Contig-U09876-1
Contig ID Contig-U09876-1
Contig update 2002. 9.13
Contig sequence
>Contig-U09876-1 (Contig-U09876-1Q) /CSM_Contig/Contig-U09876-1Q.Seq.d
AAAATTAATTATCACTTGCACCCACGCGCACACGAGCATTTTCTCACTTA
GTTTACAACTAAAAGTAATACATATTCAATATATTTATACCAATAAAAAT
AAAAAAAAATAAAAAAAAACAAACTCTTCATTTCACATATATATATACAC
ACATATAATGAGGCAACCCCTTATTTGTTCAGGTCACTCAAGACCAGTTT
CAGATTTATCATTTAGTAATGAAAATTCAGATGGTAGTTTTATAGTTTCT
GCATGTTTAGATGGGTCACCAATGCTCAGAAATGGTGAGAATGGTGATTG
GATTGGAACTTTTGAAGGCCACAAAGGCGCAGTTTGGTCATCAAGATTCA
ATTCTACAGCTTCTCAAGCATTGACAGCATCTGCTGATTATACAGTTAAA
TTATGGGATACATTAAACGGTAGTGAAATACTTTCAATTGAACATCAATC
AATAGTAAAGACAGCAGATTTTTCAAATAATAATAGTAGAGTTGTTACAG
GTGGTAGTGAAAAGATACTTAGAATATTCGATTTAGAGAGACCAAATGAC
CCATTACTTCAAATTTCAGGACATACAAATACGATTAAAACAGCAACATG
GAGTGTACATAATGATGATATTGTCTT

Gap no gap
Contig length 627
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 4464525
End point 4463899
Strand (PLUS/MINUS) MINUS
Number of clones 2
Number of EST 2
Link to clone list U09876
List of clone(s)

est1=AFA884F,1,603
est2=VFM645F,2,627
Translated Amino Acid sequence
kliitcthahtsifslslqlkvihiqyiytnknkkk*KKTNSSFHIYIYTHIMRQPLICS
GHSRPVSDLSFSNENSDGSFIVSACLDGSPMLRNGENGDWIGTFEGHKGAVWSSRFNSTA
SQALTASADYTVKLWDTLNGSEILSIEHQSIVKTADFSNNNSRVVTGGSEKILRIFDLER
PNDPLLQISGHTNTIKTATWSVHNDDIV


Translated Amino Acid sequence (All Frames)
Frame A:
kinyhlhprahehflt*fttksntysiylyq*k*kkikknklfishiyihtyneatpylf
rslktsfrfii***kfrw*fysfcmfrwvtnaqkw*ew*ldwnf*rpqrrslvikiqfys
fssidsic*lys*imgyikr**ntfn*tsinskdsrffk****scyrw**kdt*nirfre
tk*pitsnfrtykyd*nsnmect***ycl


Frame B:
kliitcthahtsifslslqlkvihiqyiytnknkkk*KKTNSSFHIYIYTHIMRQPLICS
GHSRPVSDLSFSNENSDGSFIVSACLDGSPMLRNGENGDWIGTFEGHKGAVWSSRFNSTA
SQALTASADYTVKLWDTLNGSEILSIEHQSIVKTADFSNNNSRVVTGGSEKILRIFDLER
PNDPLLQISGHTNTIKTATWSVHNDDIV


Frame C:
n*lslaptrtrafshlvyn*k*yifnifipikikknkkkqtlhftyiythi**gnplfvq
vtqdqfqiyhlvmkiqmvvl*flhv*mghqcsemvrmviglellkatkaqfghqdsilql
lkh*qhlliiqlnygih*tvvkyfqlninq**rqqifqiiivellqvvvkryleysi*rd
qmthyfkfqdiqirlkqqhgvyimmils


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U09876-1 (Contig-U09876-1Q)
/CSM_Contig/Contig-U09876-1Q.Seq.d
(627 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U09876-1 (Contig-U09876-1Q) /CSM_Contig/Conti... 1007 0.0
Contig-U09404-1 (Contig-U09404-1Q) /CSM_Contig/Conti... 38 0.011
Contig-U04993-1 (Contig-U04993-1Q) /CSM_Contig/Conti... 38 0.011
Contig-U14844-1 (Contig-U14844-1Q) /CSM_Contig/Conti... 36 0.044
Contig-U11841-1 (Contig-U11841-1Q) /CSM_Contig/Conti... 36 0.044
Contig-U05022-1 (Contig-U05022-1Q) /CSM_Contig/Conti... 36 0.044
Contig-U14280-1 (Contig-U14280-1Q) /CSM_Contig/Conti... 34 0.17
Contig-U14181-1 (Contig-U14181-1Q) /CSM_Contig/Conti... 34 0.17
Contig-U13039-1 (Contig-U13039-1Q) /CSM_Contig/Conti... 34 0.17
Contig-U11529-1 (Contig-U11529-1Q) /CSM_Contig/Conti... 34 0.17

>Contig-U09876-1 (Contig-U09876-1Q) /CSM_Contig/Contig-U09876-1Q.Seq.d
Length = 627

Score = 1007 bits (508), Expect = 0.0
Identities = 508/508 (100%)
Strand = Plus / Plus


Query: 120 caaactcttcatttcacatatatatatacacacatataatgaggcaaccccttatttgtt 179
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 120 caaactcttcatttcacatatatatatacacacatataatgaggcaaccccttatttgtt 179


Query: 180 caggtcactcaagaccagtttcagatttatcatttagtaatgaaaattcagatggtagtt 239
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 180 caggtcactcaagaccagtttcagatttatcatttagtaatgaaaattcagatggtagtt 239


Query: 240 ttatagtttctgcatgtttagatgggtcaccaatgctcagaaatggtgagaatggtgatt 299
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 240 ttatagtttctgcatgtttagatgggtcaccaatgctcagaaatggtgagaatggtgatt 299


Query: 300 ggattggaacttttgaaggccacaaaggcgcagtttggtcatcaagattcaattctacag 359
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 300 ggattggaacttttgaaggccacaaaggcgcagtttggtcatcaagattcaattctacag 359


Query: 360 cttctcaagcattgacagcatctgctgattatacagttaaattatgggatacattaaacg 419
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 360 cttctcaagcattgacagcatctgctgattatacagttaaattatgggatacattaaacg 419


Query: 420 gtagtgaaatactttcaattgaacatcaatcaatagtaaagacagcagatttttcaaata 479
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 420 gtagtgaaatactttcaattgaacatcaatcaatagtaaagacagcagatttttcaaata 479


Query: 480 ataatagtagagttgttacaggtggtagtgaaaagatacttagaatattcgatttagaga 539
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 480 ataatagtagagttgttacaggtggtagtgaaaagatacttagaatattcgatttagaga 539


Query: 540 gaccaaatgacccattacttcaaatttcaggacatacaaatacgattaaaacagcaacat 599
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 540 gaccaaatgacccattacttcaaatttcaggacatacaaatacgattaaaacagcaacat 599


Query: 600 ggagtgtacataatgatgatattgtctt 627
||||||||||||||||||||||||||||
Sbjct: 600 ggagtgtacataatgatgatattgtctt 627


Score = 186 bits (94), Expect = 2e-47
Identities = 94/94 (100%)
Strand = Plus / Plus


Query: 1 aaaattaattatcacttgcacccacgcgcacacgagcattttctcacttagtttacaact 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 aaaattaattatcacttgcacccacgcgcacacgagcattttctcacttagtttacaact 60


Query: 61 aaaagtaatacatattcaatatatttataccaat 94
||||||||||||||||||||||||||||||||||
Sbjct: 61 aaaagtaatacatattcaatatatttataccaat 94


>Contig-U09404-1 (Contig-U09404-1Q) /CSM_Contig/Contig-U09404-1Q.Seq.d
Length = 1014

Score = 38.2 bits (19), Expect = 0.011
Identities = 19/19 (100%)
Strand = Plus / Plus


Query: 60 taaaagtaatacatattca 78
|||||||||||||||||||
Sbjct: 570 taaaagtaatacatattca 588


>Contig-U04993-1 (Contig-U04993-1Q) /CSM_Contig/Contig-U04993-1Q.Seq.d
Length = 339

Score = 38.2 bits (19), Expect = 0.011
Identities = 19/19 (100%)
Strand = Plus / Plus


Query: 467 gatttttcaaataataata 485
|||||||||||||||||||
Sbjct: 60 gatttttcaaataataata 78


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 10,243
Number of Sequences: 6905
Number of extensions: 10243
Number of successful extensions: 1211
Number of sequences better than 10.0: 110
length of query: 627
length of database: 5,674,871
effective HSP length: 16
effective length of query: 611
effective length of database: 5,564,391
effective search space: 3399842901
effective search space used: 3399842901
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.11.18
Homology vs DNA
Query= Contig-U09876-1 (Contig-U09876-1Q) /CSM_Contig/Contig-U09876-1Q.Seq.d
(627 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ416414) Dictyostelium discoideum cDNA clone:ddv26i12, 5' ... 1007 0.0 2
(BJ325894) Dictyostelium discoideum cDNA clone:dda2h22, 5' e... 954 0.0 2
(FC337837) CAYY17228.fwd CAYY Physcomitrella patens subsp. p... 86 5e-13 2
(FC412848) CAYZ32195.fwd CAYZ Physcomitrella patens subsp. p... 86 5e-13 2
(FC375552) CAYY9845.fwd CAYY Physcomitrella patens subsp. pa... 86 5e-13 2
(FF562254) MUSRJ09TF MUSR Musa acuminata cDNA 5', mRNA seque... 86 2e-12 1
(EH684321) CCIL9013.b1_J21.ab1 CCI(LMS) chicory Cichorium in... 60 4e-12 3
(EL342921) CCEL10914.b1_D17.ab1 CCE(LMS) endive Cichorium en... 60 4e-12 3
(EL371213) CCEL13227.b1_F19.ab1 CCE(LMS) endive Cichorium en... 60 4e-12 3
(EH675422) CCIL13285.b1_I10.ab1 CCI(LMS) chicory Cichorium i... 60 4e-12 3
(EH684899) CCIL9687.b1_M21.ab1 CCI(LMS) chicory Cichorium in... 60 4e-12 3
(EH675830) CCIL13662.b1_K08.ab1 CCI(LMS) chicory Cichorium i... 60 4e-12 3
(EH684609) CCIL9301.b1_I21.ab1 CCI(LMS) chicory Cichorium in... 60 4e-12 3
(EH672568) CCIL10199.b1_M06.ab1 CCI(LMS) chicory Cichorium i... 60 4e-12 3
(EH682943) CCIL7630.b1_L12.ab1 CCI(LMS) chicory Cichorium in... 60 4e-12 3
(EH673151) CCIL11172.b1_G09.ab1 CCI(LMS) chicory Cichorium i... 60 4e-12 3
(EH673076) CCIL10713.b1_B16.ab1 CCI(LMS) chicory Cichorium i... 60 4e-12 3
(EL361099) CCEM5755.b1_F24.ab1 CCE(LMS) endive Cichorium end... 60 4e-12 3
(EH681462) CCIL6249.b1_B03.ab1 CCI(LMS) chicory Cichorium in... 60 4e-12 3
(EL344198) CCEL12146.b1_C14.ab1 CCE(LMS) endive Cichorium en... 52 9e-10 3
(DV633852) EST1102448 Dulce mature fruit library Cucumis mel... 76 2e-09 1
(DC599836) Lotus japonicus mRNA, clone: MR095c10_r, 5' end s... 76 2e-09 1
(AM735197) Cucumis melo subsp. melo EST, clone CI_51-A10-M13R. 76 2e-09 1
(AM718822) Cucumis melo subsp. melo EST, clone PS_14-D03-M13R. 76 2e-09 1
(AB233412) Nicotiana glutinosa Ng0808 mRNA for putative WD-4... 74 7e-09 1
(AP010078) Lotus japonicus genomic DNA, clone: LjT33M20, TM0... 72 3e-08 1
(DY801041) MTUNUL1.P56.D08 NUL Populus fremontii x Populus a... 72 3e-08 1
(DV156674) CV03103A1H10.f1 CV03-normalized library Euphorbia... 72 3e-08 1
(DR402671) TKN085E03_632864 Taraxacum kok-saghyz root cDNA l... 72 3e-08 1
(DB885810) Populus nigra mRNA, clone: PnFL2-062_H23, 5'end. 72 3e-08 1
(DB875594) Populus nigra mRNA, clone: PnFL2-005_F22, 5'end. 72 3e-08 1
(BU882857) UM83TB08 Populus flower cDNA library Populus tric... 72 3e-08 1
(BI787628) sai47h02.y1 Gm-c1065 Glycine max cDNA clone GENOM... 72 3e-08 1
(BG154420) saa93h05.y1 Gm-c1063 Glycine max cDNA clone GENOM... 72 3e-08 1
(FK000086) GLPAE60TF JCVI-SOY1 Glycine max cDNA 5', mRNA seq... 72 3e-08 1
(EV278298) GLNA518TF JCVI-SOY3 Glycine max cDNA 5', mRNA seq... 72 3e-08 1
(EV271855) GLMBC03TF JCVI-SOY2 Glycine max cDNA 5', mRNA seq... 72 3e-08 1
(EV264694) GLLAL55TF JCVI-SOY1 Glycine max cDNA 5', mRNA seq... 72 3e-08 1
(FG419327) 000511KUFA003399HT (KUFA) Actinidia eriantha youn... 60 1e-07 2
(BQ116048) EST601624 mixed potato tissues Solanum tuberosum ... 66 2e-07 2
(DV672845) CGN-8650 Seed of Middle Development Stage Coffea ... 66 2e-07 2
(FG459533) 021011KAIA006697HT (KAIA) Actinidia chinensis rip... 60 3e-07 2
(BI176469) EST517414 cSTE Solanum tuberosum cDNA clone cSTE1... 66 3e-07 2
(BI436233) EST538994 cSTE Solanum tuberosum cDNA clone cSTE2... 66 3e-07 2
(FG509271) 030312KAPC001558HT (KAPC) Actinidia eriantha peta... 60 3e-07 2
(FG460141) 021011KAIA009376HT (KAIA) Actinidia chinensis rip... 60 3e-07 2
(BQ047783) EST596901 P. infestans-challenged potato leaf, in... 66 3e-07 2
(DN940333) 8723.2 After-Cooking Darkening A Solanum tuberosu... 66 4e-07 2
(ES224065) MpHnorm_ag4_M18 Myzus persicae, tobacco lineage, ... 68 4e-07 1
(DY829871) CTOY549.b1_J17.ab1 CTO(XYZ) dandelion Taraxacum o... 68 4e-07 1
(DY827375) CTOY3108.b1_G09.ab1 CTO(XYZ) dandelion Taraxacum ... 68 4e-07 1
(CA526340) E186_F -P normal and proteoid roots 7 and 10 DAE ... 68 4e-07 1
(CV469773) 42511.1 Common Scab-Challenged Tubers Solanum tub... 64 1e-06 2
(EH674747) CCIL12661.b1_J22.ab1 CCI(LMS) chicory Cichorium i... 60 1e-06 2
(EH634185) EST5293 LK04 Laupala kohalensis cDNA clone 106102... 66 2e-06 1
(EB157322) 020613ABKA001046HT (ABKA) Royal Gala temperature ... 66 2e-06 1
(EB156816) 030221ABLC006738HT (ABLC) Braeburn cell culture t... 66 2e-06 1
(EB147162) 010917ABEA001162HT (ABEA) Royal Gala seedling lea... 66 2e-06 1
(EB138809) 010630AAZA002415HT (AAZA) M9 xylem Malus x domest... 66 2e-06 1
(EB133948) 010604AAWA006537HT (AAWA) Royal Gala 59 DAFB seed... 66 2e-06 1
(DV127082) CV03047A1D09.f1 CV03-normalized library Euphorbia... 66 2e-06 1
(DT765460) EST1199309 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT763546) EST1197395 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT759747) EST1193596 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT759534) EST1193383 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT757467) EST1191316 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT748383) EST1182232 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT745706) EST1179555 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT734843) EST1168693 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT732640) EST1166490 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DT003497) Mdrta1015G05.g1 Apple_EST_Mdrta Malus x domestica... 66 2e-06 1
(DR951191) EST1142730 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DR939037) EST1130576 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DR938556) EST1130095 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DR929549) EST1121088 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DR921129) EST1112668 Aquilegia cDNA library Aquilegia formo... 66 2e-06 1
(DB929150) Manihot esculenta mRNA, clone: CAS01_026_E10, 5'end. 66 2e-06 1
(FF536183) CASRL70TF CASR Manihot esculenta cDNA 5', mRNA se... 66 2e-06 1
(FD954279) RS3FV52TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 66 2e-06 1
(FD569392) RS2F220TF RS2(RS) Raphanus sativus cDNA 5', mRNA ... 66 2e-06 1
(EY912902) RR3D085TF RR3(NY) Raphanus raphanistrum subsp. ra... 66 2e-06 1
(EX905156) RS3CG93TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 66 2e-06 1
(EX903519) RS3BX38TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 66 2e-06 1
(CK719025) 19165 Swollen Stolon Solanum tuberosum cDNA, mRNA... 62 4e-06 2
(CV302375) 74349.1 Swollen Stolon Solanum tuberosum cDNA clo... 62 5e-06 2
(CV498013) 62261.1 Mixed Leaf Solanum tuberosum cDNA clone 6... 62 6e-06 2
(CV302939) 74967.1 Swollen Stolon Solanum tuberosum cDNA clo... 62 6e-06 2
(FG916343) UCRVU09_CCNT1386_b1 Cowpea UCR 707 Mixed Tissue a... 64 6e-06 1
(FG916042) UCRVU09_CCNT1212_b1 Cowpea UCR 707 Mixed Tissue a... 64 6e-06 1
(FG912288) UCRVU08_CCNS8225_b1 Cowpea IT97K-461-4 Mixed Tiss... 64 6e-06 1
(FG901393) UCRVU08_CCNS1703_b1 Cowpea IT97K-461-4 Mixed Tiss... 64 6e-06 1
(FG900778) UCRVU08_CCNS16601_b1 Cowpea IT97K-461-4 Mixed Tis... 64 6e-06 1
(FG884202) UCRVU07_CCNP15798_b1 Cowpea UCR 779 Mixed Tissue ... 64 6e-06 1
(FG882020) UCRVU07_CCNP14528_b1 Cowpea UCR 779 Mixed Tissue ... 64 6e-06 1
(FG881820) UCRVU07_CCNP14406_b1 Cowpea UCR 779 Mixed Tissue ... 64 6e-06 1
(FG879201) UCRVU07_CCNP12892_b1 Cowpea UCR 779 Mixed Tissue ... 64 6e-06 1
(FG878871) UCRVU07_CCNP12700_b1 Cowpea UCR 779 Mixed Tissue ... 64 6e-06 1
(FG847646) UCRVU05_CCNN15269_b1 Cowpea IT84S-2049 Mixed Tiss... 64 6e-06 1
(FE899846) PvEST5704 Bean pod tissue cDNA Entry Library Phas... 64 6e-06 1
(FE694469) Pv017D_M13F_A04.ab1 Phaseolus vulgaris cv Early g... 64 6e-06 1

>(BJ416414) Dictyostelium discoideum cDNA clone:ddv26i12, 5' end,
single read.
Length = 626

Score = 1007 bits (508), Expect(2) = 0.0
Identities = 508/508 (100%)
Strand = Plus / Plus


Query: 120 caaactcttcatttcacatatatatatacacacatataatgaggcaaccccttatttgtt 179
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 119 caaactcttcatttcacatatatatatacacacatataatgaggcaaccccttatttgtt 178


Query: 180 caggtcactcaagaccagtttcagatttatcatttagtaatgaaaattcagatggtagtt 239
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 179 caggtcactcaagaccagtttcagatttatcatttagtaatgaaaattcagatggtagtt 238


Query: 240 ttatagtttctgcatgtttagatgggtcaccaatgctcagaaatggtgagaatggtgatt 299
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 239 ttatagtttctgcatgtttagatgggtcaccaatgctcagaaatggtgagaatggtgatt 298


Query: 300 ggattggaacttttgaaggccacaaaggcgcagtttggtcatcaagattcaattctacag 359
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 299 ggattggaacttttgaaggccacaaaggcgcagtttggtcatcaagattcaattctacag 358


Query: 360 cttctcaagcattgacagcatctgctgattatacagttaaattatgggatacattaaacg 419
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 359 cttctcaagcattgacagcatctgctgattatacagttaaattatgggatacattaaacg 418


Query: 420 gtagtgaaatactttcaattgaacatcaatcaatagtaaagacagcagatttttcaaata 479
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 419 gtagtgaaatactttcaattgaacatcaatcaatagtaaagacagcagatttttcaaata 478


Query: 480 ataatagtagagttgttacaggtggtagtgaaaagatacttagaatattcgatttagaga 539
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 479 ataatagtagagttgttacaggtggtagtgaaaagatacttagaatattcgatttagaga 538


Query: 540 gaccaaatgacccattacttcaaatttcaggacatacaaatacgattaaaacagcaacat 599
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 539 gaccaaatgacccattacttcaaatttcaggacatacaaatacgattaaaacagcaacat 598


Query: 600 ggagtgtacataatgatgatattgtctt 627
||||||||||||||||||||||||||||
Sbjct: 599 ggagtgtacataatgatgatattgtctt 626

Score = 176 bits (89), Expect(2) = 0.0
Identities = 92/93 (98%)
Strand = Plus / Plus


Query: 2 aaattaattatcacttgcacccacgcgcacacgagcattttctcacttagtttacaacta 61
|||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 aaattaattatcacctgcacccacgcgcacacgagcattttctcacttagtttacaacta 60


Query: 62 aaagtaatacatattcaatatatttataccaat 94
|||||||||||||||||||||||||||||||||
Sbjct: 61 aaagtaatacatattcaatatatttataccaat 93

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 733,752,303
Number of extensions: 75593927
Number of successful extensions: 5760057
Number of sequences better than 10.0: 5019
Length of query: 627
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 604
Effective length of database: 93,106,754,628
Effective search space: 56236479795312
Effective search space used: 56236479795312
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 6.26
Homology vs Protein
Query= Contig-U09876-1 (Contig-U09876-1Q) /CSM_Contig/Contig-U09876-1Q.Seq.d
(627 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

BC081265_1(BC081265|pid:none) Xenopus laevis MGC86380 protein, m... 183 4e-45
AY889259_1(AY889259|pid:none) Synthetic construct Homo sapiens c... 181 1e-44
AY891072_1(AY891072|pid:none) Synthetic construct Homo sapiens c... 180 3e-44
AK077504_1(AK077504|pid:none) Mus musculus 8 days embryo whole b... 179 4e-44
(Q9Z1Z2) RecName: Full=Serine-threonine kinase receptor-associat... 179 4e-44
BC049525_1(BC049525|pid:none) Danio rerio serine/threonine kinas... 178 1e-43
AB171592_1(AB171592|pid:none) Macaca fascicularis brain cDNA clo... 178 1e-43
AF315726_1(AF315726|pid:none) Carassius auratus gibelio serine-t... 178 1e-43
(Q5ZL33) RecName: Full=Serine-threonine kinase receptor-associat... 177 2e-43
AC007591_42(AC007591|pid:none) Arabidopsis thaliana chromosome 1... 176 6e-43
AK297942_1(AK297942|pid:none) Homo sapiens cDNA FLJ51909 complet... 171 2e-41
AB017071_2(AB017071|pid:none) Arabidopsis thaliana genomic DNA, ... 169 6e-41
AB233412_1(AB233412|pid:none) Nicotiana glutinosa Ng0808 mRNA fo... 164 2e-39
EU959631_1(EU959631|pid:none) Zea mays clone 218967 serine-threo... 164 2e-39
AP005008_24(AP005008|pid:none) Oryza sativa Japonica Group genom... 162 7e-39
BT068751_1(BT068751|pid:none) Zea mays full-length cDNA clone ZM... 162 9e-39
DQ440438_1(DQ440438|pid:none) Aedes aegypti clone AET-5874 serin... 161 2e-38
CP001328_174(CP001328|pid:none) Micromonas sp. RCC299 chromosome... 155 7e-37
BT077747_1(BT077747|pid:none) Lepeophtheirus salmonis clone lsal... 155 1e-36
CU633899_183(CU633899|pid:none) Podospora anserina genomic DNA c... 140 2e-32
FN314131_1(FN314131|pid:none) Schistosoma japonicum isolate Anhu... 134 2e-30
FN314130_1(FN314130|pid:none) Schistosoma japonicum isolate Anhu... 134 2e-30
AP007164_655(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 131 2e-29
AM270054_16(AM270054|pid:none) Aspergillus niger contig An03c013... 127 3e-28
AM502245_85(AM502245|pid:none) Leishmania infantum chromosome 27... 119 5e-26
AM440408_2(AM440408|pid:none) Vitis vinifera contig VV78X105456.... 105 1e-21
CR954210_82(CR954210|pid:none) Ostreococcus tauri strain OTTH059... 103 4e-21
BC097832_1(BC097832|pid:none) Xenopus laevis serine/threonine ki... 97 4e-19
AE013599_929(AE013599|pid:none) Drosophila melanogaster chromoso... 91 3e-17
BT023859_1(BT023859|pid:none) Drosophila melanogaster IP09508 fu... 91 3e-17
AC132489_10(AC132489|pid:none) Oryza sativa (japonica cultivar-g... 88 2e-16
EF146121_1(EF146121|pid:none) Populus trichocarpa clone WS0115_K... 84 4e-15
A84901(A84901) hypothetical protein At2g46290 [imported] - Arabi... 82 9e-15
AF335551_1(AF335551|pid:none) Phaseolus vulgaris TGF-beta recept... 82 1e-14
S60256(S60256) TGF-beta receptor interacting protein 1 homolog -... 82 2e-14
AK317262_1(AK317262|pid:none) Arabidopsis thaliana AT2G46280 mRN... 82 2e-14
(Q38884) RecName: Full=Eukaryotic translation initiation factor ... 82 2e-14
CP001038_141(CP001038|pid:none) Nostoc punctiforme PCC 73102 pla... 80 4e-14
CP001037_1914(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 80 4e-14
(P79083) RecName: Full=Eukaryotic translation initiation factor ... 80 5e-14
D89187_1(D89187|pid:none) Schizosaccharomyces pombe mRNA, partia... 80 5e-14
CP000117_2100(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 79 8e-14
(A8WVX8) RecName: Full=Eukaryotic translation initiation factor ... 79 1e-13
AY123140_1(AY123140|pid:none) Griffithsia japonica TGF-beta rece... 78 2e-13
AC124957_16(AC124957|pid:none) Medicago truncatula clone mth2-15... 78 2e-13
AF285835_1(AF285835|pid:none) Arabidopsis thaliana eukaryotic in... 77 3e-13
(Q55563) RecName: Full=Uncharacterized WD repeat-containing prot... 77 5e-13
(Q965S8) RecName: Full=Eukaryotic translation initiation factor ... 77 5e-13
CP000117_4653(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 76 7e-13
CP001291_1144(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 76 7e-13
CP000393_2151(CP000393|pid:none) Trichodesmium erythraeum IMS101... 75 2e-12
CP001099_1375(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 75 2e-12
(Q7ZV55) RecName: Full=Eukaryotic translation initiation factor ... 75 2e-12
BT074955_1(BT074955|pid:none) Osmerus mordax clone omor-rgc-504-... 75 2e-12
(A7RM20) RecName: Full=Eukaryotic translation initiation factor ... 75 2e-12
(Q16K15) RecName: Full=Eukaryotic translation initiation factor ... 75 2e-12
CP000492_814(CP000492|pid:none) Chlorobium phaeobacteroides DSM ... 75 2e-12
AM746676_4559(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 75 2e-12
(B4GSH1) RecName: Full=Eukaryotic translation initiation factor ... 74 3e-12
AY745983_1(AY745983|pid:none) Aedes aegypti putative translation... 74 3e-12
CP001037_1143(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 74 3e-12
AM989989_35(AM989989|pid:none) Zygosaccharomyces rouxii strain C... 74 3e-12
(B4Q354) RecName: Full=Eukaryotic translation initiation factor ... 74 3e-12
AY232199_1(AY232199|pid:none) Drosophila yakuba clone yak-ad_Tri... 74 3e-12
BT044683_1(BT044683|pid:none) Salmo salar clone ssal-rgf-002-287... 74 3e-12
(B3N4C7) RecName: Full=Eukaryotic translation initiation factor ... 74 3e-12
CP000230_1281(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 74 4e-12
CP000117_2956(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 74 4e-12
CU928180_653(CU928180|pid:none) Kluyveromyces thermotolerans str... 74 4e-12
CP000117_2804(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 73 6e-12
(Q5R7R2) RecName: Full=Eukaryotic translation initiation factor ... 73 6e-12
AE016818_604(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 73 7e-12
(B4N0L0) RecName: Full=Eukaryotic translation initiation factor ... 73 7e-12
CR382135_388(CR382135|pid:none) Debaryomyces hansenii strain CBS... 73 7e-12
(P25382) RecName: Full=WD repeat-containing protein YCR072C; &A... 73 7e-12
CP000117_4826(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 72 1e-11
S19487(S19487;S26657)hypothetical protein YCR072c - yeast (Sacch... 72 1e-11
CR954206_59(CR954206|pid:none) Ostreococcus tauri strain OTTH059... 72 1e-11
(Q5IH81) RecName: Full=Eukaryotic translation initiation factor ... 72 1e-11
(Q5E966) RecName: Full=Eukaryotic translation initiation factor ... 72 1e-11
AY888456_1(AY888456|pid:none) Synthetic construct Homo sapiens c... 72 1e-11
(B0BNA7) RecName: Full=Eukaryotic translation initiation factor ... 72 1e-11
(B5FZ19) RecName: Full=Eukaryotic translation initiation factor ... 72 1e-11
AK172208_1(AK172208|pid:none) Mus musculus activated spleen cDNA... 72 2e-11
CU928165_278(CU928165|pid:none) Kluyveromyces thermotolerans str... 72 2e-11
(Q9QZD9) RecName: Full=Eukaryotic translation initiation factor ... 72 2e-11
(Q66J51) RecName: Full=Eukaryotic translation initiation factor ... 72 2e-11
CP000807_36(CP000807|pid:none) Cyanothece sp. ATCC 51142 linear ... 72 2e-11
AM920437_2228(AM920437|pid:none) Penicillium chrysogenum Wiscons... 71 3e-11
(Q7RXH4) RecName: Full=Eukaryotic translation initiation factor ... 71 3e-11
CP000393_4067(CP000393|pid:none) Trichodesmium erythraeum IMS101... 70 4e-11
AY813621_1(AY813621|pid:none) Schistosoma japonicum SJCHGC02832 ... 70 4e-11
BT076031_1(BT076031|pid:none) Caligus rogercresseyi clone crog-e... 70 4e-11
(B4LUA5) RecName: Full=Eukaryotic translation initiation factor ... 70 5e-11
AP007151_775(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 70 5e-11
AP009552_3821(AP009552|pid:none) Microcystis aeruginosa NIES-843... 70 5e-11
(Q2GTM8) RecName: Full=Eukaryotic translation initiation factor ... 70 6e-11
(Q7PP77) RecName: Full=Eukaryotic translation initiation factor ... 70 6e-11
(B3MVL6) RecName: Full=Eukaryotic translation initiation factor ... 69 8e-11
(A6ZMK5) RecName: Full=Eukaryotic translation initiation factor ... 69 8e-11
(Q2UQ34) RecName: Full=Eukaryotic translation initiation factor ... 69 8e-11
AG1889(AG1889) WD-40 repeat protein [imported] - Nostoc sp. (str... 69 1e-10
CP001037_1323(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 69 1e-10
FN392319_286(FN392319|pid:none) Pichia pastoris GS115 chromosome... 69 1e-10
CP001037_4354(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 69 1e-10
CP000501_12(CP000501|pid:none) Pichia stipitis CBS 6054 chromoso... 68 2e-10
FM992691_442(FM992691|pid:none) Candida dubliniensis CD36 chromo... 68 2e-10
AM472166_2(AM472166|pid:none) Vitis vinifera contig VV78X131919.... 68 2e-10
(B4KGX9) RecName: Full=Eukaryotic translation initiation factor ... 68 2e-10
AP007175_262(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 68 2e-10
AY174059_1(AY174059|pid:none) Plasmodium falciparum activated pr... 68 2e-10
(A1CJY4) RecName: Full=Eukaryotic translation initiation factor ... 68 2e-10
AF323582_1(AF323582|pid:none) Podospora anserina beta transducin... 68 2e-10
CU633455_72(CU633455|pid:none) Podospora anserina genomic DNA ch... 68 2e-10
AF323584_1(AF323584|pid:none) Podospora anserina beta transducin... 68 2e-10
AF323583_1(AF323583|pid:none) Podospora anserina beta transducin... 68 2e-10
(Q1HPW4) RecName: Full=Eukaryotic translation initiation factor ... 68 2e-10
(O74319) RecName: Full=Transcription initiation factor TFIID sub... 67 3e-10
CP000828_671(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 67 3e-10
AC159435_6(AC159435|pid:none) Trypanosoma brucei chromosome 8 cl... 67 3e-10
(P38123) RecName: Full=COMPASS component SWD3; AltName: Full=Com... 67 3e-10
BA000045_4351(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 67 3e-10
(Q00808) RecName: Full=Vegetative incompatibility protein HET-E-... 67 4e-10
(Q1DPU4) RecName: Full=Eukaryotic translation initiation factor ... 67 4e-10
CU928173_341(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 67 4e-10
(Q5B8Y3) RecName: Full=Eukaryotic translation initiation factor ... 67 4e-10
CP000117_1553(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 67 4e-10
AI2493(AI2493) WD-repeat protein [imported] - Nostoc sp. (strain... 67 5e-10
(A7EF03) RecName: Full=Eukaryotic translation initiation factor ... 67 5e-10
FN357299_49(FN357299|pid:none) Schistosoma mansoni genome sequen... 66 7e-10
AM746676_4558(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 66 7e-10
AM920427_1306(AM920427|pid:none) Penicillium chrysogenum Wiscons... 66 7e-10
CP000473_5641(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 66 9e-10
CP000828_167(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 66 9e-10
AH2154(AH2154) WD-repeat protein [imported] - Nostoc sp. (strain... 66 9e-10
AY394939_1(AY394939|pid:none) Danio rerio clone RK046A1C09 WD re... 66 9e-10
AP007157_289(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 66 9e-10
AK016201_1(AK016201|pid:none) Mus musculus adult male testis cDN... 65 1e-09
BC145995_1(BC145995|pid:none) Mus musculus WD repeat domain 69, ... 65 1e-09
CP001291_699(CP001291|pid:none) Cyanothece sp. PCC 7424, complet... 65 1e-09
AH2195(AH2195) hypothetical protein alr3119 [imported] - Nostoc ... 65 1e-09
AK016977_1(AK016977|pid:none) Mus musculus adult male testis cDN... 65 1e-09
FN313599_1(FN313599|pid:none) Schistosoma japonicum isolate Anhu... 65 2e-09
CP001291_1208(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 65 2e-09
(Q5FWQ6) RecName: Full=WD repeat-containing protein 69; &BC0892... 65 2e-09
(A3LX18) RecName: Full=Eukaryotic translation initiation factor ... 65 2e-09
CU074315_1(CU074315|pid:none) Podospora anserina genomic DNA, NW... 65 2e-09
CP000828_4370(CP000828|pid:none) Acaryochloris marina MBIC11017,... 65 2e-09
CP000839_184(CP000839|pid:none) Acaryochloris marina MBIC11017 p... 65 2e-09
AF323581_1(AF323581|pid:none) Podospora anserina beta transducin... 65 2e-09
AP007150_220(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 65 2e-09
(Q6P2Y2) RecName: Full=WD repeat-containing protein 69; &BC0642... 65 2e-09
AM910987_42(AM910987|pid:none) Plasmodium knowlesi strain H chro... 64 3e-09
DQ151642_1(DQ151642|pid:none) Chlamydomonas reinhardtii WD repea... 64 3e-09
(Q5AI86) RecName: Full=Eukaryotic translation initiation factor ... 64 3e-09
AX885903_1(AX885903|pid:none) Sequence 1766 from Patent EP1033401. 64 3e-09
CU074270_1(CU074270|pid:none) Podospora anserina genomic DNA, NW... 64 3e-09
AK301029_1(AK301029|pid:none) Homo sapiens cDNA FLJ60170 complet... 64 3e-09
AM778950_12(AM778950|pid:none) Microcystis aeruginosa PCC 7806 g... 64 3e-09
AP007163_34(AP007163|pid:none) Aspergillus oryzae RIB40 genomic ... 64 3e-09
(P49695) RecName: Full=Probable serine/threonine-protein kinase ... 64 3e-09
CU074274_1(CU074274|pid:none) Podospora anserina genomic DNA, NW... 64 3e-09
CP000383_3602(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 64 3e-09
AF1890(AF1890) WD-repeat protein [imported] - Nostoc sp. (strain... 64 3e-09
AC117072_4(AC117072|pid:none) Dictyostelium discoideum chromosom... 64 5e-09
(Q5BK30) RecName: Full=WD repeat-containing protein 69; &BC0912... 64 5e-09
AB264259_1(AB264259|pid:none) Cryptomeria japonica CC2196 gene f... 64 5e-09
AY428810_1(AY428810|pid:none) Solanum chacoense notchless-like p... 64 5e-09
BA000045_1965(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 64 5e-09
CP001037_5630(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 63 6e-09
CP001037_6067(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 63 6e-09
CP001037_1497(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 63 6e-09
CP000828_5861(CP000828|pid:none) Acaryochloris marina MBIC11017,... 63 6e-09
AB264260_1(AB264260|pid:none) Cryptomeria japonica CC2196 gene f... 63 6e-09
AB264263_1(AB264263|pid:none) Chamaecyparis pisifera CC2196 gene... 63 6e-09
AB264266_1(AB264266|pid:none) Chamaecyparis obtusa CC2196 gene f... 63 6e-09
AY159316_1(AY159316|pid:none) Homo sapiens lung cancer oncogene ... 63 8e-09
AK012242_1(AK012242|pid:none) Mus musculus 11 days embryo whole ... 63 8e-09
BA000045_4356(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 63 8e-09
AY694127_4(AY694127|pid:none) Gallus gallus cosmid c12.1 chromos... 63 8e-09
D29802_1(D29802|pid:none) Mus musculus p205 mRNA for G protein b... 63 8e-09
(Q6DIF4) RecName: Full=WD repeat-containing protein 1; AltName: ... 63 8e-09
CP000393_3425(CP000393|pid:none) Trichodesmium erythraeum IMS101... 63 8e-09
(Q9FLX9) RecName: Full=Notchless protein homolog; &AB009055_3(A... 63 8e-09
AK222488_1(AK222488|pid:none) Homo sapiens mRNA for guanine nucl... 63 8e-09
(P63243) RecName: Full=Guanine nucleotide-binding protein subuni... 63 8e-09
CP000828_20(CP000828|pid:none) Acaryochloris marina MBIC11017, c... 63 8e-09
AM269969_6(AM269969|pid:none) Aspergillus niger contig An01c0220... 63 8e-09
CU633453_76(CU633453|pid:none) Podospora anserina genomic DNA ch... 63 8e-09
AK098821_1(AK098821|pid:none) Homo sapiens cDNA FLJ25955 fis, cl... 62 1e-08
BC102286_1(BC102286|pid:none) Bos taurus guanine nucleotide bind... 62 1e-08
BC051783_1(BC051783|pid:none) Danio rerio small nuclear ribonucl... 62 1e-08
(Q8N136) RecName: Full=WD repeat-containing protein 69; &AC0730... 62 1e-08
AP007175_253(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 62 1e-08
CP000117_2178(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 62 1e-08
(A5DVY3) RecName: Full=Eukaryotic translation initiation factor ... 62 1e-08
AK301861_1(AK301861|pid:none) Homo sapiens cDNA FLJ54195 complet... 62 1e-08
BT052263_1(BT052263|pid:none) Medicago truncatula clone MTYF9_FA... 62 1e-08
BT072537_1(BT072537|pid:none) Salmo salar clone ssal-rgf-529-231... 62 1e-08
AP009552_5491(AP009552|pid:none) Microcystis aeruginosa NIES-843... 62 1e-08
AY457171_1(AY457171|pid:none) Leishmania amazonensis antigenic W... 62 1e-08
BC044710_1(BC044710|pid:none) Xenopus laevis Notchless gene homo... 62 1e-08
FN357585_7(FN357585|pid:none) Schistosoma mansoni genome sequenc... 62 1e-08
CP000686_3299(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 62 1e-08
AF000265_6(AF000265|pid:none) Caenorhabditis elegans cosmid C18E... 62 1e-08
AM269977_20(AM269977|pid:none) Aspergillus niger contig An01c030... 62 1e-08
BT080073_1(BT080073|pid:none) Esox lucius clone eluc-evq-506-011... 62 1e-08
CT005245_3(CT005245|pid:none) Leishmania major strain Friedlin, ... 62 1e-08
AB264261_1(AB264261|pid:none) Thujopsis dolabrata CC2196 gene fo... 62 1e-08
AL049795_12(AL049795|pid:none) Human DNA sequence from clone RP4... 62 1e-08
CP001327_247(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 62 2e-08
(Q6P5M2) RecName: Full=WD repeat-containing protein 61; &BC0628... 62 2e-08
(A2QEV8) RecName: Full=Eukaryotic translation initiation factor ... 62 2e-08
(Q8YTC2) RecName: Full=Uncharacterized WD repeat-containing prot... 62 2e-08
CP001037_4818(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 62 2e-08
CP001328_404(CP001328|pid:none) Micromonas sp. RCC299 chromosome... 62 2e-08
CP000686_859(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 62 2e-08
DQ353790_1(DQ353790|pid:none) Ictalurus punctatus isolate C82LLH... 62 2e-08
BC095217_1(BC095217|pid:none) Danio rerio zgc:110281, mRNA (cDNA... 62 2e-08
AF323585_1(AF323585|pid:none) Podospora anserina beta transducin... 62 2e-08
AB246881_1(AB246881|pid:none) Lethenteron japonicum GNB2L1 mRNA ... 62 2e-08
BT075698_1(BT075698|pid:none) Osmerus mordax clone omor-rgc-001-... 62 2e-08
(A8QBF3) RecName: Full=Eukaryotic translation initiation factor ... 62 2e-08
BT058435_1(BT058435|pid:none) Salmo salar clone Contig699 Guanin... 62 2e-08
CP001037_139(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 62 2e-08
BT043532_1(BT043532|pid:none) Salmo salar clone HM4_1707 guanine... 62 2e-08
AD1842(AD1842) WD-40 repeat protein [imported] - Nostoc sp. (str... 61 2e-08
AY249909_1(AY249909|pid:none) Oryctolagus cuniculus G-protein be... 61 2e-08
FN392321_803(FN392321|pid:none) Pichia pastoris GS115 chromosome... 61 2e-08
AP009552_6258(AP009552|pid:none) Microcystis aeruginosa NIES-843... 61 2e-08
(Q55AR8) RecName: Full=U5 small nuclear ribonucleoprotein 40 kDa... 61 2e-08
EU290652_1(EU290652|pid:none) Sander vitreus receptor for activa... 61 2e-08
BC150407_1(BC150407|pid:none) Danio rerio guanine nucleotide bin... 61 2e-08
AM502242_165(AM502242|pid:none) Leishmania infantum chromosome 24. 61 2e-08
CP000842_108(CP000842|pid:none) Acaryochloris marina MBIC11017 p... 61 2e-08
CP001037_1432(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 61 2e-08
AM502224_3(AM502224|pid:none) Leishmania infantum chromosome 6. 61 2e-08
CR382125_207(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 61 3e-08
BT080509_1(BT080509|pid:none) Caligus clemensi clone ccle-evs-50... 61 3e-08
AK304508_1(AK304508|pid:none) Homo sapiens cDNA FLJ57449 complet... 61 3e-08
AC1842(AC1842) WD-40 repeat protein [imported] - Nostoc sp. (str... 61 3e-08
AE016818_101(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 60 4e-08
CP000117_2876(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 60 4e-08
CR380949_26(CR380949|pid:none) Candida glabrata strain CBS138 ch... 60 4e-08
AY547291_1(AY547291|pid:none) Toxoplasma gondii receptor for act... 60 4e-08
BA000012_2184(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 60 4e-08
BT077645_1(BT077645|pid:none) Lepeophtheirus salmonis clone lsal... 60 4e-08
CP000839_340(CP000839|pid:none) Acaryochloris marina MBIC11017 p... 60 4e-08
(Q5RE95) RecName: Full=WD repeat-containing protein 5B; &CR8576... 60 4e-08
AK002149_1(AK002149|pid:none) Homo sapiens cDNA FLJ11287 fis, cl... 60 4e-08
(Q9VZF4) RecName: Full=F-box/WD repeat-containing protein 7; Alt... 60 4e-08
CR382137_757(CR382137|pid:none) Debaryomyces hansenii strain CBS... 60 5e-08
BT045379_1(BT045379|pid:none) Salmo salar clone ssal-rgf-519-314... 60 5e-08
AP007169_1(AP007169|pid:none) Aspergillus oryzae RIB40 genomic D... 60 5e-08
AG2400(AG2400) WD-repeat protein [imported] - Nostoc sp. (strain... 60 5e-08
AJ719967_1(AJ719967|pid:none) Gallus gallus mRNA for hypothetica... 60 5e-08
CP001099_247(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 60 5e-08
(Q6PE01) RecName: Full=U5 small nuclear ribonucleoprotein 40 kDa... 60 5e-08
CU633454_82(CU633454|pid:none) Podospora anserina genomic DNA ch... 60 5e-08
AF083383_1(AF083383|pid:none) Homo sapiens 38kDa splicing factor... 60 5e-08
AY342000_1(AY342000|pid:none) Oreochromis mossambicus receptor f... 60 7e-08
CP000089_3569(CP000089|pid:none) Dechloromonas aromatica RCB, co... 60 7e-08
CR382138_945(CR382138|pid:none) Debaryomyces hansenii strain CBS... 60 7e-08
CP001013_1798(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 60 7e-08
AM462218_2(AM462218|pid:none) Vitis vinifera contig VV78X125617.... 60 7e-08
GN121086_1(GN121086|pid:none) Sequence 3982 from Patent WO200903... 60 7e-08
(Q0P593) RecName: Full=WD repeat-containing protein 69; &BC1203... 60 7e-08
(Q9NVX2) RecName: Full=Notchless protein homolog 1; &AK001320_1... 60 7e-08
AX135809_1(AX135809|pid:none) Sequence 3 from Patent WO0132614. 60 7e-08
CP000806_3920(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 60 7e-08
BC124403_1(BC124403|pid:none) Danio rerio WD repeat domain 69, m... 60 7e-08
BC077273_1(BC077273|pid:none) Xenopus laevis cDNA clone IMAGE:40... 60 7e-08
CU633438_612(CU633438|pid:none) Podospora anserina genomic DNA c... 60 7e-08
BC002884_1(BC002884|pid:none) Homo sapiens notchless homolog 1 (... 60 7e-08
AM778958_177(AM778958|pid:none) Microcystis aeruginosa PCC 7806 ... 60 7e-08
AK303253_1(AK303253|pid:none) Homo sapiens cDNA FLJ58655 complet... 60 7e-08
(Q9D7H2) RecName: Full=WD repeat-containing protein 5B; &AK0092... 60 7e-08
(Q4V7Y7) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 60 7e-08
CP000593_9(CP000593|pid:none) Ostreococcus lucimarinus CCE9901 c... 60 7e-08
(Q1LV15) RecName: Full=WD repeat-containing protein 69; &BC1244... 60 7e-08
CP001287_2282(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 60 7e-08
AX135807_1(AX135807|pid:none) Sequence 1 from Patent WO0132614. 60 7e-08
BC168104_1(BC168104|pid:none) Xenopus tropicalis cDNA clone MGC:... 60 7e-08
(Q58D20) RecName: Full=Notchless protein homolog 1; 59 9e-08
CP000117_1538(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 59 9e-08
CP000117_5003(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 59 9e-08
(Q8W1K8) RecName: Full=Protein Mut11; AltName: Full=Mut11p; &AF... 59 9e-08
AK088953_1(AK088953|pid:none) Mus musculus 2 days neonate thymus... 59 9e-08
U75309_1(U75309|pid:none) Human TBP-associated factor (hTAFII100... 59 9e-08
BC052268_1(BC052268|pid:none) Homo sapiens TAF5 RNA polymerase I... 59 9e-08
AM494961_234(AM494961|pid:none) Leishmania braziliensis chromoso... 59 9e-08
AE014296_3092(AE014296|pid:none) Drosophila melanogaster chromos... 59 9e-08
AY525781_1(AY525781|pid:none) Acanthamoeba healyi coronin mRNA, ... 59 9e-08
AY130394_1(AY130394|pid:none) Petromyzon marinus guanine nucleot... 59 9e-08
(Q15542) RecName: Full=Transcription initiation factor TFIID sub... 59 9e-08
AB174186_1(AB174186|pid:none) Macaca fascicularis brain cDNA clo... 59 9e-08
BC156180_1(BC156180|pid:none) Synthetic construct Mus musculus c... 59 9e-08
BT021777_1(BT021777|pid:none) Bos taurus Notchless gene homolog ... 59 9e-08
AC073555_19(AC073555|pid:none) Arabidopsis thaliana chromosome 1... 59 1e-07
EF083131_1(EF083131|pid:none) Picea sitchensis clone WS02722_J02... 59 1e-07
CR812943_6(CR812943|pid:none) Zebrafish DNA sequence from clone ... 59 1e-07
AJ298991_1(AJ298991|pid:none) Fagus sylvatica partial mRNA for G... 59 1e-07
S18663(S18663) coronin - slime mold (Dictyostelium discoideum) ... 59 1e-07
CP000099_2768(CP000099|pid:none) Methanosarcina barkeri str. Fus... 59 1e-07
AM269996_122(AM269996|pid:none) Aspergillus niger contig An02c00... 59 1e-07
AF299085_1(AF299085|pid:none) Myxococcus xanthus Bap1 (bap1) gen... 59 1e-07
AE1810(AE1810) WD-40 repeat protein [imported] - Nostoc sp. (str... 59 1e-07
CP000828_5917(CP000828|pid:none) Acaryochloris marina MBIC11017,... 59 1e-07
EF197117_1(EF197117|pid:none) Oncorhynchus mykiss RACK1 mRNA, co... 59 1e-07
AM746676_2689(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 59 1e-07
BC075548_1(BC075548|pid:none) Xenopus tropicalis MGC89488 protei... 59 1e-07
(Q54WA3) RecName: Full=Peroxisomal targeting signal 2 receptor; ... 59 1e-07
BC045034_1(BC045034|pid:none) Xenopus laevis U5 snRNP-specific 4... 59 1e-07
CR940353_257(CR940353|pid:none) Theileria annulata strain Ankara... 59 1e-07
AY814155_1(AY814155|pid:none) Schistosoma japonicum SJCHGC06272 ... 59 1e-07
BT047461_1(BT047461|pid:none) Salmo salar clone ssal-rgb2-603-17... 59 1e-07
AK170853_1(AK170853|pid:none) Mus musculus NOD-derived CD11c +ve... 59 1e-07
AL603745_5(AL603745|pid:none) Mouse DNA sequence from clone RP23... 59 1e-07
CP000502_174(CP000502|pid:none) Pichia stipitis CBS 6054 chromos... 59 1e-07
(Q8VEJ4) RecName: Full=Notchless protein homolog 1; &BC018399_1... 59 1e-07
CP001037_5275(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 58 2e-07
AF106576_4(AF106576|pid:none) Caenorhabditis elegans cosmid W07E... 58 2e-07
AM746676_3634(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 58 2e-07
AJ012588_1(AJ012588|pid:none) Drosophila melanogaster mRNA for N... 58 2e-07
AE014134_131(AE014134|pid:none) Drosophila melanogaster chromoso... 58 2e-07
CR382130_1100(CR382130|pid:none) Yarrowia lipolytica strain CLIB... 58 2e-07
CP000854_3359(CP000854|pid:none) Mycobacterium marinum M, comple... 58 2e-07
CP001100_2468(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 58 2e-07
(Q8C092) RecName: Full=Transcription initiation factor TFIID sub... 58 2e-07
AF407335_1(AF407335|pid:none) Lentinula edodes guanine nucleotid... 58 2e-07
CP000828_3726(CP000828|pid:none) Acaryochloris marina MBIC11017,... 58 2e-07
AB022686_1(AB022686|pid:none) Solanum lycopersicum mRNA for LeAr... 58 2e-07
(P74442) RecName: Full=Uncharacterized WD repeat-containing prot... 58 2e-07
BC090898_1(BC090898|pid:none) Danio rerio peroxisomal biogenesis... 58 2e-07
AK144091_1(AK144091|pid:none) Mus musculus RCB-0559 K-1 . F1 cDN... 58 2e-07
CP000593_141(CP000593|pid:none) Ostreococcus lucimarinus CCE9901... 58 2e-07
AY316746_172(AY316746|pid:none) Rhizobium sp. NGR234 megaplasmid... 58 2e-07
EF677877_1(EF677877|pid:none) Picea sitchensis clone WS0277_A02 ... 58 2e-07
FM992694_112(FM992694|pid:none) Candida dubliniensis CD36 chromo... 58 2e-07
AJ719451_1(AJ719451|pid:none) Gallus gallus mRNA for hypothetica... 58 2e-07
(Q6NVM2) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 58 2e-07
(Q5M786) RecName: Full=WD repeat-containing protein 5; &BC08100... 57 3e-07
(Q9W7F2) RecName: Full=WD repeat-containing protein 1-A; AltName... 57 3e-07
AJ011376_1(AJ011376|pid:none) Homo sapiens mRNA for hypothetical... 57 3e-07
AC117075_70(AC117075|pid:none) Dictyostelium discoideum chromoso... 57 3e-07
AJ004807_1(AJ004807|pid:none) Nicotiana tabacum xanthi arcA 3 ge... 57 3e-07
AM502235_26(AM502235|pid:none) Leishmania infantum chromosome 17. 57 3e-07
AL772282_6(AL772282|pid:none) Mouse DNA sequence from clone RP23... 57 3e-07
BT075125_1(BT075125|pid:none) Osmerus mordax clone omor-eva-518-... 57 3e-07
AF105259_1(AF105259|pid:none) Xenopus laevis activated protein k... 57 3e-07
S33263(S33263;S45729;A54593)transcription initiation factor IID-... 57 3e-07
BA000045_1630(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 57 3e-07
DQ885470_1(DQ885470|pid:none) Blattella germanica receptor for a... 57 3e-07
AE017348_264(AE017348|pid:none) Cryptococcus neoformans var. neo... 57 3e-07
(Q2KIG2) RecName: Full=WD repeat-containing protein 5; &BC11265... 57 3e-07
BC158602_1(BC158602|pid:none) Rattus norvegicus sperm associated... 57 3e-07
(P49846) RecName: Full=Transcription initiation factor TFIID sub... 57 3e-07
BC052124_1(BC052124|pid:none) Danio rerio WD repeat domain 5, mR... 57 3e-07
CP000844_164(CP000844|pid:none) Acaryochloris marina MBIC11017 p... 57 3e-07
AM494954_21(AM494954|pid:none) Leishmania braziliensis chromosom... 57 3e-07
(Q7ZUV2) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 57 4e-07
U27537_1(U27537|pid:none) Dictyostelium discoideum G beta like p... 57 4e-07
CU074316_1(CU074316|pid:none) Podospora anserina genomic DNA, NW... 57 4e-07
BC045888_1(BC045888|pid:none) Danio rerio WD repeat domain 51A, ... 57 4e-07
BC077844_1(BC077844|pid:none) Xenopus laevis WD repeat domain 5,... 57 4e-07
BT050222_1(BT050222|pid:none) Salmo salar clone ssal-sjb-015-257... 57 4e-07
CU640366_848(CU640366|pid:none) Podospora anserina genomic DNA c... 57 4e-07
CP000113_4019(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 57 4e-07
CP001108_1939(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 57 4e-07
FN357341_7(FN357341|pid:none) Schistosoma mansoni genome sequenc... 57 4e-07
CP000117_4784(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 57 4e-07
CP001287_548(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 57 4e-07
(Q54D08) RecName: Full=Protein LST8 homolog; AltName: Full=Letha... 57 6e-07
AM392737_1(AM392737|pid:none) Synthetic construct Homo sapiens c... 57 6e-07
(Q8C7V3) RecName: Full=U3 small nucleolar RNA-associated protein... 57 6e-07
AM393545_1(AM393545|pid:none) Synthetic construct Homo sapiens c... 57 6e-07
CR954213_14(CR954213|pid:none) Ostreococcus tauri strain OTTH059... 57 6e-07
(P97865) RecName: Full=Peroxisomal targeting signal 2 receptor; ... 57 6e-07
AP008931_213(AP008931|pid:none) Rhodococcus erythropolis PR4 pla... 57 6e-07
AE014297_3432(AE014297|pid:none) Drosophila melanogaster chromos... 57 6e-07
AK302021_1(AK302021|pid:none) Homo sapiens cDNA FLJ57656 complet... 57 6e-07
BT045059_1(BT045059|pid:none) Salmo salar clone ssal-rgf-510-334... 57 6e-07
AY130395_1(AY130395|pid:none) Scyliorhinus canicula guanine nucl... 57 6e-07
CP000828_160(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 57 6e-07
CP001037_247(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 57 6e-07
(Q7ZXZ2) RecName: Full=U3 small nucleolar RNA-associated protein... 57 6e-07
CP001110_343(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 56 7e-07
DQ122897_1(DQ122897|pid:none) Chlamydomonas incerta G protein be... 56 7e-07
CP000820_1755(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 56 7e-07
AF064071_1(AF064071|pid:none) Mus musculus apoptotic protease ac... 56 7e-07
(Q5JTN6) RecName: Full=WD repeat-containing protein 38; &AL3549... 56 7e-07
(P25387) RecName: Full=Guanine nucleotide-binding protein subuni... 56 7e-07
GQ223794_1(GQ223794|pid:none) Nicotiana benthamiana heterotrimer... 56 7e-07
CP000806_2172(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 56 7e-07
CP000686_3296(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 56 7e-07
(O88879) RecName: Full=Apoptotic protease-activating factor 1; ... 56 7e-07
(Q8R537) RecName: Full=Peroxisomal targeting signal 2 receptor; ... 56 7e-07
CP000148_1200(CP000148|pid:none) Geobacter metallireducens GS-15... 56 7e-07
AE010299_2454(AE010299|pid:none) Methanosarcina acetivorans str.... 56 7e-07
BT042868_1(BT042868|pid:none) Zea mays full-length cDNA clone ZM... 56 7e-07
CP000828_5338(CP000828|pid:none) Acaryochloris marina MBIC11017,... 56 7e-07
CR954205_121(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 56 9e-07
CR382127_605(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 56 9e-07
AK220340_1(AK220340|pid:none) Mus musculus mRNA for mKIAA0413 pr... 56 9e-07
BC131683_1(BC131683|pid:none) Mus musculus apoptotic peptidase a... 56 9e-07
AL590449_21(AL590449|pid:none) chromosome X of strain GB-M1 of E... 56 9e-07
(A2RRU3) RecName: Full=U3 small nucleolar RNA-associated protein... 56 9e-07
CU928176_40(CU928176|pid:none) Zygosaccharomyces rouxii strain C... 56 9e-07
BC123679_1(BC123679|pid:none) Bos taurus peroxisomal biogenesis ... 56 9e-07
AP007175_233(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 56 9e-07
BT012225_1(BT012225|pid:none) Arabidopsis thaliana At5g13480 gen... 56 9e-07
FM992694_169(FM992694|pid:none) Candida dubliniensis CD36 chromo... 56 9e-07
AE013599_962(AE013599|pid:none) Drosophila melanogaster chromoso... 55 1e-06
CP000117_2838(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 55 1e-06
CP001332_291(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 55 1e-06
FN359065_4(FN359065|pid:none) Schistosoma mansoni genome sequenc... 55 1e-06
DQ214275_1(DQ214275|pid:none) Taeniopygia guttata clone 0061P001... 55 1e-06
CP000117_2617(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 55 1e-06
FN392320_711(FN392320|pid:none) Pichia pastoris GS115 chromosome... 55 1e-06
BC161681_1(BC161681|pid:none) Xenopus laevis TBP-associated fact... 55 1e-06
AM910987_83(AM910987|pid:none) Plasmodium knowlesi strain H chro... 55 1e-06
(Q9D994) RecName: Full=WD repeat-containing protein 38; &AK0072... 55 2e-06
(Q93847) RecName: Full=Uncharacterized WD repeat-containing prot... 55 2e-06
(P49026) RecName: Full=Guanine nucleotide-binding protein subuni... 55 2e-06
AP006852_172(AP006852|pid:none) Candida albicans genomic DNA, ch... 55 2e-06
AF326339_1(AF326339|pid:none) Aedes aegypti unknown protein i8 m... 55 2e-06
EU954724_1(EU954724|pid:none) Zea mays clone 1479275 WD-repeat p... 55 2e-06
CR382137_211(CR382137|pid:none) Debaryomyces hansenii strain CBS... 55 2e-06
(Q4V7A0) RecName: Full=WD repeat-containing protein 61; &BC0980... 55 2e-06
CU928169_422(CU928169|pid:none) Kluyveromyces thermotolerans str... 55 2e-06
CU928178_641(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 55 2e-06
CP000119_130(CP000119|pid:none) Anabaena variabilis ATCC 29413 p... 55 2e-06
AY345135_1(AY345135|pid:none) Trypanosoma cruzi translation init... 55 2e-06
(Q9ERF3) RecName: Full=WD repeat-containing protein 61; AltName:... 55 2e-06
(B4MU54) RecName: Full=Ribosome biogenesis protein WDR12 homolog; 55 2e-06
EF215228_1(EF215228|pid:none) Callithrix jacchus clone E23-52.1_... 55 2e-06
AE014296_2405(AE014296|pid:none) Drosophila melanogaster chromos... 55 2e-06
BA000045_2888(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 55 2e-06
AF326340_1(AF326340|pid:none) Aedes aegypti unknown protein i8 m... 55 2e-06
CP001574_661(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 55 2e-06
(Q9VU68) RecName: Full=Actin-interacting protein 1; Sho... 55 2e-06
CP001038_142(CP001038|pid:none) Nostoc punctiforme PCC 73102 pla... 55 2e-06
AB174681_1(AB174681|pid:none) Macaca fascicularis brain cDNA clo... 55 2e-06
AY064077_1(AY064077|pid:none) Aedes aegypti clone unKRc2 unknown... 55 2e-06
CP001101_2134(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 55 2e-06
CP000117_3846(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 55 2e-06
CP001577_363(CP001577|pid:none) Micromonas sp. RCC299 chromosome... 55 2e-06
T22703(T22703)hypothetical protein F55B12.3 - Caenorhabditis ele... 55 2e-06
(Q93794) RecName: Full=F-box/WD repeat-containing protein sel-10... 55 2e-06
(Q6GMD2) RecName: Full=WD repeat-containing protein 61; &BC0741... 55 2e-06
AC006200_20(AC006200|pid:none) Arabidopsis thaliana chromosome 2... 55 2e-06
AX888066_1(AX888066|pid:none) Sequence 3929 from Patent EP1033401. 55 2e-06
AP008207_3678(AP008207|pid:none) Oryza sativa (japonica cultivar... 55 2e-06
AY737531_1(AY737531|pid:none) Toxoptera citricida putative activ... 55 2e-06
CP000600_30(CP000600|pid:none) Ostreococcus lucimarinus CCE9901 ... 55 2e-06
CP000828_5196(CP000828|pid:none) Acaryochloris marina MBIC11017,... 55 2e-06
AM270009_6(AM270009|pid:none) Aspergillus niger contig An02c0140... 55 2e-06
AP006852_115(AP006852|pid:none) Candida albicans genomic DNA, ch... 55 2e-06
CR382126_571(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 55 2e-06
CR380959_230(CR380959|pid:none) Candida glabrata strain CBS138 c... 55 2e-06
AM238664_1098(AM238664|pid:none) Streptomyces ambofaciens ATCC 2... 55 2e-06
DQ132809_1(DQ132809|pid:none) Oryza sativa (japonica cultivar-gr... 55 2e-06
AP003517_26(AP003517|pid:none) Oryza sativa Japonica Group genom... 55 2e-06
AK153862_1(AK153862|pid:none) Mus musculus 2 days neonate thymus... 54 3e-06
(Q5REE0) RecName: Full=U3 small nucleolar RNA-associated protein... 54 3e-06
BA000039_488(BA000039|pid:none) Thermosynechococcus elongatus BP... 54 3e-06
(O14301) RecName: Full=Uncharacterized WD repeat-containing prot... 54 3e-06
CP000590_338(CP000590|pid:none) Ostreococcus lucimarinus CCE9901... 54 3e-06
BC019504_1(BC019504|pid:none) Mus musculus transducin (beta)-lik... 54 3e-06
AK028806_1(AK028806|pid:none) Mus musculus 10 days neonate skin ... 54 3e-06
BC004624_1(BC004624|pid:none) Mus musculus transducin (beta)-lik... 54 3e-06
AF462796_1(AF462796|pid:none) Arabidopsis thaliana At1g73720/F25... 54 3e-06
AK149940_1(AK149940|pid:none) Mus musculus bone marrow macrophag... 54 3e-06
BA000045_725(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 54 3e-06
AK165125_1(AK165125|pid:none) Mus musculus 2 days pregnant adult... 54 3e-06
CP000393_2802(CP000393|pid:none) Trichodesmium erythraeum IMS101... 54 3e-06
(Q5ZIU8) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 54 3e-06
(P69103) RecName: Full=Guanine nucleotide-binding protein subuni... 54 3e-06
AC012679_13(AC012679|pid:none) Arabidopsis thaliana chromosome 1... 54 3e-06
CP000393_3289(CP000393|pid:none) Trichodesmium erythraeum IMS101... 54 3e-06
AJ720686_1(AJ720686|pid:none) Gallus gallus mRNA for hypothetica... 54 3e-06
CR382125_534(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 54 3e-06
DQ410670_1(DQ410670|pid:none) Gallus gallus brain p80 katanin mR... 54 3e-06
CR954210_23(CR954210|pid:none) Ostreococcus tauri strain OTTH059... 54 3e-06
AL592382_2(AL592382|pid:none) Pneumocystis carinii telomeric cos... 54 3e-06
(Q8C4J7) RecName: Full=Transducin beta-like protein 3; &AK08196... 54 3e-06
CR382128_858(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 54 4e-06
(Q4P9P9) RecName: Full=Nuclear distribution protein PAC1; AltNam... 54 4e-06
DQ111989_1(DQ111989|pid:none) Sparus aurata activated protein ki... 54 4e-06
CP001037_1947(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 54 4e-06
DQ100314_1(DQ100314|pid:none) Uta stansburiana G protein beta 1 ... 54 4e-06
GN121088_1(GN121088|pid:none) Sequence 3984 from Patent WO200903... 54 4e-06
EF661023_4(EF661023|pid:none) Carica papaya clone BAC PH61H02, c... 54 4e-06
CR954214_40(CR954214|pid:none) Ostreococcus tauri strain OTTH059... 54 4e-06
AC159439_36(AC159439|pid:none) Trypanosoma brucei chromosome 7 c... 54 4e-06
BC133771_1(BC133771|pid:none) Xenopus laevis hypothetical protei... 54 4e-06
CR382131_1322(CR382131|pid:none) Yarrowia lipolytica strain CLIB... 54 4e-06
CP001037_148(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 54 4e-06
CU928179_838(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 54 4e-06
CP000845_57(CP000845|pid:none) Acaryochloris marina MBIC11017 pl... 54 4e-06

>BC081265_1(BC081265|pid:none) Xenopus laevis MGC86380 protein, mRNA
(cDNA clone MGC:86380 IMAGE:7011142), complete cds.
Length = 329

Score = 183 bits (464), Expect = 4e-45
Identities = 84/157 (53%), Positives = 115/157 (73%), Gaps = 1/157 (0%)
Frame = +2

Query: 158 MRQ-PLICSGHSRPVSDLSFSNENSDGSFIVSACLDGSPMLRNGENGDWIGTFEGHKGAV 334
MRQ PL CSGH+RPV DL+FS G F++SAC DG PMLR G+ GDWIGTF GHKGAV
Sbjct: 3 MRQTPLTCSGHTRPVVDLAFSPITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAV 62

Query: 335 WSSRFNSTASQALTASADYTVKLWDTLNGSEILSIEHQSIVKTADFSNNNSRVVTGGSEK 514
W + N+ A++A TA+AD+T K+WD + G E+LS+ H+ IVK+ DF+ +++ ++TGG +K
Sbjct: 63 WGATINNDATKAATAAADFTAKVWDAVTGDELLSLAHKHIVKSVDFTEDSNNLLTGGQDK 122

Query: 515 ILRIFDLERPNDPLLQISGHTNTIKTATWSVHNDDIV 625
+LRI+DL +P +ISGHT+ IK A W +N I+
Sbjct: 123 VLRIYDLNKPEAEPWEISGHTSAIKKALWYNNNTQIL 159

Score = 35.4 bits (80), Expect = 1.3
Identities = 26/120 (21%), Positives = 54/120 (45%), Gaps = 4/120 (3%)
Frame = +2

Query: 125 SSFHIYIYTHIMRQPLICSGHSRPVSDLSFSNENSD----GSFIVSACLDGSPMLRNGEN 292
+ F ++ + L+ H V + F+ ++++ G V D L E
Sbjct: 79 ADFTAKVWDAVTGDELLSLAHKHIVKSVDFTEDSNNLLTGGQDKVLRIYD----LNKPEA 134

Query: 293 GDWIGTFEGHKGAVWSSRFNSTASQALTASADYTVKLWDTLNGSEILSIEHQSIVKTADF 472
W GH A+ + + + +Q L+AS D TV+LWD ++ +E+ +++ V + ++
Sbjct: 135 EPW--EISGHTSAIKKALWYNNNTQILSASDDRTVRLWDRVSMTEVKTLQFGVSVSSMEY 192

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 936,512,996
Number of extensions: 17567891
Number of successful extensions: 59481
Number of sequences better than 10.0: 2868
Number of HSP's gapped: 57039
Number of HSP's successfully gapped: 5715
Length of query: 209
Length of database: 1,040,966,779
Length adjustment: 123
Effective length of query: 86
Effective length of database: 646,839,724
Effective search space: 55628216264
Effective search space used: 55628216264
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)

PSORT

psg: 0.85 gvh: 0.43 alm: 0.49 top: 0.47 tms: 0.00 mit: 0.42 mip: 0.06
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

44.0 %: mitochondrial
32.0 %: nuclear
16.0 %: cytoplasmic
4.0 %: cytoskeletal
4.0 %: peroxisomal

>> prediction for Contig-U09876-1 is mit

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 1
AH (FL, L) 0
AF (FL, S) 1
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0