138 BT048439_1(BT048439|pid:none) Salmo salar clone ssal-rgb2-564-08... 305 e-137 BT056385_1(BT056385|pid:none) Salmo salar clone ssal-rgb2-554-07... 303 e-136 BC020803_1(BC020803|pid:none) Homo sapiens developmentally regul... 306 e-134 DQ215861_1(DQ215861|pid:none) Taeniopygia guttata clone 0058P004... 305 e-134 AL844504_241(AL844504|pid:none) Plasmodium falciparum 3D7 chromo... 302 e-134 AK080814_1(AK080814|pid:none) Mus musculus adult male corpora qu... 306 e-134 AL117202_32(AL117202|pid:none) Caenorhabditis elegans YAC Y47D3A... 300 e-133 FN357816_4(FN357816|pid:none) Schistosoma mansoni genome sequenc... 299 e-132 EU670507_1(EU670507|pid:none) Drosophila sechellia strain ss77 1... 299 e-131 EU310302_1(EU310302|pid:none) Drosophila mauritiana strain 105 1... 299 e-131 EU670439_1(EU670439|pid:none) Drosophila simulans strain Florida... 299 e-131 (P32234) RecName: Full=GTP-binding protein 128up; &AE013599_144... 297 e-131 S42582(S42582;S33467) GTP-binding protein 128up - fruit fly (Dro... 297 e-130 AM502254_481(AM502254|pid:none) Leishmania infantum chromosome 36. 294 e-130 AM494972_249(AM494972|pid:none) Leishmania braziliensis chromoso... 291 e-128 CP000581_619(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 293 e-123 AL590445_42(AL590445|pid:none) chromosome V of strain GB-M1 of E... 270 e-121 (Q9UT21) RecName: Full=Uncharacterized GTP-binding protein C9.07... 273 e-120 D89135_1(D89135|pid:none) Schizosaccharomyces pombe mRNA, partia... 273 e-120 BC073378_1(BC073378|pid:none) Xenopus laevis GTP-binding protein... 252 e-118 FN392319_562(FN392319|pid:none) Pichia pastoris GS115 chromosome... 255 e-118 CR382127_8(CR382127|pid:none) Yarrowia lipolytica strain CLIB122... 254 e-118 (P39729) RecName: Full=GTP-binding protein RBG1; AltName: Full=R... 249 e-117 CU928168_61(CU928168|pid:none) Kluyveromyces thermotolerans stra... 250 e-114 AM270407_21(AM270407|pid:none) Aspergillus niger contig An18c015... 247 e-114 AM920433_219(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 236 e-110 AC007843_4(AC007843|pid:none) Arabidopsis thaliana chromosome I ... 239 e-109 AC104272_7(AC104272|pid:none) Oryza sativa (japonica cultivar-gr... 242 e-109 AF014821_1(AF014821|pid:none) Pisum sativum developmentally regu... 238 e-108 AF370258_1(AF370258|pid:none) Arabidopsis thaliana putative deve... 239 e-108 AC022492_17(AC022492|pid:none) Genomic sequence for Arabidopsis ... 236 e-108 EU965090_1(EU965090|pid:none) Zea mays clone 283745 developmenta... 237 e-107 (P34280) RecName: Full=Uncharacterized GTP-binding protein C02F5... 231 e-107 AY891424_1(AY891424|pid:none) Synthetic construct Homo sapiens c... 225 e-107 AE014297_2787(AE014297|pid:none) Drosophila melanogaster chromos... 231 e-107 S44605(S44605)C02F5.3 protein - Caenorhabditis elegans 228 e-106 AC010926_14(AC010926|pid:none) Arabidopsis thaliana chromosome 1... 232 e-106 BC076919_1(BC076919|pid:none) Xenopus tropicalis developmentally... 221 e-106 AY398336_1(AY398336|pid:none) Danio rerio clone RK115A3G01 devel... 222 e-105 CR762167_1(CR762167|pid:none) Xenopus tropicalis finished cDNA, ... 219 e-105 AY862193_1(AY862193|pid:none) Gibberella moniliformis GTP bindin... 239 e-105 AY224594_1(AY224594|pid:none) Danio rerio developmentally regula... 219 e-105 AF035177_1(AF035177|pid:none) Oncorhynchus tshawytsha GTP-bindin... 219 e-104 (Q54WT4) RecName: Full=Developmentally-regulated GTP-binding pro... 226 e-104 BT074527_1(BT074527|pid:none) Osmerus mordax clone omor-eva-520-... 219 e-104 AP007150_328(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 226 e-103 AF407338_1(AF407338|pid:none) Lentinula edodes developmentally r... 215 e-102 CP001329_180(CP001329|pid:none) Micromonas sp. RCC299 chromosome... 213 e-100 FN392321_1157(FN392321|pid:none) Pichia pastoris GS115 chromosom... 211 4e-99 CP000081_526(CP000081|pid:none) Leishmania major chromosome 35, ... 219 8e-99 CR932508_1(CR932508|pid:none) Paramecium tetraurelia, Small GTPa... 197 2e-98 CR954201_601(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 222 4e-98 AM502253_524(AM502253|pid:none) Leishmania infantum chromosome 35. 218 7e-98 CR382126_649(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 207 1e-96 FM992692_447(FM992692|pid:none) Candida dubliniensis CD36 chromo... 203 1e-95 (P53295) RecName: Full=Uncharacterized GTP-binding protein YGR17... 198 4e-94 CR857302_1(CR857302|pid:none) Pongo abelii mRNA; cDNA DKFZp469I1... 188 5e-94 AM910993_119(AM910993|pid:none) Plasmodium knowlesi strain H chr... 187 6e-94 CU928179_466(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 202 8e-94 CU928166_97(CU928166|pid:none) Kluyveromyces thermotolerans stra... 201 1e-93 AE017346_325(AE017346|pid:none) Cryptococcus neoformans var. neo... 196 2e-92 AP007164_187(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 190 1e-88 DQ215857_1(DQ215857|pid:none) Taeniopygia guttata clone 0058P004... 199 3e-87 AL590448_128(AL590448|pid:none) chromosome VIII of strain GB-M1 ... 186 5e-82 (Q58722) RecName: Full=Uncharacterized GTP-binding protein MJ132... 194 1e-81 AE010299_4240(AE010299|pid:none) Methanosarcina acetivorans str.... 174 8e-79 CP000099_560(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 174 2e-78 AE000782_2121(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 172 3e-76 CP000559_1388(CP000559|pid:none) Methanocorpusculum labreanum Z,... 163 5e-76 CP000254_602(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 156 6e-72 CP000562_1691(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 160 4e-71 CR382135_475(CR382135|pid:none) Debaryomyces hansenii strain CBS... 250 7e-65 AM180088_626(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 142 3e-64 BA000011_1(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA, c... 139 4e-62 CR936257_2217(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 131 3e-61 CP001365_776(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 132 8e-61 T43254(T43254) GTP-binding protein - Thermoplasma acidophilum &... 135 6e-60 AK319004_1(AK319004|pid:none) Arabidopsis thaliana AT1G72660 mRN... 232 2e-59 AL133085_1(AL133085|pid:none) Homo sapiens mRNA; cDNA DKFZp434N1... 217 8e-55 T40599(T40599)hypothetical protein SPBC649.06 - fission yeast (... 202 2e-50 AL023587_6(AL023587|pid:none) S.pombe chromosome II cosmid c649. 202 2e-50 AY815154_1(AY815154|pid:none) Schistosoma japonicum SJCHGC02630 ... 120 4e-49 BA000001_1719(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 122 1e-46 AJ248284_203(AJ248284|pid:none) Pyrococcus abyssi complete genom... 120 3e-46 Y13986_1(Y13986|pid:none) Ostertagia circumcincta mRNA for GTP-b... 184 6e-45 GM015171_204(GM015171|pid:none) Sequence 1 from Patent EP1923464. 121 6e-45 CP000855_1288(CP000855|pid:none) Thermococcus onnurineus NA1, co... 119 1e-44 CP000742_745(CP000742|pid:none) Methanococcus vannielii SB, comp... 179 1e-43 DQ407846_1(DQ407846|pid:none) Ictalurus punctatus clone SEEF09R ... 137 2e-42 CP000745_682(CP000745|pid:none) Methanococcus maripaludis C7, co... 176 2e-42 BX950229_1443(BX950229|pid:none) Methanococcus maripaludis strai... 175 4e-42 CP000477_92(CP000477|pid:none) Methanosaeta thermophila PT, comp... 172 2e-41 AM473981_1(AM473981|pid:none) Vitis vinifera contig VV78X189459.... 171 5e-41 CP000102_638(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 162 3e-38 AE009439_1199(AE009439|pid:none) Methanopyrus kandleri AV19, com... 108 4e-38 EU016634_9(EU016634|pid:none) Uncultured Group I marine crenarch... 152 2e-35 AM464615_1(AM464615|pid:none) Vitis vinifera contig VV78X217967.... 144 9e-33 AL022071_1(AL022071|pid:none) S.pombe chromosome II cosmid c354.... 142 3e-32 CP000575_1258(CP000575|pid:none) Staphylothermus marinus F1, com... 102 6e-31 AK221170_1(AK221170|pid:none) Arabidopsis thaliana mRNA for GTP-... 135 2e-30 F72509(F72509)probable developmentally regulated GTP-binding pro... 93 2e-28 CP000561_568(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 89 2e-23 CP000504_1638(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 67 8e-20 CP000493_379(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 97 1e-18 CR954207_417(CR954207|pid:none) Ostreococcus tauri strain OTTH05... 94 1e-17 BA000023_574(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 66 1e-17 CP000505_670(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 92 5e-17 CP001014_678(CP001014|pid:none) Thermoproteus neutrophilus V24St... 76 2e-12 CP000968_1(CP000968|pid:none) Candidatus Korarchaeum cryptofilum... 72 4e-11 AP009389_469(AP009389|pid:none) Pelotomaculum thermopropionicum ... 69 3e-10 AE017199_112(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 69 4e-10 CP000852_960(CP000852|pid:none) Caldivirga maquilingensis IC-167... 68 6e-10 CP001402_196(CP001402|pid:none) Sulfolobus islandicus M.16.4, co... 67 1e-09 CP001400_178(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 67 1e-09 CP001399_211(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 67 2e-09 CP001403_182(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,... 67 2e-09 CP000478_2500(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 66 3e-09 CP001034_2137(CP001034|pid:none) Natranaerobius thermophilus JW/... 64 1e-08 CP000144_15(CP000144|pid:none) Rhodobacter sphaeroides 2.4.1 chr... 63 2e-08 CP000662_636(CP000662|pid:none) Rhodobacter sphaeroides ATCC 170... 63 2e-08 CP001151_47(CP001151|pid:none) Rhodobacter sphaeroides KD131 chr... 63 2e-08 CP000769_189(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, co... 59 3e-07 CP000361_1572(CP000361|pid:none) Arcobacter butzleri RM4018, com... 59 4e-07 CP000088_2173(CP000088|pid:none) Thermobifida fusca YX, complete... 59 5e-07 (P47624) RecName: Full=Uncharacterized GTP-binding protein MG384... 58 6e-07 CP001055_90(CP001055|pid:none) Elusimicrobium minutum Pei191, co... 55 7e-07 AM711867_1509(AM711867|pid:none) Clavibacter michiganensis subsp... 58 8e-07 AM849034_1793(AM849034|pid:none) Clavibacter michiganensis subsp... 58 8e-07 AM260479_1270(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 57 1e-06 AB110607_1(AB110607|pid:none) Thermus thermophilus gene for cons... 57 1e-06 AE017221_1416(AE017221|pid:none) Thermus thermophilus HB27, comp... 57 1e-06 CP000474_2266(CP000474|pid:none) Arthrobacter aurescens TC1, com... 57 1e-06 CU207366_2830(CU207366|pid:none) Gramella forsetii KT0803 comple... 57 1e-06 AP008955_1849(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 57 1e-06 CP000139_1634(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 57 1e-06 AP009178_1232(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 57 1e-06 CP001341_2108(CP001341|pid:none) Arthrobacter chlorophenolicus A... 57 1e-06 CP000113_1442(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 57 1e-06 CP000454_2367(CP000454|pid:none) Arthrobacter sp. FB24, complete... 57 1e-06 CP000932_180(CP000932|pid:none) Campylobacter lari RM2100, compl... 57 1e-06 AE006470_2184(AE006470|pid:none) Chlorobium tepidum TLS, complet... 57 2e-06 CP001251_582(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 56 2e-06 CP000487_1460(CP000487|pid:none) Campylobacter fetus subsp. fetu... 56 2e-06 BX571658_142(BX571658|pid:none) Wolinella succinogenes, complete... 56 2e-06 CP000264_2283(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 56 2e-06 CP000356_1692(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 56 3e-06 (P75215) RecName: Full=Uncharacterized GTP-binding protein MG384... 56 3e-06 AP006627_1534(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 56 3e-06 CP001279_1351(CP001279|pid:none) Nautilia profundicola AmH, comp... 55 4e-06 CP000251_4166(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 55 4e-06 CP001359_4289(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 55 4e-06 AP006841_1122(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 55 4e-06 CU179680_510(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 55 4e-06 CP000969_839(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 55 5e-06 AE000512_98(AE000512|pid:none) Thermotoga maritima MSB8, complet... 55 5e-06 CP000517_811(CP000517|pid:none) Lactobacillus helveticus DPC 457... 55 5e-06 CP001618_1614(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 55 5e-06 CP000702_816(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 55 5e-06 CP000025_86(CP000025|pid:none) Campylobacter jejuni RM1221, comp... 55 7e-06 CP000814_87(CP000814|pid:none) Campylobacter jejuni subsp. jejun... 55 7e-06 CP001099_153(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 55 7e-06 BA000028_2042(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 55 7e-06 CP001110_229(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 55 7e-06 CP000607_224(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 55 7e-06 CP000148_3160(CP000148|pid:none) Geobacter metallireducens GS-15... 55 7e-06 CP001097_2200(CP001097|pid:none) Chlorobium limicola DSM 245, co... 54 9e-06 CP000463_548(CP000463|pid:none) Rhodopseudomonas palustris BisA5... 54 9e-06 AE017198_912(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 54 9e-06 AP006628_89(AP006628|pid:none) Onion yellows phytoplasma OY-M DN... 54 9e-06 CP000096_163(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 54 9e-06 CP000413_844(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 54 9e-06 CR931997_562(CR931997|pid:none) Corynebacterium jeikeium K411 co... 54 9e-06 CP000770_148(CP000770|pid:none) Candidatus Sulcia muelleri GWSS,... 54 1e-05 AP009049_795(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 54 1e-05 CP001280_3202(CP001280|pid:none) Methylocella silvestris BL2, co... 54 1e-05 CP000383_69(CP000383|pid:none) Cytophaga hutchinsonii ATCC 33406... 54 1e-05 BA000040_425(BA000040|pid:none) Bradyrhizobium japonicum USDA 11... 54 1e-05 CP000302_2906(CP000302|pid:none) Shewanella denitrificans OS217,... 54 1e-05 CP000494_404(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 54 1e-05 CP000250_250(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 54 1e-05 CP000325_3054(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 54 1e-05 AP011115_1033(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 54 1e-05 AE017180_3194(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 54 1e-05 AL672130_1(AL672130|pid:none) Mouse DNA sequence from clone RP24... 54 1e-05 CP000771_358(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 54 1e-05 CP000916_593(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 54 1e-05 CU234118_406(CU234118|pid:none) Bradyrhizobium sp. ORS278,comple... 54 1e-05 AK001603_1(AK001603|pid:none) Homo sapiens cDNA FLJ10741 fis, cl... 54 1e-05 (Q9H4K7) RecName: Full=GTP-binding protein 5; AltName: Full=Prot... 54 1e-05 AE017125_8(AE017125|pid:none) Helicobacter hepaticus ATCC 51449,... 54 1e-05 CP000384_3533(CP000384|pid:none) Mycobacterium sp. MCS, complete... 54 2e-05 CP001096_157(CP001096|pid:none) Rhodopseudomonas palustris TIE-1... 54 2e-05 BX572593_163(BX572593|pid:none) Rhodopseudomonas palustris CGA00... 54 2e-05 CP000910_3203(CP000910|pid:none) Renibacterium salmoninarum ATCC... 54 2e-05 CP000557_2494(CP000557|pid:none) Geobacillus thermodenitrificans... 54 2e-05 CP000408_751(CP000408|pid:none) Streptococcus suis 98HAH33, comp... 54 2e-05 CP000962_2963(CP000962|pid:none) Clostridium botulinum A3 str. L... 54 2e-05 CP001100_681(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 54 2e-05 CP000768_77(CP000768|pid:none) Campylobacter jejuni subsp. doyle... 54 2e-05 BC083707_1(BC083707|pid:none) Rattus norvegicus GTP binding prot... 54 2e-05 CP001083_3118(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 53 2e-05 CP001336_4269(CP001336|pid:none) Desulfitobacterium hafniense DC... 53 2e-05 AE014184_471(AE014184|pid:none) Tropheryma whipplei str. Twist, ... 53 2e-05 CP000108_1842(CP000108|pid:none) Chlorobium chlorochromatii CaD3... 53 2e-05 BX251411_8(BX251411|pid:none) Tropheryma whipplei TW08/27, compl... 53 2e-05 CP000698_304(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 53 2e-05 CP000023_1377(CP000023|pid:none) Streptococcus thermophilus LMG ... 53 2e-05 CP001114_2453(CP001114|pid:none) Deinococcus deserti VCD115, com... 53 3e-05 CU458896_1594(CU458896|pid:none) Mycobacterium abscessus chromos... 53 3e-05 BA000043_2606(BA000043|pid:none) Geobacillus kaustophilus HTA426... 53 3e-05 CP000503_3148(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 53 3e-05 CP000854_3710(CP000854|pid:none) Mycobacterium marinum M, comple... 53 3e-05 CP000003_1057(CP000003|pid:none) Streptococcus pyogenes MGAS1039... 53 3e-05 AE009948_1428(AE009948|pid:none) Streptococcus agalactiae 2603V/... 53 3e-05 CP001390_1228(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 53 3e-05 BA000034_849(BA000034|pid:none) Streptococcus pyogenes SSI-1 DNA... 53 3e-05 CP000259_1130(CP000259|pid:none) Streptococcus pyogenes MGAS9429... 53 3e-05 EF215167_1(EF215167|pid:none) Callithrix jacchus clone K24-46.3_... 53 3e-05 CP000056_1067(CP000056|pid:none) Streptococcus pyogenes MGAS6180... 53 3e-05 CP000260_1144(CP000260|pid:none) Streptococcus pyogenes MGAS1027... 53 3e-05 DQ068067_20(DQ068067|pid:none) Uncultured bacterium BAC13K9BAC, ... 53 3e-05 AE014074_1010(AE014074|pid:none) Streptococcus pyogenes MGAS315,... 53 3e-05 CP000509_3399(CP000509|pid:none) Nocardioides sp. JS614, complet... 53 3e-05 FM177140_1521(FM177140|pid:none) Lactobacillus casei BL23 comple... 52 3e-05 AE017333_2796(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 52 3e-05 AM946015_1133(AM946015|pid:none) Streptococcus uberis 0140J comp... 52 3e-05 AE014133_726(AE014133|pid:none) Streptococcus mutans UA159, comp... 52 3e-05 CP000679_1498(CP000679|pid:none) Caldicellulosiruptor saccharoly... 52 3e-05 AE015927_1842(AE015927|pid:none) Clostridium tetani E88, complet... 52 3e-05 CP000423_1263(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 52 3e-05 AP008957_3792(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 52 3e-05 EU015081_52(EU015081|pid:none) Helicobacter cetorum strain MIT-0... 52 3e-05 CP001349_4539(CP001349|pid:none) Methylobacterium nodulans ORS 2... 52 3e-05 CP000387_768(CP000387|pid:none) Streptococcus sanguinis SK36, co... 52 3e-05 AM295007_761(AM295007|pid:none) Streptococcus pyogenes Manfredo ... 52 3e-05 CP001124_162(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 52 3e-05 AM295250_1247(AM295250|pid:none) Staphylococcus carnosus subsp. ... 52 3e-05 CP001072_297(CP001072|pid:none) Helicobacter pylori Shi470, comp... 52 3e-05 AE014299_3548(AE014299|pid:none) Shewanella oneidensis MR-1, com... 52 3e-05 CP000685_416(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 52 5e-05 AP007281_635(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 52 5e-05 CP000830_1459(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 52 5e-05 CP000480_4464(CP000480|pid:none) Mycobacterium smegmatis str. MC... 52 5e-05 AM398681_1321(AM398681|pid:none) Flavobacterium psychrophilum JI... 52 5e-05 CP000359_2203(CP000359|pid:none) Deinococcus geothermalis DSM 11... 52 5e-05 CP000879_999(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 52 5e-05 CP001029_4818(CP001029|pid:none) Methylobacterium populi BJ001, ... 52 5e-05 AE005176_1587(AE005176|pid:none) Lactococcus lactis subsp. lacti... 52 5e-05 CP000878_240(CP000878|pid:none) Prochlorococcus marinus str. MIT... 43 6e-05 CP001056_520(CP001056|pid:none) Clostridium botulinum B str. Ekl... 52 6e-05 CP000781_2040(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 52 6e-05 CP000362_2475(CP000362|pid:none) Roseobacter denitrificans OCh 1... 52 6e-05 CP001078_498(CP001078|pid:none) Clostridium botulinum E3 str. Al... 52 6e-05 CP000241_306(CP000241|pid:none) Helicobacter pylori HPAG1, compl... 52 6e-05 CP000046_1658(CP000046|pid:none) Staphylococcus aureus subsp. au... 52 6e-05 CP000821_954(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 52 6e-05 (P0C1E6) RecName: Full=Uncharacterized GTP-binding protein Cgl23... 52 6e-05 CP000447_3062(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 52 6e-05 CP001080_839(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 52 6e-05 BA000026_194(BA000026|pid:none) Mycoplasma penetrans HF-2 DNA, c... 52 6e-05 CP000425_1553(CP000425|pid:none) Lactococcus lactis subsp. cremo... 52 6e-05 AJ938182_1513(AJ938182|pid:none) Staphylococcus aureus RF122 com... 52 6e-05 CP000159_1153(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 52 6e-05 CP000248_1141(CP000248|pid:none) Novosphingobium aromaticivorans... 52 6e-05 AE015924_693(AE015924|pid:none) Porphyromonas gingivalis W83, co... 52 6e-05 AP009044_2283(AP009044|pid:none) Corynebacterium glutamicum R DN... 52 6e-05 AP009484_1284(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 52 6e-05 AM263198_1550(AM263198|pid:none) Listeria welshimeri serovar 6b ... 51 8e-05 CP001146_1122(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 51 8e-05 U31922_1(U31922|pid:none) Streptococcus pyogenes GTP-binding pro... 51 8e-05 BT077215_1(BT077215|pid:none) Caligus rogercresseyi clone crog-e... 51 8e-05 CP001175_1013(CP001175|pid:none) Listeria monocytogenes HCC23, c... 51 8e-05 CP001173_273(CP001173|pid:none) Helicobacter pylori G27, complet... 51 8e-05 FM204883_1393(FM204883|pid:none) Streptococcus equi subsp. equi ... 51 8e-05 CP000908_4349(CP000908|pid:none) Methylobacterium extorquens PA1... 51 8e-05 CP000721_509(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 51 8e-05 CP000479_1655(CP000479|pid:none) Mycobacterium avium 104, comple... 51 8e-05 CP000020_273(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 51 8e-05 CP001147_426(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 51 8e-05 AE016958_2264(AE016958|pid:none) Mycobacterium avium subsp. para... 51 8e-05 CP000896_343(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 51 8e-05 CP000083_4376(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 51 8e-05 (O25074) RecName: Full=Uncharacterized GTP-binding protein HP_03... 51 8e-05 CR954246_2588(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 51 1e-04 CR932520_1(CR932520|pid:none) Paramecium tetraurelia, Small GTPa... 51 1e-04 AM260522_514(AM260522|pid:none) Helicobacter acinonychis str. Sh... 51 1e-04 G97692(G97692)GTP-binding protein (AF019407) [imported] - Agroba... 51 1e-04 CP000252_708(CP000252|pid:none) Syntrophus aciditrophicus SB, co... 51 1e-04 (P20964) RecName: Full=Spo0B-associated GTP-binding protein; &A... 51 1e-04 CP000319_505(CP000319|pid:none) Nitrobacter hamburgensis X14, co... 51 1e-04 CP000920_988(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 51 1e-04 CP000628_3688(CP000628|pid:none) Agrobacterium radiobacter K84 c... 51 1e-04 CP000918_1083(CP000918|pid:none) Streptococcus pneumoniae 70585,... 51 1e-04 (A4D1E9) RecName: Full=GTP-binding protein 10; AltName: Full=Pro... 51 1e-04 BC107714_1(BC107714|pid:none) Homo sapiens GTP-binding protein 1... 51 1e-04 CP001033_1201(CP001033|pid:none) Streptococcus pneumoniae CGSP14... 51 1e-04 AM420293_1383(AM420293|pid:none) Saccharopolyspora erythraea NRR... 51 1e-04 AK095561_1(AK095561|pid:none) Homo sapiens cDNA FLJ38242 fis, cl... 51 1e-04 CP000936_1070(CP000936|pid:none) Streptococcus pneumoniae Hungar... 51 1e-04 AB171212_1(AB171212|pid:none) Macaca fascicularis brain cDNA clo... 51 1e-04 AP006618_1362(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 51 1e-04 AE013598_1598(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 49 1e-04 AP009493_4955(AP009493|pid:none) Streptomyces griseus subsp. gri... 50 1e-04 BT015198_1(BT015198|pid:none) Drosophila melanogaster RE71283 fu... 50 1e-04 CP000820_5147(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 50 1e-04 CP001577_138(CP001577|pid:none) Micromonas sp. RCC299 chromosome... 50 1e-04 CP000158_2520(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 50 1e-04 CP000473_3121(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 50 1e-04 CP001079_581(CP001079|pid:none) Anaplasma marginale str. Florida... 50 1e-04 AE015929_1327(AE015929|pid:none) Staphylococcus epidermidis ATCC... 50 1e-04 AY142797_1(AY142797|pid:none) Heliobacillus mobilis SPO0B-associ... 50 1e-04 AE017283_823(AE017283|pid:none) Propionibacterium acnes KPA17120... 50 1e-04 CP001095_2221(CP001095|pid:none) Bifidobacterium longum subsp. i... 50 1e-04 AY075526_1(AY075526|pid:none) Drosophila melanogaster RE72863 fu... 50 1e-04 CP000667_3425(CP000667|pid:none) Salinispora tropica CNB-440, co... 50 1e-04 AE014134_1544(AE014134|pid:none) Drosophila melanogaster chromos... 50 1e-04 AY458644_64(AY458644|pid:none) Uncultured marine bacterium 562 c... 50 1e-04 BT080148_1(BT080148|pid:none) Caligus clemensi clone ccle-evs-50... 50 1e-04 AE000516_2592(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 50 1e-04 AP006716_1277(AP006716|pid:none) Staphylococcus haemolyticus JCS... 50 1e-04 A90556(A90556) gtp-binding protein [imported] - Mycoplasma pulmo... 50 1e-04 CP000087_1324(CP000087|pid:none) Rickettsia bellii RML369-C, com... 50 1e-04 AE000513_83(AE000513|pid:none) Deinococcus radiodurans R1 chromo... 50 1e-04 CP001337_1598(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 50 1e-04 CP001217_300(CP001217|pid:none) Helicobacter pylori P12, complet... 50 1e-04 CP000030_416(CP000030|pid:none) Anaplasma marginale str. St. Mar... 50 1e-04 CP001107_1629(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 50 2e-04 CP001145_530(CP001145|pid:none) Coprothermobacter proteolyticus ... 50 2e-04 BX908798_219(BX908798|pid:none) Parachlamydia-related symbiont U... 50 2e-04 AK299147_1(AK299147|pid:none) Homo sapiens cDNA FLJ60822 complet... 50 2e-04 FM178379_363(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 50 2e-04 BA000030_5476(BA000030|pid:none) Streptomyces avermitilis MA-468... 50 2e-04 CP000941_1438(CP000941|pid:none) Xylella fastidiosa M12, complet... 50 2e-04 DQ489736_1329(DQ489736|pid:none) Leuconostoc citreum KM20, compl... 50 2e-04 CP001615_2663(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 50 2e-04 CP000750_3426(CP000750|pid:none) Kineococcus radiotolerans SRS30... 50 2e-04 BA000016_2127(BA000016|pid:none) Clostridium perfringens str. 13... 50 2e-04 (Q8K9G1) RecName: Full=Uncharacterized GTP-binding protein BUsg_... 50 2e-04 AP008937_626(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 50 2e-04 AE016830_1431(AE016830|pid:none) Enterococcus faecalis V583, com... 50 2e-04 CP000544_1815(CP000544|pid:none) Halorhodospira halophila SL1, c... 50 2e-04 CP000930_2609(CP000930|pid:none) Heliobacterium modesticaldum Ic... 50 2e-04 AM942444_1366(AM942444|pid:none) Corynebacterium urealyticum DSM... 50 2e-04 CP000238_586(CP000238|pid:none) Baumannia cicadellinicola str. H... 50 2e-04 CT005272_309(CT005272|pid:none) Leishmania major strain Friedlin... 50 2e-04 CP000233_1082(CP000233|pid:none) Lactobacillus salivarius UCC118... 50 2e-04 CP000850_3714(CP000850|pid:none) Salinispora arenicola CNS-205, ... 49 3e-04 BT021695_1(BT021695|pid:none) Bos taurus GTP binding protein 5 (... 49 3e-04 CP000510_506(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 49 3e-04 CP001323_212(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 49 3e-04 CP000848_1278(CP000848|pid:none) Rickettsia rickettsii str. 'She... 49 3e-04 CP000766_1319(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 49 3e-04 CP000875_4207(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 49 3e-04 CP000927_4694(CP000927|pid:none) Caulobacter sp. K31, complete g... 49 3e-04 (Q6DHF7) RecName: Full=GTP-binding protein 10; &BC076017_1(BC07... 49 3e-04 CP000847_1193(CP000847|pid:none) Rickettsia akari str. Hartford,... 49 3e-04 AM743169_1212(AM743169|pid:none) Stenotrophomonas maltophilia K2... 49 3e-04 CR954253_793(CR954253|pid:none) Lactobacillus delbrueckii subsp.... 49 3e-04 CP000606_870(CP000606|pid:none) Shewanella loihica PV-4, complet... 49 3e-04 CP000230_1236(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 49 3e-04 CP000435_2351(CP000435|pid:none) Synechococcus sp. CC9311, compl... 42 3e-04 AP009256_242(AP009256|pid:none) Bifidobacterium adolescentis ATC... 49 4e-04 CP000449_2775(CP000449|pid:none) Maricaulis maris MCS10, complet... 49 4e-04 (P57469) RecName: Full=Uncharacterized GTP-binding protein BU389... 49 4e-04 CP000903_4176(CP000903|pid:none) Bacillus weihenstephanensis KBA... 49 4e-04 AE017243_38(AE017243|pid:none) Mycoplasma hyopneumoniae J, compl... 49 5e-04 CP000812_389(CP000812|pid:none) Thermotoga lettingae TMO, comple... 49 5e-04 AP008971_367(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 49 5e-04 (Q5M8V6) RecName: Full=GTP-binding protein 10; &BC087811_1(BC08... 49 5e-04 CP001601_1858(CP001601|pid:none) Corynebacterium aurimucosum ATC... 49 5e-04 AE017244_43(AE017244|pid:none) Mycoplasma hyopneumoniae 7448, co... 49 5e-04 CR925677_497(CR925677|pid:none) Ehrlichia ruminantium str. Garde... 49 5e-04 CR767821_505(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 49 5e-04 CP000414_464(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 49 5e-04 (Q5U528) RecName: Full=GTP-binding protein 10; &BC084856_1(BC08... 49 5e-04 CP000481_755(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 49 5e-04 BA000035_2264(BA000035|pid:none) Corynebacterium efficiens YS-31... 49 5e-04 AE017332_43(AE017332|pid:none) Mycoplasma hyopneumoniae 232, com... 49 5e-04 CP000524_298(CP000524|pid:none) Bartonella bacilliformis KC583, ... 48 7e-04 CP000675_2825(CP000675|pid:none) Legionella pneumophila str. Cor... 48 7e-04 BT053673_1(BT053673|pid:none) Drosophila melanogaster FI02804 fu... 48 7e-04 CU928164_3655(CU928164|pid:none) Escherichia coli IAI39 chromoso... 48 7e-04 (Q9I7M2) RecName: Full=GTP-binding protein 10 homolog; &AE01413... 48 7e-04 CP000758_1042(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 48 7e-04 CP000038_3107(CP000038|pid:none) Shigella sonnei Ss046, complete... 48 7e-04 AE016879_4314(AE016879|pid:none) Bacillus anthracis str. Ames, c... 48 7e-04 AY070937_1(AY070937|pid:none) Drosophila melanogaster RE03627 fu... 48 7e-04 AE016877_4237(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 48 7e-04 BX248359_82(BX248359|pid:none) Corynebacterium diphtheriae gravi... 48 7e-04 CP001177_4377(CP001177|pid:none) Bacillus cereus AH187, complete... 48 7e-04 AE017355_4131(AE017355|pid:none) Bacillus thuringiensis serovar ... 48 7e-04 CP000764_3002(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 48 7e-04 CP001283_4429(CP001283|pid:none) Bacillus cereus AH820, complete... 48 7e-04 CP000034_3120(CP000034|pid:none) Shigella dysenteriae Sd197, com... 48 7e-04 CP001103_3701(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 48 7e-04 A85982(A85982) probable GTP-binding factor yhbZ [imported] - Esc... 48 7e-04 CP000672_1301(CP000672|pid:none) Haemophilus influenzae PittGG, ... 48 9e-04 BX897700_142(BX897700|pid:none) Bartonella quintana str. Toulous... 48 9e-04 AF480915_1(AF480915|pid:none) Legionella pneumophila clone pA17A... 48 9e-04 AM746676_1801(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 48 9e-04 CP000513_460(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 48 9e-04 AE017354_2599(AE017354|pid:none) Legionella pneumophila subsp. p... 48 9e-04 CP001185_734(CP001185|pid:none) Thermosipho africanus TCF52B, co... 48 9e-04 AM502254_369(AM502254|pid:none) Leishmania infantum chromosome 36. 48 9e-04 CP000388_3705(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 48 9e-04 (Q29K06) RecName: Full=GTP-binding protein 10 homolog; 48 9e-04 CR628337_2585(CR628337|pid:none) Legionella pneumophila str. Len... 48 9e-04 CP000323_1676(CP000323|pid:none) Psychrobacter cryohalolentis K5... 47 0.001 AM884176_670(AM884176|pid:none) Chlamydia trachomatis strain L2/... 47 0.001 CP001074_4295(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 47 0.001 CP001275_1653(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 47 0.001 CP000450_924(CP000450|pid:none) Nitrosomonas eutropha C91, compl... 47 0.001 CP000082_1504(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 47 0.001 CP000453_842(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 47 0.001 CP000051_438(CP000051|pid:none) Chlamydia trachomatis A/HAR-13, ... 47 0.001 CP000249_1205(CP000249|pid:none) Frankia sp. CcI3, complete geno... 47 0.001 FM954972_315(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 47 0.001 AP007255_4079(AP007255|pid:none) Magnetospirillum magneticum AMB... 47 0.001 CP000411_969(CP000411|pid:none) Oenococcus oeni PSU-1, complete ... 47 0.001 CP000282_1008(CP000282|pid:none) Saccharophagus degradans 2-40, ... 47 0.001 FM211050_43(FM211050|pid:none) Photorhabdus asymbiotica subsp. a... 47 0.002 FJ377704_1(FJ377704|pid:none) Vibrio vulnificus strain LMG 13545... 47 0.002 BX293980_414(BX293980|pid:none) Mycoplasma mycoides subsp. mycoi... 47 0.002 CP000614_543(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 47 0.002 CP000783_3478(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 47 0.002 AD0903(AD0903) probable GTP-binding protein [imported] - Salmone... 47 0.002 FJ377707_1(FJ377707|pid:none) Vibrio harveyi strain LMG 4044 Cgt... 47 0.002 CP000653_3586(CP000653|pid:none) Enterobacter sp. 638, complete ... 47 0.002 CP000880_4151(CP000880|pid:none) Salmonella enterica subsp. ariz... 47 0.002 FJ377703_1(FJ377703|pid:none) Vibrio parahaemolyticus strain LMG... 47 0.002 AE006468_3207(AE006468|pid:none) Salmonella enterica subsp. ente... 47 0.002 AM933173_3079(AM933173|pid:none) Salmonella enterica subsp. ente... 47 0.002 CU207211_2633(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 47 0.002 CR378664_42(CR378664|pid:none) Photobacterium profundum SS9; seg... 47 0.002 CP000236_521(CP000236|pid:none) Ehrlichia chaffeensis str. Arkan... 47 0.002 CP000116_866(CP000116|pid:none) Thiobacillus denitrificans ATCC ... 46 0.002 AP008232_366(AP008232|pid:none) Sodalis glossinidius str. 'morsi... 46 0.002 AE009952_667(AE009952|pid:none) Yersinia pestis KIM, complete ge... 46 0.002 CP000804_4153(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 46 0.002 AM889285_3173(AM889285|pid:none) Gluconacetobacter diazotrophicu... 46 0.002 CP000964_520(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 46 0.002 CP001184_483(CP001184|pid:none) Ureaplasma urealyticum serovar 1... 46 0.002 (Q89AE7) RecName: Full=Uncharacterized GTP-binding protein bbp_3... 46 0.002 CP001503_471(CP001503|pid:none) Burkholderia glumae BGR1 chromos... 46 0.002 CP000458_583(CP000458|pid:none) Burkholderia cenocepacia HI2424 ... 46 0.002 CP000440_482(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 46 0.002 CP000151_486(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 46 0.002 CP001052_3384(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 46 0.003 CP000478_3607(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 46 0.003 CP000027_2(CP000027|pid:none) Dehalococcoides ethenogenes 195, c... 46 0.003 A72065(A72065) GTP binding protein - Chlamydophila pneumoniae (s... 46 0.003 CP000009_135(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 46 0.003 CP000270_3886(CP000270|pid:none) Burkholderia xenovorans LB400 c... 46 0.003 AE002161_206(AE002161|pid:none) Chlamydophila pneumoniae AR39, c... 46 0.003 CP000934_459(CP000934|pid:none) Cellvibrio japonicus Ueda107, co... 46 0.003 CP000240_2288(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 45 0.004 CP000109_342(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 45 0.004 AM439695_1(AM439695|pid:none) Vitis vinifera contig VV78X101685.... 45 0.004 CP000949_4469(CP000949|pid:none) Pseudomonas putida W619, comple... 45 0.004 AP004570_14(AP004570|pid:none) Oryza sativa Japonica Group genom... 45 0.004 AP006861_808(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA,... 45 0.004 CP000390_3424(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 45 0.004 CP000749_4188(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 45 0.004 CR555306_445(CR555306|pid:none) Azoarcus sp. EbN1 complete genome. 45 0.004 CR848038_194(CR848038|pid:none) Chlamydophila abortus strain S26... 45 0.004 CP000409_1043(CP000409|pid:none) Rickettsia canadensis str. McKi... 45 0.004 CP000094_4853(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 45 0.004 AM286415_402(AM286415|pid:none) Yersinia enterocolitica subsp. e... 45 0.004 CP000713_1582(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 45 0.004 AE015925_197(AE015925|pid:none) Chlamydophila caviae GPIC, compl... 45 0.004 (P44915) RecName: Full=Uncharacterized GTP-binding protein HI087... 45 0.004 BA000012_3093(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 45 0.006 CP000462_898(CP000462|pid:none) Aeromonas hydrophila subsp. hydr... 45 0.006 AE016853_782(AE016853|pid:none) Pseudomonas syringae pv. tomato ... 45 0.006 CU468135_334(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 45 0.006 CP000155_5672(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 45 0.006 CP000395_790(CP000395|pid:none) Borrelia afzelii PKo, complete g... 45 0.006 CP000551_239(CP000551|pid:none) Prochlorococcus marinus str. AS9... 45 0.006 CP000284_2213(CP000284|pid:none) Methylobacillus flagellatus KT,... 45 0.007 CP000123_504(CP000123|pid:none) Mycoplasma capricolum subsp. cap... 45 0.007 AC007583_32(AC007583|pid:none) Arabidopsis thaliana chromosome 1... 45 0.007 AL646052_2818(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 45 0.007 AE016825_850(AE016825|pid:none) Chromobacterium violaceum ATCC 1... 45 0.007 CP000048_753(CP000048|pid:none) Borrelia hermsii DAH, complete g... 45 0.007 CP001140_1281(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 45 0.007 CU694389_29(CU694389|pid:none) Ralstonia solanacearum strain Mol... 45 0.007 CP000089_3442(CP000089|pid:none) Dechloromonas aromatica RCB, co... 45 0.007 CP001068_3021(CP001068|pid:none) Ralstonia pickettii 12J chromos... 45 0.007 CP000360_20(CP000360|pid:none) Acidobacteria bacterium Ellin345,... 41 0.007 CP000512_3603(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 44 0.009 CP000697_232(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 44 0.009 AD2273(AD2273) GTP-binding protein [imported] - Nostoc sp. (stra... 44 0.009 AM443153_3(AM443153|pid:none) Vitis vinifera contig VV78X232680.... 44 0.009 CP000685_2456(CP000685|pid:none) Flavobacterium johnsoniae UW101... 44 0.009 CP000103_1805(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 44 0.009
>AK066361_1(AK066361|pid:none) Oryza sativa Japonica Group cDNA clone:J013063L05, full insert sequence. &AP004306_12(AP004306|pid:none) &AP008213_1679(AP008213|pid:none) Length = 369
Score = 321 bits (823), Expect(2) = e-144 Identities = 145/221 (65%), Positives = 186/221 (84%) Frame = +3
Query: 567 DAMKPLVHKKIIERELDGFGIRLNKQPPPITFKKKEKGGINFSHTPNVNPTQLDSETVKA 746 DA+KP+ HK++IE+EL+GFGIRLNK PP +TF++K+KGGINF+ T V T LD ETVKA Sbjct: 151 DAIKPITHKRLIEKELEGFGIRLNKTPPNLTFRRKDKGGINFTST--VTNTNLDLETVKA 208
Query: 747 ICAEYKIHNADVILRGNCTVDEFIDVIEGNRIYVPCIYVLNKIDAISIEELDLLDKIPHY 926 IC+EY+IHNADV LR + T D+ IDVIEG+RIY+PCIYV+NKID I++EEL++LDK+PHY Sbjct: 209 ICSEYRIHNADVSLRYDATADDLIDVIEGSRIYMPCIYVVNKIDQITLEELEILDKLPHY 268
Query: 927 VPISSHLEWNLDALLDKIWEYLKLIRVYTKPKGLIPDYNEPVVIRGGEEASIETFCNHIH 1106 PIS+HLEWNLD LL+ IWEYL L+R+YTKPKGL PDY +PV++ ++ ++E FCN IH Sbjct: 269 CPISAHLEWNLDGLLEMIWEYLDLVRIYTKPKGLNPDYEDPVIV-SSKKKTVEDFCNRIH 327
Query: 1107 NSIIRQFRYALVWGSSAKHNPQRCGKDHVLADEDIVQIVKK 1229 +++QF+YALVWGSS KH PQR GK+H L DED+VQI+KK Sbjct: 328 KDMVKQFKYALVWGSSVKHKPQRVGKEHELEDEDVVQIIKK 368
Score = 216 bits (550), Expect(2) = e-144 Identities = 109/148 (73%), Positives = 123/148 (83%) Frame = +2
Query: 122 SLVQKIKEVEDEMARTQKNKATSFHLGVLKAKLAKYKRELLLGPSKGAAAGAGEGFDVSK 301 +++QKIK++EDEMARTQKNKAT+ HLG+LKAKLAK +RELL SKG GAGEGFDV+K Sbjct: 3 TVMQKIKDIEDEMARTQKNKATAHHLGLLKAKLAKLRRELLTPTSKGGGGGAGEGFDVTK 62
Query: 302 AGDARVGLIGFPSVXXXXXXXXXXXXXXEVASYEFTTLTCIPGVINYKGAKIQLLDLPGI 481 +GDARVGL+GFPSV EVA+YEFTTLTCIPGVI YKGAKIQLLDLPGI Sbjct: 63 SGDARVGLVGFPSVGKSTLLNKLTGTFSEVAAYEFTTLTCIPGVIMYKGAKIQLLDLPGI 122
Query: 482 IEGAKDGKGRGRQVIAVGRTCNLILIVL 565 IEGAKDGKGRGRQVI+ RTCN+ILIVL Sbjct: 123 IEGAKDGKGRGRQVISTARTCNVILIVL 150
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 2,017,003,118 Number of extensions: 42472654 Number of successful extensions: 104675 Number of sequences better than 10.0: 809 Number of HSP's gapped: 103815 Number of HSP's successfully gapped: 927 Length of query: 423 Length of database: 1,040,966,779 Length adjustment: 131 Effective length of query: 292 Effective length of database: 621,205,444 Effective search space: 181391989648 Effective search space used: 181391989648 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|