Contig-U09810-1
Contig ID Contig-U09810-1
Contig update 2002. 9.13
Contig sequence
>Contig-U09810-1 (Contig-U09810-1Q) /CSM_Contig/Contig-U09810-1Q.Seq.d
CGCGTCCGCCGAGNAGCCAAATAATGAAAATGAAGATTCAATTGTTTTAT
TACCATTAGATAGATATACAGTTGGAATTGACGAGTTTATTGGATTTAAT
GAATTTTATGATGATTATAAAAATAATAATTTTAATGAAAAAGATTCAAT
AATAAATGAATTATGTTATATGTCAATTCAATTAATGGAAAAGTTATCAT
TAAAATTAGGAGATTGGATATTTATTGATGTTCAAAAACAACAACAAAAA
CAACAAAAACAACAACAACAACAACAACAAAATAAACAATGTATTATATC
AAAAGTTTGGACTTCAAGATATATTCAACAAAATTATTATATTCAATCAA
ATTCAAAACTAATATTAAACCAACAAATAAATGATGAAGAACAAGAACAA
GAACAAGAACAAGAACAAGAACAACAAGAACAAGAACAAAATAAAAAACA
AAACAAATCAATAAAATATCCAAGTTTTGTCAAAATTTATAAAGTTAATG
AATTTGAAAATAATTTAAATAATGTTGATATTGAAATTATAGTTTCAAAT
AATAATAATAATAATAATAATGAAAATATAAGAACATTATTTAGTAGTAA
ACAATTTATAAAGCAATTATTAATAAATAAATTAATATGTAGTGGAATGA
ATATAT----------ATAATGCACAGTCAAGAGTGTTGTCAACATTTTT
AAATGAAATGGATGGTGTTGAACAATTGAATGGTGTAATNGTAATTGGTG
CAACCAATAGATTAGATATGATCGATAATGCATTACTCAGACCTGGAAGA
TTCGATAAAATATTGGAAATCAAATTACCAGATCAATTATCAAGATTAAA
AATTTTAAAAATTAAAACAAAATCAATACCACTCTCAGATAATGTTAANT
TAATTGAAATCTCAAATTTAACAAATGGTTTCAGTGGTGCTGATCTTGAA
AATCTGTGTAGAGAAGCTTCATTTCAATCNTTAAGAAGAGATTTATTAAA
TGGTTTTGTTGAAATGTATGATTTTTTAAATTGTTTATCAAAAATTAATA
ATCAATCAAAAAATT

Gap gap included
Contig length 1055
Chromosome number (1..6, M) 3
Chromosome length 6358359
Start point 5556269
End point 5557316
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 2
Link to clone list U09810
List of clone(s)

est1=VSI328F,1,657
est2=VSI328Z,658,1057
Translated Amino Acid sequence
ASAEXPNNENEDSIVLLPLDRYTVGIDEFIGFNEFYDDYKNNNFNEKDSIINELCYMSIQ
LMEKLSLKLGDWIFIDVQKQQQKQQKQQQQQQQNKQCIISKVWTSRYIQQNYYIQSNSKL
ILNQQINDEEQEQEQEQEQEQQEQEQNKKQNKSIKYPSFVKIYKVNEFENNLNNVDIEII
VSNNNNNNNNENIRTLFSSKQFIKQLLINKLICSGMNI---

---NAQSRVLSTFLNEMDGVEQLNGVXVIGATNRLDMIDNALLRPGRFDKILEIKLPDQL
SRLKILKIKTKSIPLSDNVXLIEISNLTNGFSGADLENLCREASFQSLRRDLLNGFVEMY
DFLNCLSKINNQSKN


Translated Amino Acid sequence (All Frames)
Frame A:
rvrrxak**k*rfncfitir*iyswn*rvywi**il**l*k**f**krfnnk*imlyvns
ingkviikirrldiy*csktttkttktttttttk*tmyyiksldfkiystkllysikfkt
nikptnk**rtrtrtrtrtrttrtrtk*ktkqinkiskfcqnl*s**i*k*fk*c*y*ny
sfk********kyknii***tiykaiink*inm*wney---

---imhsqeccqhf*mkwmvlnn*mv*x*lvqpid*i*simhysdledsikywksnyqin
yqd*kf*klkqnqyhsqimlx*lksqi*qmvsvvlilkicveklhfnx*eeiy*mvllkc
mif*ivyqkliinqki

Frame B:
ASAEXPNNENEDSIVLLPLDRYTVGIDEFIGFNEFYDDYKNNNFNEKDSIINELCYMSIQ
LMEKLSLKLGDWIFIDVQKQQQKQQKQQQQQQQNKQCIISKVWTSRYIQQNYYIQSNSKL
ILNQQINDEEQEQEQEQEQEQQEQEQNKKQNKSIKYPSFVKIYKVNEFENNLNNVDIEII
VSNNNNNNNNENIRTLFSSKQFIKQLLINKLICSGMNI---

---*ctvksvvnifk*ngwc*tiewcnxnwcnq*irydr*citqtwkir*nignqitrsi
ikiknfkn*nkinttlr*c*xn*nlkfnkwfqwc*s*ksv*rsfisixkkrfikwfc*nv
*ffklfikn**sikk

Frame C:
rppxsqimkmkiqlfyyh*idiqleltslldlmnfmmiikiiilmkkiq**mnyvicqfn
*wksyh*n*eigyllmfknnnknnknnnnnnnkinnvlyqkfglqdifnkiiifnqiqn*
y*tnk*mmknknknknknknnknknkiknktnq*niqvlskfiklmnlkii*imlilkl*
fqiiiiiiimki*ehylvvnnl*sny**in*yvve*iy---

---NAQSRVLSTFLNEMDGVEQLNGVXVIGATNRLDMIDNALLRPGRFDKILEIKLPDQL
SRLKILKIKTKSIPLSDNVXLIEISNLTNGFSGADLENLCREASFQSLRRDLLNGFVEMY
DFLNCLSKINNQSKN

own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U09810-1 (Contig-U09810-1Q)
/CSM_Contig/Contig-U09810-1Q.Seq.d
(1065 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U09810-1 (Contig-U09810-1Q) /CSM_Contig/Conti... 476 e-134
Contig-U13930-1 (Contig-U13930-1Q) /CSM_Contig/Conti... 40 0.005
Contig-U05046-1 (Contig-U05046-1Q) /CSM_Contig/Conti... 40 0.005
Contig-U13961-1 (Contig-U13961-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U12258-1 (Contig-U12258-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U12020-1 (Contig-U12020-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U11262-1 (Contig-U11262-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U09478-1 (Contig-U09478-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U05674-1 (Contig-U05674-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U05652-1 (Contig-U05652-1Q) /CSM_Contig/Conti... 38 0.019

>Contig-U09810-1 (Contig-U09810-1Q) /CSM_Contig/Contig-U09810-1Q.Seq.d
Length = 1065

Score = 476 bits (240), Expect = e-134
Identities = 273/273 (100%)
Strand = Plus / Plus


Query: 572 gaaaatataagaacattatttagtagtaaacaatttataaagcaattattaataaataaa 631
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 572 gaaaatataagaacattatttagtagtaaacaatttataaagcaattattaataaataaa 631


Query: 632 ttaatatgtagtggaatgaatatatnnnnnnnnnnataatgcacagtcaagagtgttgtc 691
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 632 ttaatatgtagtggaatgaatatatnnnnnnnnnnataatgcacagtcaagagtgttgtc 691


Query: 692 aacatttttaaatgaaatggatggtgttgaacaattgaatggtgtaatngtaattggtgc 751
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 692 aacatttttaaatgaaatggatggtgttgaacaattgaatggtgtaatngtaattggtgc 751


Query: 752 aaccaatagattagatatgatcgataatgcattactcagacctggaagattcgataaaat 811
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 752 aaccaatagattagatatgatcgataatgcattactcagacctggaagattcgataaaat 811


Query: 812 attggaaatcaaattaccagatcaattatcaag 844
|||||||||||||||||||||||||||||||||
Sbjct: 812 attggaaatcaaattaccagatcaattatcaag 844


Score = 371 bits (187), Expect = e-102
Identities = 193/193 (100%)
Strand = Plus / Plus


Query: 873 tcaataccactctcagataatgttaanttaattgaaatctcaaatttaacaaatggtttc 932
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 873 tcaataccactctcagataatgttaanttaattgaaatctcaaatttaacaaatggtttc 932


Query: 933 agtggtgctgatcttgaaaatctgtgtagagaagcttcatttcaatcnttaagaagagat 992
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 933 agtggtgctgatcttgaaaatctgtgtagagaagcttcatttcaatcnttaagaagagat 992


Query: 993 ttattaaatggttttgttgaaatgtatgattttttaaattgtttatcaaaaattaataat 1052
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 993 ttattaaatggttttgttgaaatgtatgattttttaaattgtttatcaaaaattaataat 1052


Query: 1053 caatcaaaaaatt 1065
|||||||||||||
Sbjct: 1053 caatcaaaaaatt 1065


Score = 208 bits (105), Expect = 9e-54
Identities = 105/105 (100%)
Strand = Plus / Plus


Query: 281 aataaacaatgtattatatcaaaagtttggacttcaagatatattcaacaaaattattat 340
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 281 aataaacaatgtattatatcaaaagtttggacttcaagatatattcaacaaaattattat 340


Query: 341 attcaatcaaattcaaaactaatattaaaccaacaaataaatgat 385
|||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 341 attcaatcaaattcaaaactaatattaaaccaacaaataaatgat 385


Score = 184 bits (93), Expect = 1e-46
Identities = 96/96 (100%)
Strand = Plus / Plus


Query: 1 cgcgtccgccgagnagccaaataatgaaaatgaagattcaattgttttattaccattaga 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 cgcgtccgccgagnagccaaataatgaaaatgaagattcaattgttttattaccattaga 60


Query: 61 tagatatacagttggaattgacgagtttattggatt 96
||||||||||||||||||||||||||||||||||||
Sbjct: 61 tagatatacagttggaattgacgagtttattggatt 96


Score = 147 bits (74), Expect = 3e-35
Identities = 74/74 (100%)
Strand = Plus / Plus


Query: 159 aattatgttatatgtcaattcaattaatggaaaagttatcattaaaattaggagattgga 218
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 159 aattatgttatatgtcaattcaattaatggaaaagttatcattaaaattaggagattgga 218


Query: 219 tatttattgatgtt 232
||||||||||||||
Sbjct: 219 tatttattgatgtt 232


Score = 73.8 bits (37), Expect = 3e-13
Identities = 37/37 (100%)
Strand = Plus / Plus


Query: 467 tatccaagttttgtcaaaatttataaagttaatgaat 503
|||||||||||||||||||||||||||||||||||||
Sbjct: 467 tatccaagttttgtcaaaatttataaagttaatgaat 503


>Contig-U13930-1 (Contig-U13930-1Q) /CSM_Contig/Contig-U13930-1Q.Seq.d
Length = 459

Score = 40.1 bits (20), Expect = 0.005
Identities = 20/20 (100%)
Strand = Plus / Plus


Query: 618 tattaataaataaattaata 637
||||||||||||||||||||
Sbjct: 127 tattaataaataaattaata 146


Score = 30.2 bits (15), Expect = 4.6
Identities = 21/23 (91%)
Strand = Plus / Plus


Query: 615 aattattaataaataaattaata 637
|||| ||||||||||||| ||||
Sbjct: 147 aatttttaataaataaataaata 169


>Contig-U05046-1 (Contig-U05046-1Q) /CSM_Contig/Contig-U05046-1Q.Seq.d
Length = 1142

Score = 40.1 bits (20), Expect = 0.005
Identities = 20/20 (100%)
Strand = Plus / Minus


Query: 33 aagattcaattgttttatta 52
||||||||||||||||||||
Sbjct: 1137 aagattcaattgttttatta 1118


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 19,213
Number of Sequences: 6905
Number of extensions: 19213
Number of successful extensions: 2293
Number of sequences better than 10.0: 322
length of query: 1065
length of database: 5,674,871
effective HSP length: 16
effective length of query: 1049
effective length of database: 5,564,391
effective search space: 5837046159
effective search space used: 5837046159
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.11.18
Homology vs DNA
Query= Contig-U09810-1 (Contig-U09810-1Q) /CSM_Contig/Contig-U09810-1Q.Seq.d
(1065 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU268516) Dictyostelium discoideum vegetative cDNA clone:VS... 361 e-168 2
(AU268515) Dictyostelium discoideum vegetative cDNA clone:VS... 176 e-119 4
(CP000963) Clostridium botulinum A3 str. Loch Maree plasmid ... 42 0.007 2
(EK585272) 1095522061015 Global-Ocean-Sampling_GS-32-01-01-1... 54 0.011 1
(EK504264) 1095506093799 Global-Ocean-Sampling_GS-32-01-01-1... 54 0.011 1
(AW562163) SWOvAFCAP35E04SK Onchocerca volvulus adult female... 54 0.011 1
(AE017199) Nanoarchaeum equitans Kin4-M, complete genome. 52 0.044 1
(AC126663) Rattus norvegicus clone CH230-4C9, *** SEQUENCING... 42 0.073 5
(AC117076) Dictyostelium discoideum chromosome 2 map 3323568... 40 0.11 7
(BJ349266) Dictyostelium discoideum cDNA clone:dda35n24, 3' ... 36 0.13 2
(AC005872) Homo sapiens chromosome 10 clone CIT987SK-1137I1,... 50 0.17 1
(BX950857) Zebrafish DNA sequence from clone CH211-203D19 in... 34 0.39 2
(ES731018) Nad03b_18_F03_C005.g1 Nuphar advena flower bud li... 36 0.50 2
(CU019638) Zebrafish DNA sequence from clone CH73-242A13 in ... 34 0.55 9
(EI211272) DA_CBa0001C19.f DA_CBa Drosophila arizonae genomi... 44 0.66 2
(AJ417718) Ancylostoma duodenale complete mitochondrial genome. 48 0.69 1
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 48 0.69 1
(AL445565) Mycoplasma pulmonis (strain UAB CTIP) complete ge... 48 0.69 1
(EB379503) nbc47f07.x1 Rabbit trigeminal nerve. Unnormalized... 36 2.2 2
(CN520472) GQ0107.B3_P14 GQ010 Populus trichocarpa x Populus... 44 2.2 2
(AC187298) Canis familiaris chromosome X, clone XX-93B19, co... 42 2.3 3
(CR309346) mte1-30K16FM1 BAC end, cultivar Jemalong A17 of M... 40 2.6 2
(CR932077) Zebrafish DNA sequence from clone DKEY-33K1 in li... 46 2.7 1
(CR847495) Zebrafish DNA sequence from clone DKEY-150G9 in l... 46 2.7 1
(BX001014) Zebrafish DNA sequence from clone DKEY-11C5 in li... 46 2.7 1
(AL929085) Zebrafish DNA sequence from clone CH211-11G18 in ... 46 2.7 1
(AY863212) Rhizopus oryzae mitochondrion, complete genome. 46 2.7 1
(AP003501) Homo sapiens genomic DNA, chromosome 11q, clone:R... 46 2.7 1
(CU915758) S.lycopersicum DNA sequence *** SEQUENCING IN PRO... 46 2.7 1
(AC094128) Rattus norvegicus clone CH230-3D9, *** SEQUENCING... 46 2.7 1
(AL844509) Plasmodium falciparum chromosome 13. 46 2.7 1
(AC231587) Monodelphis domestica clone VMRC18-711P21, WORKIN... 46 2.7 1
(AC231324) Monodelphis domestica clone VMRC18-271K24, WORKIN... 46 2.7 1
(AC188326) Microcebus murinus clone CH257-148L2, WORKING DRA... 46 2.7 1
(AC179466) Strongylocentrotus purpuratus clone R3-63I4, WORK... 46 2.7 1
(AC178869) Strongylocentrotus purpuratus clone R3-28J10, WOR... 46 2.7 1
(AC175854) Strongylocentrotus purpuratus clone R3-15J14, WOR... 46 2.7 1
(AQ691631) HS_5377_A2_B11_T7A RPCI-11 Human Male BAC Library... 46 2.7 1
(EK474598) 1095469474676 Global-Ocean-Sampling_GS-32-01-01-1... 46 2.7 1
(ED614527) GM_WBa0006G24.f GM_WBa Glycine max genomic clone ... 46 2.7 1
(CZ134461) OA_BBa0027P08.f OA_BBa Oryza alta genomic clone O... 46 2.7 1
(BZ388568) EINAP58TF EI_10_12_KB Entamoeba invadens genomic ... 46 2.7 1
(CK519297) rswea0_002004.y1 swe Bombyx mori cDNA, mRNA seque... 46 2.7 1
(CJ455382) Macaca fascicularis mRNA, clone: QflA-21162, 5' e... 46 2.7 1
(AJ932195) Theileria annulata EST, clone ta0034B08_b. 46 2.7 1
(AI771077) SWOvAFCAP15A02SK Onchocerca volvulus adult female... 46 2.7 1
(AI540006) SWOvAFCAP28E11SK Onchocerca volvulus adult female... 46 2.7 1
(AA618908) SWOv3MCA1898SK Onchocerca volvulus molting L3 lar... 46 2.7 1
(BF199456) SWOvAFCAP49D03SK Onchocerca volvulus adult female... 46 2.7 1
(FF418254) gmnbspic_0002l11.pDNRF2 Gadus morhua spleen libra... 46 2.7 1
(CP000867) Methanococcus maripaludis C6, complete genome. 46 2.7 1
(BX119315) Zebrafish DNA sequence from clone CH211-215F22 in... 42 2.8 5
(AM469158) Vitis vinifera contig VV78X101044.9, whole genome... 36 3.4 3
(AC112582) Rattus norvegicus clone CH230-257N6, *** SEQUENCI... 40 3.7 3
(DD010735) Diagnosis of known genetic Parameters within the ... 32 4.1 2
(CP000678) Methanobrevibacter smithii ATCC 35061, complete g... 34 4.3 2
(AX344552) Sequence 3 from Patent WO0200932. 32 4.9 2
(AX344551) Sequence 2 from Patent WO0200932. 32 4.9 2
(AC023235) Homo sapiens 3 BAC RP11-484D18 (Roswell Park Canc... 32 5.1 2
(AL133378) Human DNA sequence from clone RP1-91B17 on chromo... 32 5.2 2
(AC186210) Canis Familiaris chromosome X, clone XX-263M16, c... 40 5.4 2
(BH151585) ENTPO84TF Entamoeba histolytica Sheared DNA Entam... 38 5.6 3
(AC016917) Drosophila melanogaster clone RP98-1K12, *** SEQU... 42 6.2 3
(AC120307) Oryza sativa Japonica Group chromosome 11 clone O... 36 6.4 3
(ED810345) ML__Ba0053J06r ML__Ba Mimulus lewisii genomic, ge... 32 6.7 2
(BX511224) Zebrafish DNA sequence from clone CH211-113D14 in... 38 8.4 7
(AC093677) Homo sapiens BAC clone RP11-629B11 from 4, comple... 40 9.1 4
(ER591119) 1093016198794 Global-Ocean-Sampling_GS-36-01-01-2... 42 9.1 2
(AC105860) Rattus norvegicus clone CH230-97F2, *** SEQUENCIN... 44 9.1 2
(AB016892) Arabidopsis thaliana genomic DNA, chromosome 5, P... 44 9.5 2
(CR759958) Zebrafish DNA sequence from clone DKEY-50G2 in li... 38 9.8 5

>(AU268516) Dictyostelium discoideum vegetative cDNA clone:VSI328, 3'
end single read.
Length = 400

Score = 361 bits (182), Expect(2) = e-168
Identities = 188/188 (100%)
Strand = Plus / Plus


Query: 878 accactctcagataatgttaanttaattgaaatctcaaatttaacaaatggtttcagtgg 937
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 212 accactctcagataatgttaanttaattgaaatctcaaatttaacaaatggtttcagtgg 271


Query: 938 tgctgatcttgaaaatctgtgtagagaagcttcatttcaatcnttaagaagagatttatt 997
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 272 tgctgatcttgaaaatctgtgtagagaagcttcatttcaatcnttaagaagagatttatt 331


Query: 998 aaatggttttgttgaaatgtatgattttttaaattgtttatcaaaaattaataatcaatc 1057
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 332 aaatggttttgttgaaatgtatgattttttaaattgtttatcaaaaattaataatcaatc 391


Query: 1058 aaaaaatt 1065
||||||||
Sbjct: 392 aaaaaatt 399

Score = 270 bits (136), Expect(2) = e-168
Identities = 139/139 (100%)
Strand = Plus / Plus


Query: 667 ataatgcacagtcaagagtgttgtcaacatttttaaatgaaatggatggtgttgaacaat 726
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ataatgcacagtcaagagtgttgtcaacatttttaaatgaaatggatggtgttgaacaat 60


Query: 727 tgaatggtgtaatngtaattggtgcaaccaatagattagatatgatcgataatgcattac 786
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tgaatggtgtaatngtaattggtgcaaccaatagattagatatgatcgataatgcattac 120


Query: 787 tcagacctggaagattcga 805
|||||||||||||||||||
Sbjct: 121 tcagacctggaagattcga 139

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 780,471,378
Number of extensions: 55395485
Number of successful extensions: 4893632
Number of sequences better than 10.0: 74
Length of query: 1065
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1041
Effective length of database: 97,308,875,965
Effective search space: 101298539879565
Effective search space used: 101298539879565
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 6.26
Homology vs Protein
Query= Contig-U09810-1 (Contig-U09810-1Q) /CSM_Contig/Contig-U09810-1Q.Seq.d
(1065 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

AE000782_2073(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 130 1e-28
CP000816_691(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 123 1e-26
AE017261_456(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 119 1e-25
CP000102_1047(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 119 2e-25
(O05209) RecName: Full=VCP-like ATPase; &AL445065_184(AL445065|... 117 9e-25
CP001140_1067(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 117 9e-25
CP000099_2251(CP000099|pid:none) Methanosarcina barkeri str. Fus... 117 9e-25
CP000099_888(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 116 2e-24
CP000504_677(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 115 3e-24
AE009950_963(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 115 3e-24
AE009441_467(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 113 1e-23
CP000505_671(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 113 1e-23
CP000561_2090(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 113 1e-23
CP000477_76(CP000477|pid:none) Methanosaeta thermophila PT, comp... 113 1e-23
BA000011_975(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 113 1e-23
AE010299_3436(AE010299|pid:none) Methanosarcina acetivorans str.... 112 2e-23
CP000096_683(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 112 2e-23
CP000477_519(CP000477|pid:none) Methanosaeta thermophila PT, com... 112 2e-23
B71196(B71196) probable transitional endoplasmic reticulum ATPas... 111 4e-23
AE010299_4460(AE010299|pid:none) Methanosarcina acetivorans str.... 111 4e-23
AJ248284_97(AJ248284|pid:none) Pyrococcus abyssi complete genome... 111 4e-23
AP006878_1158(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 110 6e-23
A69086(A69086) cell division control protein Cdc48 - Methanobact... 110 6e-23
GM015171_186(GM015171|pid:none) Sequence 1 from Patent EP1923464. 110 6e-23
CP000575_1105(CP000575|pid:none) Staphylothermus marinus F1, com... 110 1e-22
BA000001_713(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, c... 110 1e-22
CP001399_1810(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 110 1e-22
AY596297_1361(AY596297|pid:none) Haloarcula marismortui ATCC 430... 109 1e-22
(Q58576) RecName: Full=Proteasome-activating nucleotidase; AltNa... 109 1e-22
AE008384_1256(AE008384|pid:none) Methanosarcina mazei strain Goe... 109 2e-22
CP000493_291(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 109 2e-22
BT061263_1(BT061263|pid:none) Zea mays full-length cDNA clone ZM... 109 2e-22
(Q2FQ56) RecName: Full=Proteasome-activating nucleotidase; AltNa... 109 2e-22
(O28972) RecName: Full=Cell division cycle protein 48 homolog AF... 108 2e-22
CP000300_1547(CP000300|pid:none) Methanococcoides burtonii DSM 6... 108 2e-22
CP000682_2198(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 108 3e-22
AY255679_4(AY255679|pid:none) Sulfolobus acidocaldarius DSM 639 ... 108 3e-22
AP008210_1228(AP008210|pid:none) Oryza sativa (japonica cultivar... 108 3e-22
AB018433_1(AB018433|pid:none) Pyrococcus kodakaraensis Pk-cdcA g... 108 4e-22
CP001399_1656(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 108 4e-22
CP001404_1031(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 108 4e-22
(P49825) RecName: Full=Cell division protease ftsH homolog; ... 107 5e-22
CP000855_1119(CP000855|pid:none) Thermococcus onnurineus NA1, co... 107 5e-22
CP000816_585(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 107 5e-22
AM180088_2248(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 107 5e-22
CP000254_1009(CP000254|pid:none) Methanospirillum hungatei JF-1,... 107 5e-22
CP000742_1163(CP000742|pid:none) Methanococcus vannielii SB, com... 107 7e-22
CP000493_1304(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 107 7e-22
AM114193_1763(AM114193|pid:none) Uncultured methanogenic archaeo... 107 9e-22
(Q9HPF0) RecName: Full=Protein cdcH; &AE004437_1275(AE004437|pi... 107 9e-22
AL442115_3(AL442115|pid:none) Oryza sativa genomic DNA, chromoso... 107 9e-22
L17042_1(L17042|pid:none) Sulfolobus acidocaldarius ATPase gene,... 107 9e-22
BA000023_415(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 106 1e-21
AE010299_1765(AE010299|pid:none) Methanosarcina acetivorans str.... 106 1e-21
AM392939_1(AM392939|pid:none) Synthetic construct Homo sapiens c... 106 1e-21
AK091384_1(AK091384|pid:none) Homo sapiens cDNA FLJ34065 fis, cl... 106 1e-21
(Q8NB90) RecName: Full=Spermatogenesis-associated protein 5; Alt... 106 1e-21
AM393832_1(AM393832|pid:none) Synthetic construct Homo sapiens c... 106 1e-21
CP001399_1960(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 106 2e-21
CP000698_2797(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 105 2e-21
(Q8TX03) RecName: Full=Proteasome-activating nucleotidase; AltNa... 105 2e-21
(Q58556) RecName: Full=Cell division cycle protein 48 homolog MJ... 105 3e-21
CR382131_282(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 104 5e-21
GM965345_1(GM965345|pid:none) Sequence 677 from Patent WO2008142... 104 5e-21
BX950229_176(BX950229|pid:none) Methanococcus maripaludis strain... 104 5e-21
AF217546_1(AF217546|pid:none) Arabidopsis thaliana calmodulin-bi... 104 6e-21
CP000780_2417(CP000780|pid:none) Candidatus Methanoregula boonei... 104 6e-21
CP000609_1479(CP000609|pid:none) Methanococcus maripaludis C5, c... 104 6e-21
EF553535_1(EF553535|pid:none) Paralichthys olivaceus cell divisi... 104 6e-21
CP000682_2236(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 104 6e-21
CP000866_101(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 104 6e-21
AE014296_1323(AE014296|pid:none) Drosophila melanogaster chromos... 103 8e-21
AY576993_1(AY576993|pid:none) Danio rerio clone RK103A4E09 valos... 103 8e-21
AF361489_1(AF361489|pid:none) Homo sapiens spermatogenesis assoc... 103 8e-21
CP000682_210(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 103 8e-21
AE014296_1324(AE014296|pid:none) Drosophila melanogaster chromos... 103 8e-21
X99207_1(X99207|pid:none) D.melanogaster mRNA for AAA member of ... 103 8e-21
CR936257_1989(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 103 1e-20
CP000968_194(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 103 1e-20
AE009439_486(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 103 1e-20
AL844507_134(AL844507|pid:none) Plasmodium falciparum 3D7 chromo... 103 1e-20
AE017350_312(AE017350|pid:none) Cryptococcus neoformans var. neo... 103 1e-20
(A6VHR1) RecName: Full=Proteasome-activating nucleotidase; AltNa... 103 1e-20
AM180088_1780(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 103 1e-20
EF085465_1(EF085465|pid:none) Picea sitchensis clone WS0271_L19 ... 102 2e-20
AE004438_162(AE004438|pid:none) Halobacterium sp. NRC-1 plasmid ... 102 2e-20
CP000471_434(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 102 2e-20
EF558547_15(EF558547|pid:none) Uncultured haloarchaeon FLAS10H9 ... 102 2e-20
CP000866_11(CP000866|pid:none) Nitrosopumilus maritimus SCM1, co... 102 2e-20
CP001140_1265(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 102 2e-20
AE017180_1798(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 102 2e-20
CP001002_24(CP001002|pid:none) Methylobacterium radiotolerans JC... 102 2e-20
AM114193_2109(AM114193|pid:none) Uncultured methanogenic archaeo... 102 2e-20
AE008691_109(AE008691|pid:none) Thermoanaerobacter tengcongensis... 102 2e-20
CP000510_1206(CP000510|pid:none) Psychromonas ingrahamii 37, com... 102 3e-20
BA000023_2755(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 102 3e-20
(Q9SD67) RecName: Full=Cell division protease ftsH homolog 7, ch... 102 3e-20
(Q9YAC7) RecName: Full=Proteasome-activating nucleotidase; AltNa... 102 3e-20
CP001147_615(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 102 3e-20
(Q975U2) RecName: Full=Proteasome-activating nucleotidase; AltNa... 102 3e-20
(Q9ZPR1) RecName: Full=Cell division control protein 48 homolog ... 101 4e-20
CP000300_1888(CP000300|pid:none) Methanococcoides burtonii DSM 6... 101 4e-20
AM999887_688(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 101 4e-20
(Q9FIM2) RecName: Full=Cell division protease ftsH homolog 9, ch... 101 4e-20
AC120987_6(AC120987|pid:none) Oryza sativa (japonica cultivar-gr... 101 4e-20
CP000159_1774(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 101 4e-20
(O28303) RecName: Full=Proteasome-activating nucleotidase; AltNa... 101 4e-20
AY606032_1(AY606032|pid:none) Oncorhynchus mykiss valosin contai... 101 5e-20
AK144998_1(AK144998|pid:none) Mus musculus mammary gland RCB-052... 101 5e-20
AM910996_237(AM910996|pid:none) Plasmodium knowlesi strain H chr... 101 5e-20
CP000943_6483(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 101 5e-20
CP000678_354(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 101 5e-20
BC145302_1(BC145302|pid:none) Mus musculus spermatogenesis assoc... 101 5e-20
AL627074_2(AL627074|pid:none) Mouse DNA sequence from clone RP23... 101 5e-20
FN357447_4(FN357447|pid:none) Schistosoma mansoni genome sequenc... 100 7e-20
AP008971_994(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 100 7e-20
CP001365_2346(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 100 7e-20
EF146866_1(EF146866|pid:none) Populus trichocarpa clone WS0121_F... 100 7e-20
(P18759) RecName: Full=Vesicular-fusion protein SEC18; &S45477(... 100 7e-20
CP000866_1219(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 100 7e-20
AM180252_188(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 100 7e-20
AE016818_513(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 100 7e-20
CP000878_907(CP000878|pid:none) Prochlorococcus marinus str. MIT... 100 7e-20
AK167794_1(AK167794|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 100 9e-20
AK083821_1(AK083821|pid:none) Mus musculus 12 days embryo spinal... 100 9e-20
FN357325_52(FN357325|pid:none) Schistosoma mansoni genome sequen... 100 9e-20
FN357325_50(FN357325|pid:none) Schistosoma mansoni genome sequen... 100 9e-20
S25197(S25197;S30329) transitional endoplasmic reticulum ATPase ... 100 9e-20
BC122550_1(BC122550|pid:none) Homo sapiens valosin-containing pr... 100 9e-20
FN392321_347(FN392321|pid:none) Pichia pastoris GS115 chromosome... 100 9e-20
AY596297_707(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 100 9e-20
AL137377_1(AL137377|pid:none) Homo sapiens mRNA; cDNA DKFZp434K0... 100 9e-20
(P03974) RecName: Full=Transitional endoplasmic reticulum ATPase... 100 9e-20
CP000248_571(CP000248|pid:none) Novosphingobium aromaticivorans ... 100 9e-20
AB195711_1(AB195711|pid:none) Gallus gallus vcp mRNA for valosin... 100 9e-20
AM424422_1(AM424422|pid:none) Vitis vinifera contig VV78X256011.... 100 9e-20
AK169140_1(AK169140|pid:none) Mus musculus 17 days embryo kidney... 100 9e-20
(P55072) RecName: Full=Transitional endoplasmic reticulum ATPase... 100 9e-20
(Q3ZBT1) RecName: Full=Transitional endoplasmic reticulum ATPase... 100 9e-20
FB781814_1(FB781814|pid:none) Sequence 1087 from Patent WO200803... 100 9e-20
AK030751_1(AK030751|pid:none) Mus musculus 8 days embryo whole b... 100 9e-20
CQ871266_1(CQ871266|pid:none) Sequence 35 from Patent WO20040781... 100 9e-20
AE008691_1853(AE008691|pid:none) Thermoanaerobacter tengcongensi... 100 9e-20
CP000157_2864(CP000157|pid:none) Erythrobacter litoralis HTCC259... 100 9e-20
VPPG(A26360;A01627)transitional endoplasmic reticulum ATPase - pig 100 9e-20
BC121794_1(BC121794|pid:none) Homo sapiens valosin-containing pr... 100 9e-20
BC007562_1(BC007562|pid:none) Homo sapiens valosin-containing pr... 100 9e-20
AK295686_1(AK295686|pid:none) Homo sapiens cDNA FLJ50168 complet... 100 1e-19
CU928179_526(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 100 1e-19
AY229998_1(AY229998|pid:none) Sulfolobus acidocaldarius strain D... 100 1e-19
CP000270_3153(CP000270|pid:none) Burkholderia xenovorans LB400 c... 100 1e-19
(O43933) RecName: Full=Peroxisome biogenesis factor 1; AltName: ... 100 1e-19
Z79698_2(Z79698|pid:none) Caenorhabditis elegans Cosmid ZK1014, ... 100 1e-19
(Q94392) RecName: Full=Vesicle-fusing ATPase; EC=3.6.4.... 100 1e-19
CP000496_956(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 100 1e-19
CP001052_2803(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 100 1e-19
FB781812_1(FB781812|pid:none) Sequence 1085 from Patent WO200803... 100 1e-19
(Q6LWR0) RecName: Full=Proteasome-activating nucleotidase; AltNa... 100 1e-19
BC046949_1(BC046949|pid:none) Xenopus laevis valosin containing ... 100 1e-19
CP001338_484(CP001338|pid:none) Candidatus Methanosphaerula palu... 100 1e-19
CP000867_1013(CP000867|pid:none) Methanococcus maripaludis C6, c... 100 1e-19
AM180088_1817(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 100 1e-19
EU912438_46(EU912438|pid:none) Vaucheria litorea chloroplast, co... 100 1e-19
CP000148_1869(CP000148|pid:none) Geobacter metallireducens GS-15... 100 1e-19
FM992688_1241(FM992688|pid:none) Candida dubliniensis CD36 chrom... 100 1e-19
AM167904_930(AM167904|pid:none) Bordetella avium 197N complete g... 100 1e-19
CP000924_542(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 100 1e-19
CP000390_3134(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 100 1e-19
CP000561_1786(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 100 1e-19
BX284747_26(BX284747|pid:none) Neurospora crassa DNA linkage gro... 100 1e-19
BX640441_160(BX640441|pid:none) Bordetella bronchiseptica strain... 100 1e-19
BX640414_77(BX640414|pid:none) Bordetella pertussis strain Toham... 100 1e-19
CP000575_899(CP000575|pid:none) Staphylothermus marinus F1, comp... 100 1e-19
AM910983_92(AM910983|pid:none) Plasmodium knowlesi strain H chro... 100 1e-19
CP001338_250(CP001338|pid:none) Candidatus Methanosphaerula palu... 100 1e-19
CP001574_308(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 100 1e-19
AP009384_528(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 100 1e-19
CP000923_1009(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 100 1e-19
CP001358_1695(CP001358|pid:none) Desulfovibrio desulfuricans sub... 99 2e-19
CR954201_368(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 99 2e-19
CP001124_2614(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 99 2e-19
AE017126_978(AE017126|pid:none) Prochlorococcus marinus subsp. m... 99 2e-19
CP000975_1139(CP000975|pid:none) Methylacidiphilum infernorum V4... 99 2e-19
CP001503_1100(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 99 2e-19
BT040547_1(BT040547|pid:none) Zea mays full-length cDNA clone ZM... 99 2e-19
AL391737_124(AL391737|pid:none) chromosome I of strain GB-M1 of ... 99 2e-19
EF676776_1(EF676776|pid:none) Picea sitchensis clone WS02751_M22... 99 2e-19
CP000581_397(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 99 2e-19
(Q5BL07) RecName: Full=Peroxisome biogenesis factor 1; AltName: ... 99 2e-19
BT067445_1(BT067445|pid:none) Zea mays full-length cDNA clone ZM... 99 2e-19
AJ277109_1(AJ277109|pid:none) Trichoderma reesei nsf1 gene for v... 99 2e-19
CP001014_1584(CP001014|pid:none) Thermoproteus neutrophilus V24S... 99 3e-19
AP009385_1197(AP009385|pid:none) Burkholderia multivorans ATCC 1... 99 3e-19
CP000143_2271(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 99 3e-19
CP000086_2728(CP000086|pid:none) Burkholderia thailandensis E264... 99 3e-19
CP001150_2021(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 99 3e-19
CP000378_810(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 99 3e-19
CP000781_3054(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 99 3e-19
AK063158_1(AK063158|pid:none) Oryza sativa Japonica Group cDNA c... 99 3e-19
CP000885_2026(CP000885|pid:none) Clostridium phytofermentans ISD... 99 3e-19
AM747720_1264(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 99 3e-19
AM260479_2384(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 99 3e-19
AB070254_1(AB070254|pid:none) Oryza sativa Japonica Group OsRPT4... 99 3e-19
CP000090_2152(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 99 3e-19
FB905989_1(FB905989|pid:none) Sequence 125262 from Patent WO2008... 99 3e-19
CU695239_399(CU695239|pid:none) Ralstonia solanacearum strain Mo... 99 3e-19
CP000614_1232(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 99 3e-19
CP000352_2181(CP000352|pid:none) Ralstonia metallidurans CH34, c... 99 3e-19
FN317609_1(FN317609|pid:none) Schistosoma japonicum isolate Anhu... 99 3e-19
CP000440_1169(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 99 3e-19
CP001068_1996(CP001068|pid:none) Ralstonia pickettii 12J chromos... 99 3e-19
CP000529_2586(CP000529|pid:none) Polaromonas naphthalenivorans C... 99 3e-19
AB248089_1(AB248089|pid:none) Haemaphysalis longicornis VCP gene... 99 3e-19
AB429260_1(AB429260|pid:none) Dicyema japonicum vcp gene for val... 99 3e-19
AK159177_1(AK159177|pid:none) Mus musculus osteoclast-like cell ... 99 3e-19
CP000267_1974(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 99 3e-19
BT087314_1(BT087314|pid:none) Zea mays full-length cDNA clone ZM... 99 3e-19
AY596297_693(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 99 3e-19
(P54811) RecName: Full=Transitional endoplasmic reticulum ATPase... 98 4e-19
CP000102_1167(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 98 4e-19
CP000661_560(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 98 4e-19
CP000702_338(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 98 4e-19
CU928169_602(CU928169|pid:none) Kluyveromyces thermotolerans str... 98 4e-19
CR382139_451(CR382139|pid:none) Debaryomyces hansenii strain CBS... 98 4e-19
(A4G0S4) RecName: Full=Proteasome-activating nucleotidase; AltNa... 98 4e-19
AE000512_571(AE000512|pid:none) Thermotoga maritima MSB8, comple... 98 4e-19
BC097594_1(BC097594|pid:none) Xenopus laevis hypothetical protei... 98 4e-19
CP000514_3354(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 98 4e-19
BC073644_1(BC073644|pid:none) Xenopus laevis similar to proteaso... 98 4e-19
AF044488_1(AF044488|pid:none) Trypanosoma brucei valosin-contain... 98 4e-19
AB033536_1(AB033536|pid:none) Oryza sativa Japonica Group OsRPT4... 98 4e-19
CP000304_3240(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 98 4e-19
AY673996_64(AY673996|pid:none) Gracilaria tenuistipitata var. li... 98 4e-19
CT005272_140(CT005272|pid:none) Leishmania major strain Friedlin... 98 4e-19
AE009441_2232(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 98 4e-19
CP000969_350(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 98 4e-19
FB781858_1(FB781858|pid:none) Sequence 1131 from Patent WO200803... 98 6e-19
EF531339_90(EF531339|pid:none) Candidatus Chloracidobacterium th... 98 6e-19
CP000360_64(CP000360|pid:none) Acidobacteria bacterium Ellin345,... 98 6e-19
FB781856_1(FB781856|pid:none) Sequence 1129 from Patent WO200803... 98 6e-19
CP001074_3647(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 98 6e-19
CP000854_741(CP000854|pid:none) Mycobacterium marinum M, complet... 98 6e-19
FB906005_1(FB906005|pid:none) Sequence 125278 from Patent WO2008... 98 6e-19
AY456394_1(AY456394|pid:none) 'Chlorella' ellipsoidea cell divis... 98 6e-19
CU234118_1203(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 98 6e-19
FB906007_1(FB906007|pid:none) Sequence 125280 from Patent WO2008... 98 6e-19
CP000325_1149(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 98 6e-19
AC007915_8(AC007915|pid:none) Genomic sequence for Arabidopsis t... 98 6e-19
FB781494_1(FB781494|pid:none) Sequence 767 from Patent WO2008034... 98 6e-19
CP000301_3533(CP000301|pid:none) Rhodopseudomonas palustris BisB... 98 6e-19
AE017350_267(AE017350|pid:none) Cryptococcus neoformans var. neo... 98 6e-19
BT084494_1(BT084494|pid:none) Zea mays full-length cDNA clone ZM... 98 6e-19
BC064227_1(BC064227|pid:none) Xenopus tropicalis proteasome (pro... 98 6e-19
AE002110_9(AE002110|pid:none) Ureaplasma parvum serovar 3 str. A... 98 6e-19
FB781564_1(FB781564|pid:none) Sequence 837 from Patent WO2008034... 98 6e-19
CP000512_2571(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 98 6e-19
BX572606_73(BX572606|pid:none) Rhodopseudomonas palustris CGA009... 98 6e-19
CP000133_3410(CP000133|pid:none) Rhizobium etli CFN 42, complete... 98 6e-19
(P46468) RecName: Full=Putative cell division cycle ATPase; &AL... 97 7e-19
BT083190_1(BT083190|pid:none) Anoplopoma fimbria clone afim-evh-... 97 7e-19
AY892558_1(AY892558|pid:none) Synthetic construct Homo sapiens c... 97 7e-19
BC114306_1(BC114306|pid:none) Danio rerio zgc:136908, mRNA (cDNA... 97 7e-19
AL162751_7(AL162751|pid:none) Arabidopsis thaliana DNA chromosom... 97 7e-19
AY223282_1(AY223282|pid:none) Schistosoma japonicum clone ZZD502... 97 7e-19
BC107950_1(BC107950|pid:none) Rattus norvegicus proteasome (pros... 97 7e-19
BT043940_1(BT043940|pid:none) Salmo salar clone HM4_1948 proteas... 97 7e-19
GM966461_1(GM966461|pid:none) Sequence 1793 from Patent WO200814... 97 7e-19
AE017346_411(AE017346|pid:none) Cryptococcus neoformans var. neo... 97 7e-19
BC025134_1(BC025134|pid:none) Mus musculus proteasome (prosome, ... 97 7e-19
BC057997_1(BC057997|pid:none) Mus musculus proteasome (prosome, ... 97 7e-19
CP001078_147(CP001078|pid:none) Clostridium botulinum E3 str. Al... 97 7e-19
AY627303_1(AY627303|pid:none) Haloferax volcanii DS2 proteasome-... 97 7e-19
CP000633_2652(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 97 7e-19
AY241962_1(AY241962|pid:none) Dermacentor variabilis 26S proteas... 97 1e-18
(Q7KN62) RecName: Full=Transitional endoplasmic reticulum ATPase... 97 1e-18
FB781796_1(FB781796|pid:none) Sequence 1069 from Patent WO200803... 97 1e-18
AE008384_798(AE008384|pid:none) Methanosarcina mazei strain Goe1... 97 1e-18
AM743169_1635(AM743169|pid:none) Stenotrophomonas maltophilia K2... 97 1e-18
AK098874_1(AK098874|pid:none) Oryza sativa Japonica Group cDNA c... 97 1e-18
AY548902_2(AY548902|pid:none) Antonospora locustae hypothetical ... 97 1e-18
CP001276_442(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 97 1e-18
AP009385_929(AP009385|pid:none) Burkholderia multivorans ATCC 17... 97 1e-18
AY208828_1(AY208828|pid:none) Rhipicephalus appendiculatus prote... 97 1e-18
AP008229_2801(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 97 1e-18
AE008312_4(AE008312|pid:none) Agrobacterium tumefaciens str. C58... 97 1e-18
CP001574_367(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 97 1e-18
GM966463_1(GM966463|pid:none) Sequence 1795 from Patent WO200814... 97 1e-18
AE001825_280(AE001825|pid:none) Deinococcus radiodurans R1 chrom... 97 1e-18
AE010299_4017(AE010299|pid:none) Methanosarcina acetivorans str.... 97 1e-18
CP001111_1467(CP001111|pid:none) Stenotrophomonas maltophilia R5... 97 1e-18
AE013599_1006(AE013599|pid:none) Drosophila melanogaster chromos... 97 1e-18
CP001275_287(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 97 1e-18
CP000284_780(CP000284|pid:none) Methylobacillus flagellatus KT, ... 97 1e-18
EU364814_1(EU364814|pid:none) Litchi chinensis cell division cyc... 97 1e-18
CP001010_725(CP001010|pid:none) Polynucleobacter necessarius sub... 97 1e-18
AM180088_563(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 97 1e-18
CP000825_247(CP000825|pid:none) Prochlorococcus marinus str. MIT... 97 1e-18
CP000551_248(CP000551|pid:none) Prochlorococcus marinus str. AS9... 97 1e-18
CP000111_238(CP000111|pid:none) Prochlorococcus marinus str. MIT... 97 1e-18
CP000493_1096(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 97 1e-18
AL590447_19(AL590447|pid:none) chromosome VII of strain GB-M1 of... 97 1e-18
CP000721_100(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 97 1e-18
AF024493_9(AF024493|pid:none) Caenorhabditis elegans cosmid F23F... 97 1e-18
CP001365_2041(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 97 1e-18
CP000233_1335(CP000233|pid:none) Lactobacillus salivarius UCC118... 97 1e-18
CP000552_259(CP000552|pid:none) Prochlorococcus marinus str. MIT... 97 1e-18
BA000004_85(BA000004|pid:none) Bacillus halodurans C-125 DNA, co... 97 1e-18
BT079180_1(BT079180|pid:none) Esox lucius clone eluc-evq-511-062... 97 1e-18
(Q9V287) RecName: Full=Proteasome-activating nucleotidase; AltNa... 97 1e-18
CP000926_4689(CP000926|pid:none) Pseudomonas putida GB-1, comple... 97 1e-18
CP001344_1795(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 97 1e-18
CP000967_1642(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 97 1e-18
(O17071) RecName: Full=Probable 26S protease regulatory subunit ... 97 1e-18
AP008937_221(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 97 1e-18
CP000155_1181(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 96 2e-18
CP000539_2288(CP000539|pid:none) Acidovorax sp. JS42, complete g... 96 2e-18
(Q9BVQ7) RecName: Full=Spermatogenesis-associated protein 5-like... 96 2e-18
AP003928_11(AP003928|pid:none) Oryza sativa Japonica Group genom... 96 2e-18
(P54812) RecName: Full=Transitional endoplasmic reticulum ATPase... 96 2e-18
AM902716_3543(AM902716|pid:none) Bordetella petrii strain DSM 12... 96 2e-18
CP000553_307(CP000553|pid:none) Prochlorococcus marinus str. NAT... 96 2e-18
CP000542_210(CP000542|pid:none) Verminephrobacter eiseniae EF01-... 96 2e-18
EU606206_1(EU606206|pid:none) Dimocarpus longan cell division cy... 96 2e-18
CP000237_406(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 96 2e-18
CU638744_155(CU638744|pid:none) Podospora anserina genomic DNA c... 96 2e-18
DQ515925_1(DQ515925|pid:none) Nicotiana tabacum putative spindle... 96 2e-18
AP008214_1726(AP008214|pid:none) Oryza sativa (japonica cultivar... 96 2e-18
BA000021_231(BA000021|pid:none) Wigglesworthia glossinidia endos... 96 2e-18
CP000916_84(CP000916|pid:none) Thermotoga neapolitana DSM 4359, ... 96 2e-18
AY493662_1(AY493662|pid:none) Candida albicans AAA ATPase gene, ... 96 2e-18
CP000744_5397(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 96 2e-18
CP000660_1594(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 96 2e-18
GM965351_1(GM965351|pid:none) Sequence 683 from Patent WO2008142... 96 2e-18
CP001157_4143(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 96 2e-18
CP000612_1892(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 96 2e-18
CP000562_1555(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 96 2e-18
CP000094_771(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 96 2e-18
CP000359_2167(CP000359|pid:none) Deinococcus geothermalis DSM 11... 96 2e-18
FM992692_197(FM992692|pid:none) Candida dubliniensis CD36 chromo... 96 2e-18
CP001098_56(CP001098|pid:none) Halothermothrix orenii H 168, com... 96 2e-18
CP001393_600(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 96 2e-18
CP000680_3588(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 96 2e-18
(Q9TJ83) RecName: Full=Cell division protease ftsH homolog; ... 96 2e-18
CP000117_68(CP000117|pid:none) Anabaena variabilis ATCC 29413, c... 96 2e-18
BX842651_107(BX842651|pid:none) Bdellovibrio bacteriovorus compl... 96 2e-18
AC183371_11(AC183371|pid:none) Medicago truncatula chromosome 7 ... 96 2e-18
EF495211_82(EF495211|pid:none) Arthrobacter sp. AK-1 plasmid pSI... 96 2e-18
CP000758_1208(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 96 2e-18
BA000012_2998(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 96 2e-18
AM181176_5143(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 96 2e-18
CP000356_1586(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 96 2e-18
AP009247_133(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 96 2e-18
CP000142_1094(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 96 2e-18
AE014291_1639(AE014291|pid:none) Brucella suis 1330 chromosome I... 96 3e-18
CP000462_3219(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 96 3e-18
CP000872_1630(CP000872|pid:none) Brucella canis ATCC 23365 chrom... 96 3e-18
CP000934_2610(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 96 3e-18
AE008917_342(AE008917|pid:none) Brucella melitensis 16M chromoso... 96 3e-18
AE014298_899(AE014298|pid:none) Drosophila melanogaster chromoso... 96 3e-18
CP000679_1148(CP000679|pid:none) Caldicellulosiruptor saccharoly... 96 3e-18
CP000927_4405(CP000927|pid:none) Caulobacter sp. K31, complete g... 96 3e-18
(Q9HRW6) RecName: Full=Proteasome-activating nucleotidase 2; Alt... 96 3e-18
AP009178_1080(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 96 3e-18
CQ840920_1(CQ840920|pid:none) Sequence 15 from Patent EP1439230.... 96 3e-18
BT081387_1(BT081387|pid:none) Drosophila melanogaster LP16188 fu... 96 3e-18
EU016625_19(EU016625|pid:none) Uncultured marine microorganism H... 96 3e-18
CP001349_5283(CP001349|pid:none) Methylobacterium nodulans ORS 2... 96 3e-18
(P75120) RecName: Full=Cell division protease ftsH homolog; ... 96 3e-18
CP000099_389(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 96 3e-18
CP001332_269(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 96 3e-18
CP000951_1157(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 96 3e-18
CR940353_129(CR940353|pid:none) Theileria annulata strain Ankara... 96 3e-18
FN392322_436(FN392322|pid:none) Pichia pastoris GS115 chromosome... 96 3e-18
AM910996_49(AM910996|pid:none) Plasmodium knowlesi strain H chro... 96 3e-18
CR380951_190(CR380951|pid:none) Candida glabrata strain CBS138 c... 96 3e-18
CP001056_154(CP001056|pid:none) Clostridium botulinum B str. Ekl... 96 3e-18
CP000943_266(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 96 3e-18
(Q8U4H3) RecName: Full=Proteasome-activating nucleotidase; AltNa... 96 3e-18
CP001114_116(CP001114|pid:none) Deinococcus deserti VCD115, comp... 96 3e-18
(Q98PE4) RecName: Full=Cell division protease ftsH homolog; ... 96 3e-18
AF118384_1(AF118384|pid:none) Manduca sexta N-ethylmaleimide sen... 95 4e-18
CP000416_504(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 95 4e-18
CP001050_541(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 95 4e-18
(Q89AF2) RecName: Full=Cell division protease ftsH; EC=... 95 4e-18
CP000589_264(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 95 4e-18
(Q96372) RecName: Full=Cell division cycle protein 48 homolog; ... 95 4e-18
(Q8PY58) RecName: Full=Proteasome-activating nucleotidase; AltNa... 95 4e-18
BX548175_2332(BX548175|pid:none) Prochlorococcus marinus MIT9313... 95 4e-18
AM421808_712(AM421808|pid:none) Neisseria meningitidis serogroup... 95 4e-18
BX572596_178(BX572596|pid:none) Rhodopseudomonas palustris CGA00... 95 4e-18
CP000089_941(CP000089|pid:none) Dechloromonas aromatica RCB, com... 95 4e-18
(Q5JHS5) RecName: Full=Proteasome-activating nucleotidase; AltNa... 95 4e-18
CP001400_209(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 95 4e-18
AK014354_1(AK014354|pid:none) Mus musculus 17 days embryo head c... 95 4e-18
CP000961_3531(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 95 4e-18
CP001252_1094(CP001252|pid:none) Shewanella baltica OS223, compl... 95 4e-18
(P51327) RecName: Full=Cell division protease ftsH homolog; ... 95 4e-18
CP000774_2117(CP000774|pid:none) Parvibaculum lavamentivorans DS... 95 4e-18
AY071182_1(AY071182|pid:none) Drosophila melanogaster RE23388 fu... 95 4e-18
CP001197_54(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miya... 95 4e-18
CP000240_616(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 95 4e-18
CP000681_2824(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 95 4e-18
CP000878_249(CP000878|pid:none) Prochlorococcus marinus str. MIT... 95 4e-18
CP001037_1958(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 95 4e-18
AE002098_770(AE002098|pid:none) Neisseria meningitidis MC58, com... 95 4e-18
CU207211_1100(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 95 4e-18
AM039952_1765(AM039952|pid:none) Xanthomonas campestris pv. vesi... 95 4e-18
CP000499_244(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 95 4e-18
BT079937_1(BT079937|pid:none) Esox lucius clone eluc-evq-527-020... 95 4e-18
CP000521_2946(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 95 4e-18
AF083031_144(AF083031|pid:none) Guillardia theta nucleomorph chr... 95 4e-18
AC125735_52(AC125735|pid:none) Leishmania major strain Friedlin ... 95 4e-18
CP000563_3189(CP000563|pid:none) Shewanella baltica OS155, compl... 95 4e-18
AE008384_1006(AE008384|pid:none) Methanosarcina mazei strain Goe... 95 4e-18
CP001103_1646(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 95 4e-18
CP000479_4539(CP000479|pid:none) Mycobacterium avium 104, comple... 95 4e-18
(O14325) RecName: Full=Uncharacterized AAA domain-containing pro... 95 4e-18
CR954209_288(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 95 4e-18
FN357325_51(FN357325|pid:none) Schistosoma mansoni genome sequen... 95 4e-18
(Q1XDF9) RecName: Full=Cell division protease ftsH homolog; ... 95 5e-18
CP001022_51(CP001022|pid:none) Exiguobacterium sibiricum 255-15,... 95 5e-18
(Q8TI88) RecName: Full=Proteasome-activating nucleotidase; AltNa... 95 5e-18
CP000821_3387(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 95 5e-18
CP000554_2360(CP000554|pid:none) Prochlorococcus marinus str. MI... 95 5e-18
AM746676_7305(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 95 5e-18
AE014299_1180(AE014299|pid:none) Shewanella oneidensis MR-1, com... 95 5e-18
CP000830_1108(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 95 5e-18
CP000444_1077(CP000444|pid:none) Shewanella sp. MR-7, complete g... 95 5e-18
BX248583_93(BX248583|pid:none) Blochmannia floridanus complete g... 95 5e-18
AP006627_106(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 95 5e-18
CP000472_1156(CP000472|pid:none) Shewanella piezotolerans WP3, c... 95 5e-18
AL844509_63(AL844509|pid:none) Plasmodium falciparum 3D7 chromos... 95 5e-18
CP000112_1511(CP000112|pid:none) Desulfovibrio desulfuricans G20... 95 5e-18
AE017340_971(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 95 5e-18
CP001029_5282(CP001029|pid:none) Methylobacterium populi BJ001, ... 95 5e-18
CP000552_930(CP000552|pid:none) Prochlorococcus marinus str. MIT... 95 5e-18
CP000115_2695(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 95 5e-18
AP011115_1877(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 95 5e-18
AE010299_4158(AE010299|pid:none) Methanosarcina acetivorans str.... 95 5e-18
CU468230_742(CU468230|pid:none) Acinetobacter baumannii str. SDF... 95 5e-18
CP000463_4657(CP000463|pid:none) Rhodopseudomonas palustris BisA... 95 5e-18
A70632(A70632) hypothetical protein Rv0435c - Mycobacterium tube... 95 5e-18
CP000250_1814(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 95 5e-18
CP000446_1017(CP000446|pid:none) Shewanella sp. MR-4, complete g... 95 5e-18
CP000283_4120(CP000283|pid:none) Rhodopseudomonas palustris BisB... 95 5e-18
(O57940) RecName: Full=Proteasome-activating nucleotidase; AltNa... 95 5e-18
CU466930_794(CU466930|pid:none) Candidatus Cloacamonas acidamino... 94 6e-18
BA000023_604(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 94 6e-18
AM778860_2(AM778860|pid:none) Microcystis aeruginosa PCC 7806 ge... 94 6e-18
CP001196_3238(CP001196|pid:none) Oligotropha carboxidovorans OM5... 94 6e-18
EU304328_11(EU304328|pid:none) Ostreococcus virus OsV5, complete... 94 6e-18
CP000100_996(CP000100|pid:none) Synechococcus elongatus PCC 7942... 94 6e-18
CP000107_859(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 94 6e-18
CP000494_6456(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 94 6e-18
CP000480_839(CP000480|pid:none) Mycobacterium smegmatis str. MC2... 94 6e-18
CP000077_861(CP000077|pid:none) Sulfolobus acidocaldarius DSM 63... 94 6e-18
CP000687_553(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 94 6e-18
CP000383_606(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340... 94 6e-18
CU234118_1114(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 94 6e-18
AJ243808_2(AJ243808|pid:none) Bradyrhizobium japonicum yaeN and ... 94 6e-18
CP000248_76(CP000248|pid:none) Novosphingobium aromaticivorans D... 94 6e-18
CP000319_3333(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 94 6e-18
CP001321_465(CP001321|pid:none) Haemophilus parasuis SH0165, com... 94 6e-18
AE005673_3200(AE005673|pid:none) Caulobacter crescentus CB15, co... 94 6e-18
CQ871264_1(CQ871264|pid:none) Sequence 33 from Patent WO20040781... 94 6e-18
CP000777_225(CP000777|pid:none) Leptospira biflexa serovar Patoc... 94 6e-18
CP000606_2827(CP000606|pid:none) Shewanella loihica PV-4, comple... 94 6e-18
CP000923_772(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 94 6e-18
(P46461) RecName: Full=Vesicle-fusing ATPase 1; EC=3.6.... 94 6e-18
AP008231_546(AP008231|pid:none) Synechococcus elongatus PCC 6301... 94 6e-18
CP000806_3575(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 94 6e-18
CP000851_3055(CP000851|pid:none) Shewanella pealeana ATCC 700345... 94 6e-18
AP009552_3769(AP009552|pid:none) Microcystis aeruginosa NIES-843... 94 6e-18
EU961444_1(EU961444|pid:none) Zea mays clone 235510 unknown mRNA. 94 6e-18
CP000236_1047(CP000236|pid:none) Ehrlichia chaffeensis str. Arka... 94 6e-18
CP001091_641(CP001091|pid:none) Actinobacillus pleuropneumoniae ... 94 6e-18
CP000554_1449(CP000554|pid:none) Prochlorococcus marinus str. MI... 94 8e-18
CP000473_6971(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 94 8e-18
CP000239_2612(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 94 8e-18
CT971583_355(CT971583|pid:none) Synechococcus WH7803 complete ge... 94 8e-18
AF047037_1(AF047037|pid:none) Drosophila melanogaster transition... 94 8e-18
CP000815_166(CP000815|pid:none) Paulinella chromatophora chromat... 94 8e-18
AE017245_608(AE017245|pid:none) Mycoplasma synoviae 53, complete... 94 8e-18
BT080753_1(BT080753|pid:none) Caligus clemensi clone ccle-evs-52... 94 8e-18
CR936257_2506(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 94 8e-18
M20662_2(M20662|pid:none) Yeast (S.cerevisiae) SEC18 gene encodi... 94 8e-18
(Q8K9G8) RecName: Full=Cell division protease ftsH; EC=... 94 8e-18
AL939124_94(AL939124|pid:none) Streptomyces coelicolor A3(2) com... 94 8e-18
(O19922) RecName: Full=Cell division protease ftsH homolog; ... 94 8e-18
CU928168_612(CU928168|pid:none) Kluyveromyces thermotolerans str... 94 8e-18
AL157959_901(AL157959|pid:none) Neisseria meningitidis serogroup... 94 8e-18
CP000817_80(CP000817|pid:none) Lysinibacillus sphaericus C3-41, ... 94 8e-18
CP000435_348(CP000435|pid:none) Synechococcus sp. CC9311, comple... 94 8e-18
CP001287_271(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 94 8e-18
CR940347_287(CR940347|pid:none) Theileria annulata strain Ankara... 94 8e-18
AF244544_1(AF244544|pid:none) Aspergillus niger NsfA (nsfA) gene... 94 8e-18
CR382136_279(CR382136|pid:none) Debaryomyces hansenii strain CBS... 94 8e-18
(P37476) RecName: Full=Cell division protease ftsH homolog; ... 94 8e-18
CP000301_4686(CP000301|pid:none) Rhodopseudomonas palustris BisB... 94 8e-18
CP001404_2522(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 94 1e-17

>AE000782_2073(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,
complete genome. &B69512(B69512)
Length = 811

Score = 130 bits (326), Expect = 1e-28
Identities = 66/125 (52%), Positives = 92/125 (73%)
Frame = +3

Query: 672 AQSRVLSTFLNEMDGVEQLNGVXVIGATNRLDMIDNALLRPGRFDKILEIKLPDQLSRLK 851
A RVL+ L EMDG+E+L+GV VIGATNR D++D ALLRPGRFD+++ ++ PD+ SRL
Sbjct: 651 AVERVLNQLLTEMDGLEELHGVVVIGATNRPDILDPALLRPGRFDRMVYVRPPDKKSRLA 710

Query: 852 ILKIKTKSIPLSDNVXLIEISNLTNGFSGADLENLCREASFQSLRRDLLNGFVEMYDFLN 1031
I KI T+ +PLS++V L E+++LT G+ GAD+E +CREA ++R ++ VEM FL
Sbjct: 711 IFKIHTRDMPLSEDVDLEELADLTEGYVGADIEAICREAVMLAIRENINAEKVEMRHFLE 770

Query: 1032 CLSKI 1046
L KI
Sbjct: 771 ALKKI 775

Score = 73.2 bits (178), Expect = 1e-11
Identities = 35/70 (50%), Positives = 51/70 (72%)
Frame = +3

Query: 675 QSRVLSTFLNEMDGVEQLNGVXVIGATNRLDMIDNALLRPGRFDKILEIKLPDQLSRLKI 854
+ RV++ L MDG+E+ V VIGATNR+D +D AL RPGRFD+ +EI +PD+ R +I
Sbjct: 314 ERRVVAQLLTLMDGLEERGQVIVIGATNRIDAVDPALRRPGRFDREIEIGVPDREGRYEI 373

Query: 855 LKIKTKSIPL 884
+I T+++PL
Sbjct: 374 FQIHTRNMPL 383

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,081,098,004
Number of extensions: 16318793
Number of successful extensions: 39530
Number of sequences better than 10.0: 2332
Number of HSP's gapped: 38977
Number of HSP's successfully gapped: 2610
Length of query: 355
Length of database: 1,040,966,779
Length adjustment: 129
Effective length of query: 226
Effective length of database: 627,614,014
Effective search space: 141840767164
Effective search space used: 141840767164
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.75 gvh: 0.55 alm: 0.45 top: 0.53 tms: 0.00 mit: 0.21 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

56.0 %: cytoplasmic
32.0 %: nuclear
8.0 %: mitochondrial
4.0 %: peroxisomal

>> prediction for Contig-U09810-1 is cyt

VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0