| Contig-U09747-1 |
| Contig ID |
Contig-U09747-1 |
| Contig update |
2002. 9.13 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1245 |
| Chromosome number (1..6, M) |
- |
| Chromosome length |
- |
| Start point |
- |
| End point |
- |
| Strand (PLUS/MINUS) |
- |
| Number of clones |
2 |
| Number of EST |
3 |
| Link to clone list |
U09747 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.17 |
| Homology vs DNA |
Query= Contig-U09747-1 (Contig-U09747-1Q) /CSM_Contig/Contig-U09747-1Q.Seq.d
(1255 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ435283) Dictyostelium discoideum cDNA clone:ddv26l13, 3' ... 1098 0.0 1
(BJ416509) Dictyostelium discoideum cDNA clone:ddv26l13, 5' ... 751 0.0 2
(BJ416510) Dictyostelium discoideum cDNA clone:ddv26l14, 5' ... 692 0.0 2
(EX859726) CBNF5129.rev CBNF Phycomyces blakesleeanus NRRL15... 52 0.052 1
(EX849225) CBNC7809.rev CBNC Phycomyces blakesleeanus NRRL15... 52 0.052 1
(EX847336) CBNC6843.rev CBNC Phycomyces blakesleeanus NRRL15... 52 0.052 1
(EJ746164) 1092962064139 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.072 2
(EK394959) 1095469517097 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.20 2
(K02315) D. melanogaster opsin (ninaE) gene, complete cds. 50 0.21 1
(BX571853) Zebrafish DNA sequence from clone DKEY-29H14 in l... 42 0.41 5
(AL450312) Human DNA sequence from clone RP11-138L24 on chro... 36 0.47 7
(CU462936) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 0.53 5
(AC116960) Dictyostelium discoideum chromosome 2 map complem... 34 0.54 11
(ER585923) 1093015872165 Global-Ocean-Sampling_GS-36-01-01-2... 36 0.58 2
(AC123513) Dictyostelium discoideum strain AX4 chromosome 2 ... 40 0.58 4
(AL353994) Arabidopsis thaliana DNA chromosome 5, BAC clone ... 48 0.81 1
(AC144876) Pongo abelii clone CH253-266J24, WORKING DRAFT SE... 48 0.81 1
(EL752250) AD0013017 Taenia solium UNAM-cd1_adult Taenia sol... 48 0.81 1
(EL752246) AD0013013 Taenia solium UNAM-cd1_adult Taenia sol... 48 0.81 1
(EL751991) AD0012019 Taenia solium UNAM-cd1_adult Taenia sol... 48 0.81 1
(EL751987) AD0012015 Taenia solium UNAM-cd1_adult Taenia sol... 48 0.81 1
(EE635085) CHEL10728.b1_P18.ab1 CHE(LMS) serpentine sunflowe... 48 0.81 1
(CU715547) Phaeodactylum tricornutum mRNA 5-prime sequence f... 48 0.81 1
(CR376802) Zebrafish DNA sequence from clone DKEY-150I13 in ... 36 0.90 6
(AC162114) Bos taurus clone CH240-25G7, WORKING DRAFT SEQUEN... 36 1.6 2
(AC215458) Solanum lycopersicum chromosome 2 clone C02SLe007... 36 1.7 2
(DW281778) UI-S-HH0-ads-p-15-0-UI.s1 UI-S-HH0 Euprymna scolo... 36 2.2 2
(AE014819) Plasmodium falciparum 3D7 chromosome 14 section 4... 44 2.2 8
(CK394317) hggada2A10 Gland Cell Amplified cDNA Library Hete... 34 2.3 2
(AC126151) Rattus norvegicus clone CH230-76O20, WORKING DRAF... 40 2.4 5
(AC222385) Bos taurus clone CH240-416O20, WORKING DRAFT SEQU... 42 2.7 7
(BX537253) Mouse DNA sequence from clone RP24-173B15 on chro... 46 3.2 1
(AJ252172) Mus musculus Dyrk1B gene for DYRK1B protein, exon... 46 3.2 1
(AC148986) Mus musculus BAC clone RP23-89A16 from chromosome... 46 3.2 1
(AC141883) Mus musculus BAC clone RP24-128P19 from 7, comple... 46 3.2 1
(AC123042) Mus musculus BAC clone RP24-545O17 from 10, compl... 46 3.2 1
(AC117513) Homo sapiens 3 BAC RP11-451B8 (Roswell Park Cance... 46 3.2 1
(AC108749) Homo sapiens 3 BAC RP11-288B15 (Roswell Park Canc... 46 3.2 1
(AC068044) Homo sapiens BAC clone RP11-413N15 from 2, comple... 46 3.2 1
(AC149015) Papio anubis clone RP41-356J21, WORKING DRAFT SEQ... 46 3.2 1
(AC128091) Rattus norvegicus clone CH230-321H16, *** SEQUENC... 46 3.2 1
(AC073799) Mus musculus clone RP23-437H6, WORKING DRAFT SEQU... 46 3.2 1
(AC232171) Equus caballus clone CH241-227I4, WORKING DRAFT S... 46 3.2 1
(AC225649) Equus caballus clone CH241-378O15, WORKING DRAFT ... 46 3.2 1
(AC216497) Equus caballus clone CH241-86A13, WORKING DRAFT S... 46 3.2 1
(AC209130) Saimiri boliviensis boliviensis clone CH254-275C6... 46 3.2 1
(AC171337) Macaca mulatta clone CH250-377D17, WORKING DRAFT ... 46 3.2 1
(AC167864) Bos taurus clone CH240-215C17, WORKING DRAFT SEQU... 46 3.2 1
(AZ691847) ENTMI56TR Entamoeba histolytica Sheared DNA Entam... 46 3.2 1
(AZ406705) 1M0176J05F Mouse 10kb plasmid UUGC1M library Mus ... 46 3.2 1
(FI127613) MUGQ_CH252P506I15Sp6_CH0227_056 CHORI-252 Vervet ... 46 3.2 1
(DX531057) GH_MBb0021I17r GH_MBb Gossypium hirsutum genomic ... 46 3.2 1
(CE814245) tigr-gss-dog-17000331859280 Dog Library Canis lup... 46 3.2 1
(EC822971) SME00007410 esmbsro2 Sawyeria marylandensis cDNA,... 46 3.2 1
(AU265323) Dictyostelium discoideum vegetative cDNA clone:VS... 46 3.2 1
(CJ382910) Molgula tectiformis cDNA, gastrula/neurula clone:... 46 3.2 1
(CJ381623) Molgula tectiformis cDNA, gastrula/neurula clone:... 46 3.2 1
(CF934494) TrEST-B01C04.g2 TrEST-B Hypocrea jecorina cDNA cl... 46 3.2 1
(BJ967995) Physcomitrella patens subsp. patens cDNA clone:pp... 46 3.2 1
(BJ967944) Physcomitrella patens subsp. patens cDNA clone:pp... 46 3.2 1
(BJ948033) Physcomitrella patens subsp. patens cDNA clone:pp... 46 3.2 1
(FG088712) CMRC-FF-IH0-acl-f-17-0-CMRC.r1 Ceratitis capitata... 46 3.2 1
(CP001072) Helicobacter pylori Shi470, complete genome. 46 3.2 1
(AR507248) Sequence 12208 from patent US 6703491. 42 3.9 2
(BF298157) 061PbB01 Pb cDNA #17, Tommaso Pace, Marta Ponzi, ... 36 4.3 3
(EH016183) USDA-FP_188709 Lysiphlebus testaceipes adult whol... 32 4.7 3
(DB845139) Nilaparvata lugens mRNA, EST clone:NLEB1344, 5' e... 30 5.2 3
(DB846165) Nilaparvata lugens mRNA, EST clone:NLEB4826, 5' e... 30 5.4 3
(AM485913) Vitis vinifera contig VV78X238946.16, whole genom... 38 5.5 4
(AC177066) Strongylocentrotus purpuratus clone R3-1038A23, W... 38 5.6 6
(AL158085) Human DNA sequence *** SEQUENCING CANCELLED *** f... 42 5.8 3
(AC092457) Homo sapiens chromosome 8 clone RP4-741E11 map 8,... 42 5.8 3
(DE639662) Bombyx mori genomic DNA, Fosmid clone:GBMFno387_e... 38 6.0 2
(FH572339) CHO_OF4685xk17r1.ab1 CHO_OF4 Nicotiana tabacum ge... 32 7.4 3
(AC132312) Mus musculus BAC clone RP24-298A20 from 12, compl... 42 7.7 4
(CZ849262) OC__Ba0237C17.r OC__Ba Oryza coarctata genomic cl... 38 7.9 2
(AF063866) Melanoplus sanguinipes entomopoxvirus, complete g... 34 8.1 12
(AM437561) Vitis vinifera contig VV78X271076.15, whole genom... 40 8.9 2
(AC094299) Rattus norvegicus clone CH230-3I4, *** SEQUENCING... 38 9.2 5
>(BJ435283) Dictyostelium discoideum cDNA clone:ddv26l13, 3' end,
single read.
Length = 611
Score = 1098 bits (554), Expect = 0.0
Identities = 599/599 (100%)
Strand = Plus / Minus
Query: 657 ttanatanatttaaanancnncananaatcnatagaaagaataaagcntcaattnaagtt 716
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 600 ttanatanatttaaanancnncananaatcnatagaaagaataaagcntcaattnaagtt 541
Query: 717 ngtgctcaaacttcncaaaagattcaactntattaaaagaaaaaggttgtcatccagttt 776
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 540 ngtgctcaaacttcncaaaagattcaactntattaaaagaaaaaggttgtcatccagttt 481
Query: 777 tatcntacattctaccaatggcaaatttaccatttctaatttcctccataattgcattcc 836
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 480 tatcntacattctaccaatggcaaatttaccatttctaatttcctccataattgcattcc 421
Query: 837 gtgatatggctgcaaattatccttcactcaaagatgctggtatgctttggtttaccgatt 896
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 420 gtgatatggctgcaaattatccttcactcaaagatgctggtatgctttggtttaccgatt 361
Query: 897 tatctcaaagtgatccaatttttgttttacctgttatttgttcttcactttatttaattg 956
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 360 tatctcaaagtgatccaatttttgttttacctgttatttgttcttcactttatttaattg 301
Query: 957 caactgaattggcattttcaaaaaatacaaatccattaatggtagcacttaaatgggtat 1016
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 300 caactgaattggcattttcaaaaaatacaaatccattaatggtagcacttaaatgggtat 241
Query: 1017 caagaggtatgtcattattgttgattgcatttagtccaacaattccaagtatttgttatt 1076
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 240 caagaggtatgtcattattgttgattgcatttagtccaacaattccaagtatttgttatt 181
Query: 1077 tatattggataccatcaggattatttacaattgcacaatcccttgcattcaattcaaaaa 1136
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 180 tatattggataccatcaggattatttacaattgcacaatcccttgcattcaattcaaaaa 121
Query: 1137 gagtatgtaaatttttaggtttaccaatatcaattaaaagtggtgattcagtcattagtt 1196
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 120 gagtatgtaaatttttaggtttaccaatatcaattaaaagtggtgattcagtcattagtt 61
Query: 1197 tatttaatgcatggagaaaataaaaaaccgaaattaaatatgcaccagaattaccatca 1255
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60 tatttaatgcatggagaaaataaaaaaccgaaattaaatatgcaccagaattaccatca 2
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,295,288,809
Number of extensions: 85993456
Number of successful extensions: 6797312
Number of sequences better than 10.0: 82
Length of query: 1255
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1231
Effective length of database: 97,308,875,965
Effective search space: 119787226312915
Effective search space used: 119787226312915
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.26 |
| Homology vs Protein |
Query= Contig-U09747-1 (Contig-U09747-1Q) /CSM_Contig/Contig-U09747-1Q.Seq.d
(1255 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC051634_22(AC051634|pid:none) Oryza sativa chromosome 10 BAC OS... 91 7e-17
AC079029_22(AC079029|pid:none) Oryza sativa chromosome 10 BAC OS... 91 7e-17
BC152065_1(BC152065|pid:none) Xenopus tropicalis hypothetical pr... 82 4e-16
BC134230_1(BC134230|pid:none) Danio rerio zgc:163091, mRNA (cDNA... 83 2e-14
BT074933_1(BT074933|pid:none) Osmerus mordax clone omor-rgc-512-... 82 5e-14
AE014296_1981(AE014296|pid:none) Drosophila melanogaster chromos... 80 1e-13
EU931170_1(EU931170|pid:none) Drosophila affinis CG6404-like pro... 77 2e-12
EU973937_1(EU973937|pid:none) Zea mays clone 424653 unknown mRNA. 72 3e-11
AK007567_1(AK007567|pid:none) Mus musculus 10 day old male pancr... 72 4e-11
BC001669_1(BC001669|pid:none) Homo sapiens oxidase (cytochrome c... 72 5e-11
AK170898_1(AK170898|pid:none) Mus musculus NOD-derived CD11c +ve... 72 5e-11
(Q8BGA9) RecName: Full=Mitochondrial inner membrane protein OXA1... 72 5e-11
(Q15070) RecName: Full=Mitochondrial inner membrane protein OXA1... 72 5e-11
AK154304_1(AK154304|pid:none) Mus musculus NOD-derived CD11c +ve... 72 5e-11
BX248001_1(BX248001|pid:none) human full-length cDNA clone CS0DM... 72 5e-11
AJ001981_1(AJ001981|pid:none) Homo sapiens OXA1L gene complete s... 72 5e-11
BC112331_1(BC112331|pid:none) Homo sapiens oxidase (cytochrome c... 72 5e-11
(Q3SYV3) RecName: Full=Mitochondrial inner membrane protein OXA1... 71 7e-11
AK077624_1(AK077624|pid:none) Mus musculus 8 days embryo whole b... 71 9e-11
CR954206_159(CR954206|pid:none) Ostreococcus tauri strain OTTH05... 71 9e-11
CP001324_237(CP001324|pid:none) Micromonas sp. RCC299 chromosome... 70 1e-10
BC106493_1(BC106493|pid:none) Xenopus laevis hypothetical protei... 64 1e-08
CP000386_3136(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 64 1e-08
AE017345_287(AE017345|pid:none) Cryptococcus neoformans var. neo... 62 3e-08
Z81029_4(Z81029|pid:none) Caenorhabditis elegans Cosmid C01A2, c... 62 4e-08
T18794(T18794)hypothetical protein C01A2.3 - Caenorhabditis eleg... 62 4e-08
(O94587) Inner membrane protein cox18, mitochondrial precursor (... 62 6e-08
AM055750_1(AM055750|pid:none) Homo sapiens partial mRNA for Cox1... 62 6e-08
BC143642_1(BC143642|pid:none) Homo sapiens COX18 cytochrome c ox... 61 7e-08
T43703(T43703) respiratory protein oxa1-2 - fission yeast (Schi... 60 1e-07
(O43092) RecName: Full=Mitochondrial inner membrane protein oxa1... 60 1e-07
(Q01625) RecName: Full=Membrane protein oxaA 1; AltName: Full=St... 60 2e-07
Z14225_2(Z14225|pid:none) B.subtilis genes rnpA encoding RNAse P... 60 2e-07
FN313919_1(FN313919|pid:none) Schistosoma japonicum isolate Anhu... 60 2e-07
CR857498_1(CR857498|pid:none) Pongo abelii mRNA; cDNA DKFZp468H1... 60 2e-07
CP000560_3691(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 60 2e-07
(O14300) RecName: Full=Mitochondrial inner membrane protein oxa1... 59 4e-07
CP000860_2153(CP000860|pid:none) Candidatus Desulforudis audaxvi... 59 4e-07
AE017333_4194(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 58 8e-07
CP001186_5486(CP001186|pid:none) Bacillus cereus G9842, complete... 58 8e-07
CP000903_5153(CP000903|pid:none) Bacillus weihenstephanensis KBA... 57 1e-06
(Q814F4) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 57 1e-06
CP001176_5406(CP001176|pid:none) Bacillus cereus B4264, complete... 57 1e-06
BA000043_3496(BA000043|pid:none) Geobacillus kaustophilus HTA426... 57 2e-06
CP001177_5433(CP001177|pid:none) Bacillus cereus AH187, complete... 57 2e-06
(P60037) RecName: Full=Inner membrane protein oxaA; &BX571660_1... 57 2e-06
FJ589129_1(FJ589129|pid:none) Chlamydomonas reinhardtii mitochon... 56 2e-06
(P39952) RecName: Full=Mitochondrial inner membrane protein OXA1... 56 2e-06
FJ577501_1(FJ577501|pid:none) Chlamydomonas reinhardtii clone LC... 56 2e-06
AE017194_5601(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 56 3e-06
CU928180_311(CU928180|pid:none) Kluyveromyces thermotolerans str... 56 3e-06
(Q81JH1) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 56 3e-06
CR382132_1312(CR382132|pid:none) Yarrowia lipolytica strain CLIB... 55 4e-06
CP000764_3831(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 55 5e-06
AM502229_117(AM502229|pid:none) Leishmania infantum chromosome 11. 55 5e-06
(Q8R6K6) RecName: Full=Membrane protein oxaA; &AE008691_2585(AE... 55 7e-06
CP001056_3471(CP001056|pid:none) Clostridium botulinum B str. Ek... 39 7e-06
CP000923_2346(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 54 1e-05
CP000922_2830(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 53 2e-05
AY809112_1(AY809112|pid:none) Schistosoma japonicum SJCHGC08195 ... 53 3e-05
CP000496_366(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 52 3e-05
CP000922_1524(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 52 3e-05
CP000555_3816(CP000555|pid:none) Methylibium petroleiphilum PM1,... 52 3e-05
CP001022_3005(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 52 4e-05
CP000589_395(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 52 6e-05
CP001175_2635(CP001175|pid:none) Listeria monocytogenes HCC23, c... 51 8e-05
FM992694_144(FM992694|pid:none) Candida dubliniensis CD36 chromo... 51 8e-05
(Q71VQ8) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 51 8e-05
AE016820_512(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 51 8e-05
CP000884_6037(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 51 8e-05
FM177140_3042(FM177140|pid:none) Lactobacillus casei BL23 comple... 51 1e-04
AP009178_881(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 51 1e-04
CR382133_210(CR382133|pid:none) Debaryomyces hansenii strain CBS... 50 2e-04
AP006852_149(AP006852|pid:none) Candida albicans genomic DNA, ch... 50 2e-04
CP000557_1684(CP000557|pid:none) Geobacillus thermodenitrificans... 49 3e-04
AM946015_1625(AM946015|pid:none) Streptococcus uberis 0140J comp... 49 4e-04
CP000529_4076(CP000529|pid:none) Polaromonas naphthalenivorans C... 49 4e-04
CP000238_126(CP000238|pid:none) Baumannia cicadellinicola str. H... 49 4e-04
AF382189_1(AF382189|pid:none) Podospora anserina II OXA1 (OXA1) ... 49 4e-04
CP000725_178(CP000725|pid:none) Streptococcus gordonii str. Chal... 49 5e-04
CR382139_857(CR382139|pid:none) Debaryomyces hansenii strain CBS... 49 5e-04
CP001275_1036(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 49 5e-04
(A1WWE3) RecName: Full=Inner membrane protein oxaA; &CP000544_1... 48 8e-04
(Q3IK55) RecName: Full=Inner membrane protein oxaA; &CR954246_2... 48 8e-04
AP009049_3465(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 48 8e-04
(Q4K395) RecName: Full=Inner membrane protein oxaA; &CP000076_6... 48 8e-04
CP001327_276(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 47 0.001
CP000233_1715(CP000233|pid:none) Lactobacillus salivarius UCC118... 47 0.001
AC183496_32(AC183496|pid:none) Brassica oleracea, *** SEQUENCING... 47 0.001
CR954209_422(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 47 0.001
CP000542_4905(CP000542|pid:none) Verminephrobacter eiseniae EF01... 47 0.001
(Q3K428) RecName: Full=Inner membrane protein oxaA; &CP000094_5... 47 0.001
CP000497_583(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 47 0.001
CP001392_3476(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 47 0.001
CP000512_4706(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 47 0.001
(Q0I0Z1) RecName: Full=Inner membrane protein oxaA; &CP000436_1... 47 0.002
CP000947_1977(CP000947|pid:none) Haemophilus somnus 2336, comple... 47 0.002
AM181176_6007(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 47 0.002
CP001279_803(CP001279|pid:none) Nautilia profundicola AmH, compl... 47 0.002
AF435863_1(AF435863|pid:none) Neurospora crassa mitochondrial ex... 47 0.002
(Q9RCA5) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 47 0.002
CP000777_281(CP000777|pid:none) Leptospira biflexa serovar Patoc... 46 0.002
(A5UD72) RecName: Full=Inner membrane protein oxaA; &CP000671_1... 46 0.002
CP001034_2879(CP001034|pid:none) Natranaerobius thermophilus JW/... 46 0.002
(Q8D3I8) RecName: Full=Membrane protein oxaA; &BA000021_13(BA00... 46 0.002
(Q1GXL6) RecName: Full=Inner membrane protein oxaA; &CP000284_2... 46 0.003
(Q4ZL11) RecName: Full=Inner membrane protein oxaA; &CP000075_5... 46 0.003
(Q48BF2) RecName: Full=Inner membrane protein oxaA; &CP000058_4... 46 0.003
DQ836715_1(DQ836715|pid:none) Paracoccidioides brasiliensis mito... 46 0.003
CP000513_898(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 45 0.004
CP000414_1960(CP000414|pid:none) Leuconostoc mesenteroides subsp... 45 0.004
CP000517_1608(CP000517|pid:none) Lactobacillus helveticus DPC 45... 45 0.004
(Q82YV1) RecName: Full=Membrane protein oxaA; Flags: Precursor; ... 45 0.005
CP001099_2041(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 45 0.005
(Q9CLQ2) RecName: Full=Inner membrane protein oxaA; &AE004439_1... 45 0.005
CP000713_2368(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 45 0.005
(Q15MS7) RecName: Full=Inner membrane protein oxaA; &CP000388_4... 45 0.005
CR382125_34(CR382125|pid:none) Kluyveromyces lactis strain NRRL ... 45 0.005
(P44973) RecName: Full=Inner membrane protein oxaA; &H64163(H64... 45 0.005
CP001080_945(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 45 0.005
(Q5F4W6) RecName: Full=Inner membrane protein oxaA; &AE004969_1... 45 0.007
(A1KRZ8) RecName: Full=Inner membrane protein oxaA; &(Q9JXS4) R... 45 0.007
CP000033_1860(CP000033|pid:none) Lactobacillus acidophilus NCFM,... 45 0.007
CP000114_401(CP000114|pid:none) Streptococcus agalactiae A909, c... 45 0.007
CP001130_876(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 45 0.007
CP000412_1718(CP000412|pid:none) Lactobacillus delbrueckii subsp... 45 0.007
CP000792_772(CP000792|pid:none) Campylobacter concisus 13826, co... 45 0.007
(B0KRC1) RecName: Full=Inner membrane protein oxaA; &CP000926_5... 45 0.007
CP001050_2658(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945... 45 0.007
CP000687_1402(CP000687|pid:none) Actinobacillus pleuropneumoniae... 45 0.007
CP001091_1509(CP001091|pid:none) Actinobacillus pleuropneumoniae... 45 0.007
CP000569_1400(CP000569|pid:none) Actinobacillus pleuropneumoniae... 45 0.007
CP000413_1753(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 44 0.009
CP001072_1408(CP001072|pid:none) Helicobacter pylori Shi470, com... 44 0.009
(Q9JW48) RecName: Full=Inner membrane protein oxaA; &AL157959_4... 44 0.009
CR543861_3307(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 44 0.009
CP000472_11(CP000472|pid:none) Shewanella piezotolerans WP3, com... 44 0.012
(A4Y1A0) RecName: Full=Inner membrane protein oxaA; &CP000680_4... 44 0.012
CP000724_2095(CP000724|pid:none) Alkaliphilus metalliredigens QY... 44 0.016
(A4SH20) RecName: Full=Inner membrane protein oxaA; &CP000607_1... 44 0.016
CP001161_14(CP001161|pid:none) Buchnera aphidicola str. 5A (Acyr... 44 0.016
CP000964_5423(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 44 0.016
(A6VF45) RecName: Full=Inner membrane protein oxaA; &CP000744_6... 44 0.016
(A4T0N2) RecName: Full=Membrane protein oxaA; &CP000655_2074(CP... 44 0.016
AM270208_12(AM270208|pid:none) Aspergillus niger contig An09c019... 44 0.016
(A6TG08) RecName: Full=Inner membrane protein oxaA; &AP006725_4... 44 0.016
(A8HAI0) RecName: Full=Inner membrane protein oxaA; &CP000851_4... 44 0.016
AP007162_474(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 44 0.016
CP000323_2466(CP000323|pid:none) Psychrobacter cryohalolentis K5... 44 0.016
CP001158_14(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (Ac... 44 0.016
(P0A140) RecName: Full=Inner membrane protein oxaA; &(P0A141) R... 43 0.021
(Q7U351) RecName: Full=Inner membrane protein oxaA; &BX248583_1... 43 0.021
CP001139_3(CP001139|pid:none) Vibrio fischeri MJ11 chromosome I,... 43 0.021
(Q65VC2) RecName: Full=Inner membrane protein oxaA; &AE016827_4... 43 0.021
(Q13SH4) RecName: Full=Inner membrane protein oxaA; &CP000270_4... 43 0.021
DQ489736_1701(DQ489736|pid:none) Leuconostoc citreum KM20, compl... 43 0.021
(Q8DVX3) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 43 0.021
CP001052_3919(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 43 0.021
(Q8E6W4) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 43 0.021
(Q8CX16) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 43 0.021
CP001124_4016(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 43 0.021
(A5WBB7) RecName: Full=Inner membrane protein oxaA; &CP000712_5... 43 0.021
CP001010_1505(CP001010|pid:none) Polynucleobacter necessarius su... 43 0.027
(Q02DE0) RecName: Full=Inner membrane protein oxaA; &CP000438_5... 43 0.027
(Q8DDI2) RecName: Full=Inner membrane protein oxaA; &AE016795_9... 43 0.027
(Q7MQK5) RecName: Full=Inner membrane protein oxaA; &BA000037_3... 43 0.027
CP000958_3157(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 42 0.035
CP001173_1340(CP001173|pid:none) Helicobacter pylori G27, comple... 42 0.035
CP001217_1416(CP001217|pid:none) Helicobacter pylori P12, comple... 42 0.035
(A0KBN3) RecName: Full=Inner membrane protein oxaA; &(Q1BSF7) R... 42 0.035
AM747720_433(AM747720|pid:none) Burkholderia cenocepacia J2315 c... 42 0.035
(Q0BAQ2) RecName: Full=Inner membrane protein oxaA; &CP000440_3... 42 0.035
(Q602M6) RecName: Full=Inner membrane protein oxaA; &AE017282_2... 42 0.035
AX055264_1(AX055264|pid:none) Sequence 171 from Patent WO0073502. 42 0.035
CP001616_3125(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 42 0.046
AC024827_3(AC024827|pid:none) Caenorhabditis elegans cosmid Y55F... 42 0.046
CP001321_1268(CP001321|pid:none) Haemophilus parasuis SH0165, co... 42 0.046
(Q89B34) RecName: Full=Membrane protein oxaA; &AE016826_16(AE01... 42 0.046
(A0KQZ7) RecName: Full=Inner membrane protein oxaA; &CP000462_4... 42 0.046
AK105530_1(AK105530|pid:none) Oryza sativa Japonica Group cDNA c... 42 0.046
AK227236_1(AK227236|pid:none) Arabidopsis thaliana mRNA for hypo... 42 0.060
AL138641_5(AL138641|pid:none) Arabidopsis thaliana DNA chromosom... 42 0.060
CP000360_217(CP000360|pid:none) Acidobacteria bacterium Ellin345... 42 0.060
AE017198_1820(AE017198|pid:none) Lactobacillus johnsonii NCC 533... 42 0.060
(A1S1G5) RecName: Full=Inner membrane protein oxaA; &CP000507_9... 42 0.060
(Q9ZJG8) RecName: Full=Inner membrane protein oxaA; &AE001439_1... 42 0.060
(A7MN02) RecName: Full=Inner membrane protein oxaA; &CP000783_3... 42 0.060
CP000776_612(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 42 0.060
AP009385_73(AP009385|pid:none) Burkholderia multivorans ATCC 176... 42 0.060
(A3N477) RecName: Full=Inner membrane protein oxaA; &CP000570_9... 42 0.060
(A1V7D5) RecName: Full=Inner membrane protein oxaA; &(A2S8D6) R... 42 0.060
CP000382_4(CP000382|pid:none) Clostridium novyi NT, complete gen... 41 0.078
(A9NBA5) RecName: Full=Inner membrane protein oxaA; &(P45650) R... 41 0.078
(Q3SF38) RecName: Full=Inner membrane protein oxaA; &CP000116_2... 41 0.078
CP000962_3652(CP000962|pid:none) Clostridium botulinum A3 str. L... 41 0.078
CP000387_2036(CP000387|pid:none) Streptococcus sanguinis SK36, c... 41 0.078
CP001083_3782(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 41 0.078
CP001129_228(CP001129|pid:none) Streptococcus equi subsp. zooepi... 41 0.10
CP000361_1586(CP000361|pid:none) Arcobacter butzleri RM4018, com... 41 0.10
(A9KBT1) RecName: Full=Inner membrane protein oxaA; &CP000733_1... 41 0.10
(P53239) RecName: Full=Mitochondrial inner membrane protein COX1... 41 0.10
B86055(B86055)60 KD inner-membrane protein [imported] - Escheric... 41 0.10
CP001108_2260(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 41 0.10
(Q8L718) RecName: Full=ALBINO3-like protein 2, chloroplastic; ... 41 0.10
CP001019_29(CP001019|pid:none) Coxiella burnetii CbuG_Q212, comp... 41 0.10
(A7ZTR1) RecName: Full=Inner membrane protein oxaA; &CP000800_4... 41 0.10
(Q0HD64) RecName: Full=Inner membrane protein oxaA; &CP000446_3... 41 0.10
(Q31UV9) RecName: Full=Inner membrane protein oxaA; &CP000036_3... 41 0.10
CP000227_4713(CP000227|pid:none) Bacillus cereus Q1, complete ge... 41 0.10
AY140011_1(AY140011|pid:none) Arabidopsis thaliana unknown prote... 41 0.10
(Q7NPT8) RecName: Full=Inner membrane protein oxaA; &AE016825_4... 41 0.10
(Q8EKT6) RecName: Full=Inner membrane protein oxaA; &AE014299_4... 41 0.10
DQ115391_21(DQ115391|pid:none) Saccharomyces cerevisiae Ygr039wp... 41 0.10
CP001358_1943(CP001358|pid:none) Desulfovibrio desulfuricans sub... 41 0.10
CP000976_425(CP000976|pid:none) Borrelia duttonii Ly, complete g... 41 0.10
(A6VR61) RecName: Full=Inner membrane protein oxaA; &CP000746_2... 40 0.13
(A1BJZ7) RecName: Full=Inner membrane protein oxaA; &CP000492_2... 40 0.13
(Q81XH4) RecName: Full=Membrane protein oxaA 2; Flags: Precursor... 40 0.13
CP000804_1383(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 40 0.13
CR940352_375(CR940352|pid:none) Theileria annulata strain Ankara... 40 0.13
CP000001_4698(CP000001|pid:none) Bacillus cereus E33L, complete ... 40 0.13
CP001230_196(CP001230|pid:none) Persephonella marina EX-H1, comp... 40 0.13
(A5CVI2) RecName: Full=Inner membrane protein oxaA; &AP009247_9... 40 0.13
FM204883_290(FM204883|pid:none) Streptococcus equi subsp. equi 4... 40 0.13
CP001197_881(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy... 40 0.13
(Q8RHA4) RecName: Full=Inner membrane protein oxaA; &AE009951_5... 40 0.17
FM178379_3(FM178379|pid:none) Aliivibrio salmonicida LFI1238 chr... 40 0.17
CP001176_4970(CP001176|pid:none) Bacillus cereus B4264, complete... 40 0.17
CP000863_9(CP000863|pid:none) Acinetobacter baumannii ACICU, com... 40 0.17
CP000024_239(CP000024|pid:none) Streptococcus thermophilus CNRZ1... 40 0.17
(A5F484) RecName: Full=Inner membrane protein oxaA; &(Q9KVY4) R... 40 0.17
(A9MJT7) RecName: Full=Inner membrane protein oxaA; &CP000880_3... 40 0.17
CP000521_3280(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 40 0.17
CP000705_1898(CP000705|pid:none) Lactobacillus reuteri DSM 20016... 40 0.17
CP001144_3836(CP001144|pid:none) Salmonella enterica subsp. ente... 40 0.17
CP000875_760(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2... 40 0.17
CP001186_5029(CP001186|pid:none) Bacillus cereus G9842, complete... 40 0.17
(Q8Z2N7) RecName: Full=Inner membrane protein oxaA; &AE014613_3... 40 0.17
CP001172_3455(CP001172|pid:none) Acinetobacter baumannii AB307-0... 40 0.17
(Q0AE56) RecName: Full=Inner membrane protein oxaA; &CP000450_2... 40 0.17
(Q57HZ7) RecName: Full=Inner membrane protein oxaA; &AE017220_3... 40 0.17
(A9MX83) RecName: Full=Inner membrane protein oxaA; &(Q5PKU2) R... 40 0.17
AE016819_808(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 40 0.23
CU928174_321(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 40 0.23
(A1T0M9) RecName: Full=Inner membrane protein oxaA; &CP000510_3... 40 0.23
CP000993_414(CP000993|pid:none) Borrelia recurrentis A1, complet... 40 0.23
(Q87TR5) RecName: Full=Inner membrane protein oxaA; &BA000031_3... 40 0.23
CP000049_425(CP000049|pid:none) Borrelia turicatae 91E135, compl... 40 0.23
CP000817_4581(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 40 0.23
CP001229_522(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 40 0.23
(A9KX20) RecName: Full=Inner membrane protein oxaA; &CP000891_4... 40 0.23
CP001132_33(CP001132|pid:none) Acidithiobacillus ferrooxidans AT... 40 0.23
DQ074813_1(DQ074813|pid:none) Lactobacillus reuteri lr0252 (lr02... 40 0.23
(Q6CYR0) RecName: Full=Inner membrane protein oxaA; &BX950851_4... 39 0.30
(Q2Y5A8) RecName: Full=Inner membrane protein oxaA; &CP000103_2... 39 0.30
CP001157_5047(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 39 0.30
AM412317_3649(AM412317|pid:none) Clostridium botulinum A str. AT... 39 0.30
BX571875_116(BX571875|pid:none) Photorhabdus luminescens subsp. ... 39 0.39
(Q0K5C1) RecName: Full=Inner membrane protein oxaA; &AM260479_3... 39 0.39
CP000109_2192(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 39 0.39
FP236842_3673(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 39 0.39
CP000560_2133(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 39 0.51
CP000048_425(CP000048|pid:none) Borrelia hermsii DAH, complete g... 39 0.51
CP001068_3706(CP001068|pid:none) Ralstonia pickettii 12J chromos... 39 0.51
(Q11S04) RecName: Full=Inner membrane protein oxaA; &CP000383_2... 39 0.51
(O51398) RecName: Full=Inner membrane protein oxaA; &A70155(A70... 38 0.66
CP000263_7(CP000263|pid:none) Buchnera aphidicola str. Cc (Cinar... 38 0.66
(Q39PQ8) RecName: Full=Inner membrane protein oxaA; &CP000148_3... 38 0.66
CP001154_3217(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 38 0.66
AE017194_5126(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 38 0.66
CP000932_516(CP000932|pid:none) Campylobacter lari RM2100, compl... 38 0.66
(A0Q419) RecName: Full=Inner membrane protein oxaA; &CP000439_7... 38 0.66
(Q3J6L8) RecName: Full=Inner membrane protein oxaA; &CP000127_2... 38 0.66
CP001205_419(CP001205|pid:none) Borrelia burgdorferi ZS7, comple... 38 0.66
(A7N9L6) RecName: Full=Inner membrane protein oxaA; &(Q0BNY1) R... 38 0.66
(A4J015) RecName: Full=Inner membrane protein oxaA; &(Q14JK8) R... 38 0.66
CP000312_2555(CP000312|pid:none) Clostridium perfringens SM101, ... 38 0.66
AP009389_2919(AP009389|pid:none) Pelotomaculum thermopropionicum... 38 0.66
(Q5ZR81) RecName: Full=Inner membrane protein oxaA; &AE017354_2... 38 0.87
CP000721_5017(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 38 0.87
CP000025_1005(CP000025|pid:none) Campylobacter jejuni RM1221, co... 38 0.87
(Q1LH91) RecName: Full=Inner membrane protein oxaA; &CP000352_3... 38 0.87
CP000768_677(CP000768|pid:none) Campylobacter jejuni subsp. doyl... 38 0.87
(A5IIK4) RecName: Full=Inner membrane protein oxaA; &CP000675_3... 38 0.87
(Q6LW55) RecName: Full=Inner membrane protein oxaA; &CR378663_3... 38 0.87
(Q5X0M2) RecName: Full=Inner membrane protein oxaA; &CR628336_3... 38 0.87
(Q46VL6) RecName: Full=Inner membrane protein oxaA; &CP000090_3... 38 0.87
AM711867_3005(AM711867|pid:none) Clavibacter michiganensis subsp... 37 1.1
AC124218_10(AC124218|pid:none) Medicago truncatula clone mth2-30... 37 1.1
AE013218_16(AE013218|pid:none) Buchnera aphidicola str. Sg (Schi... 37 1.1
(P29431) RecName: Full=Membrane protein oxaA; 37 1.1
AP009153_3932(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 37 1.1
CP000813_2097(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 37 1.1
CP000237_386(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 37 1.5
CU928168_559(CU928168|pid:none) Kluyveromyces thermotolerans str... 37 1.5
CP001175_1171(CP001175|pid:none) Listeria monocytogenes HCC23, c... 37 1.5
CP000425_114(CP000425|pid:none) Lactococcus lactis subsp. cremor... 37 1.5
(Q3ANZ7) RecName: Full=Inner membrane protein oxaA; &CP000108_1... 37 1.5
AM406671_141(AM406671|pid:none) Lactococcus lactis subsp. cremor... 37 1.5
(Q8DY84) RecName: Full=Membrane protein oxaA 2; Flags: Precursor... 37 1.5
CP000114_1499(CP000114|pid:none) Streptococcus agalactiae A909, ... 37 1.5
CP000853_2833(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 37 1.5
AM849034_3054(AM849034|pid:none) Clavibacter michiganensis subsp... 37 1.9
AP008232_2429(AP008232|pid:none) Sodalis glossinidius str. 'mors... 37 1.9
AM180252_1069(AM180252|pid:none) Lawsonia intracellularis PHE/MN... 37 1.9
AL844507_274(AL844507|pid:none) Plasmodium falciparum 3D7 chromo... 37 1.9
CP001338_1902(CP001338|pid:none) Candidatus Methanosphaerula pal... 37 1.9
T32510(T32510)hypothetical protein C44B12.3 - Caenorhabditis ele... 37 1.9
AM502253_470(AM502253|pid:none) Leishmania infantum chromosome 35. 37 1.9
CP000814_898(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 37 1.9
(B0TW73) RecName: Full=Inner membrane protein oxaA; &CP000937_7... 36 2.5
(Q92BX6) RecName: Full=Membrane protein oxaA 2; Flags: Precursor... 36 2.5
CP000967_4986(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 36 2.5
CT573072_473(CT573072|pid:none) Kuenenia stuttgartiensis genome ... 36 2.5
AF139908_4(AF139908|pid:none) Listeria monocytogenes lisR/lisK g... 36 2.5
BX842656_310(BX842656|pid:none) Bdellovibrio bacteriovorus compl... 36 3.3
(Q2LSF9) RecName: Full=Inner membrane protein oxaA; &CP000252_1... 36 3.3
CP001111_4037(CP001111|pid:none) Stenotrophomonas maltophilia R5... 36 3.3
AM743169_4428(AM743169|pid:none) Stenotrophomonas maltophilia K2... 36 3.3
(Q9CJ72) RecName: Full=Membrane protein oxaA 1; Flags: Precursor... 36 3.3
CP001102_218(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 36 3.3
CP000260_291(CP000260|pid:none) Streptococcus pyogenes MGAS10270... 35 4.3
AE017333_2453(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 35 4.3
AM286690_2123(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 35 5.6
AM920689_4511(AM920689|pid:none) Xanthomonas campestris pv. camp... 35 5.6
(Q4UNK8) RecName: Full=Inner membrane protein oxaA; &CP000050_4... 35 5.6
(Q9A1C3) RecName: Full=Membrane protein oxaA 2; Flags: Precursor... 35 5.6
AY057934_3(AY057934|pid:none) Xanthomonas campestris pv. campest... 35 5.6
CP000930_1030(CP000930|pid:none) Heliobacterium modesticaldum Ic... 35 5.6
CP000056_285(CP000056|pid:none) Streptococcus pyogenes MGAS6180,... 35 5.6
(Q8K8J2) RecName: Full=Membrane protein oxaA 2; Flags: Precursor... 35 5.6
(Q8P338) RecName: Full=Inner membrane protein oxaA; &AE008922_4... 35 5.6
(Q8PEH7) RecName: Full=Inner membrane protein oxaA; &AE008923_4... 35 5.6
(Q04W30) RecName: Full=Inner membrane protein oxaA; &(Q04XE2) R... 35 7.3
BX640436_220(BX640436|pid:none) Bordetella parapertussis strain ... 34 9.6
CP001114_418(CP001114|pid:none) Deinococcus deserti VCD115, comp... 34 9.6
BX640452_86(BX640452|pid:none) Bordetella bronchiseptica strain ... 34 9.6
(A6T4D7) RecName: Full=Inner membrane protein oxaA; &CP000269_3... 34 9.6
(Q7W2K1) RecName: Full=Inner membrane protein oxaA; 34 9.6
AC117070_26(AC117070|pid:none) Dictyostelium discoideum chromoso... 34 9.6
(P65622) RecName: Full=Inner membrane protein oxaA; &(P65623) R... 34 9.6
>AC051634_22(AC051634|pid:none) Oryza sativa chromosome 10 BAC
OSJNBb0018B10 genomic sequence, complete sequence.
Length = 487
Score = 91.3 bits (225), Expect = 7e-17
Identities = 47/136 (34%), Positives = 73/136 (53%), Gaps = 3/136 (2%)
Frame = +2
Query: 806 PFLISSIIAFRDMAANYPSLKDAGMLWFTDLSQSDPIFVLPVICSSLYLIATELAFSKNT 985
P +S A R+M PS+K G LWFTDL+ DP+++LPV+ + ++L+ EL +
Sbjct: 224 PIFMSFFFAIRNMIDKVPSMKGGGSLWFTDLTTPDPLYILPVLTALIFLVTVELNLQEGM 283
Query: 986 --NPLMVALKWVSRGMSLLLIAFSPTIPSICYLYWIPSGLFTIAQSLAFNSKRVCKFLGL 1159
NP+ +K SRGM++L + F+ + + YWI S LFT+ V KF L
Sbjct: 284 EGNPMARKMKNFSRGMAVLTVPFTMSFAKGIFCYWITSNLFTLTYGFVIRRPAVRKFCNL 343
Query: 1160 P-ISIKSGDSVISLFN 1204
P + +S + +FN
Sbjct: 344 PALEAQSASAKKQMFN 359
Score = 38.5 bits (88), Expect = 0.51
Identities = 17/54 (31%), Positives = 30/54 (55%)
Frame = +3
Query: 435 LNQLHHLTSLPWLVIVPVFTLFIRSALFPLSIKHRINSMRLLEIRPQLDKFKEQ 596
++ +H T L W + + T+ IRSA PL + + +L IRP+++ KE+
Sbjct: 132 IDYIHTFTGLNWWACIALATVLIRSATVPLLVNQLKATQKLNAIRPEMEAIKEE 185
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,534,959,371
Number of extensions: 33602299
Number of successful extensions: 65136
Number of sequences better than 10.0: 341
Number of HSP's gapped: 64898
Number of HSP's successfully gapped: 376
Length of query: 418
Length of database: 1,040,966,779
Length adjustment: 131
Effective length of query: 287
Effective length of database: 621,205,444
Effective search space: 178285962428
Effective search space used: 178285962428
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
2 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |