| Homology vs DNA |
 Query= Contig-U09606-1 (Contig-U09606-1Q) /CSM_Contig/Contig-U09606-1Q.Seq.d
(1014 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ410414) Dictyostelium discoideum cDNA clone:ddv12o08, 5' ... 761 0.0 2
(BJ428568) Dictyostelium discoideum cDNA clone:ddv12o08, 3' ... 624 e-174 1
(ER320244) 1092344172992 Global-Ocean-Sampling_GS-34-01-01-1... 46 5e-09 3
(FE239939) CAPG5610.fwd CAPG Naegleria gruberi amoeba stage ... 72 5e-08 1
(EJ053193) 1095456012433 Global-Ocean-Sampling_GS-26-01-01-1... 46 6e-08 2
(ER330929) 1092344259647 Global-Ocean-Sampling_GS-34-01-01-1... 46 3e-07 3
(EJ642420) 1093011966364 Global-Ocean-Sampling_GS-29-01-01-1... 54 3e-06 2
(EJ997692) 1093024005165 Global-Ocean-Sampling_GS-30-02-01-1... 46 3e-06 2
(EJ563512) 1092959683694 Global-Ocean-Sampling_GS-29-01-01-1... 46 3e-06 2
(EB947348) 13584533 ZF34XL Danio rerio cDNA clone 3854201, m... 48 4e-06 3
(EJ006396) 1091139219405 Global-Ocean-Sampling_GS-26-01-01-1... 40 4e-06 3
(EE684245) AGENCOURT_90107638 NIH_ZGC_29 Danio rerio cDNA cl... 48 9e-06 3
(EK087466) 1092961168048 Global-Ocean-Sampling_GS-31-01-01-1... 46 9e-06 3
(EJ786255) 1093017318131 Global-Ocean-Sampling_GS-30-02-01-1... 38 1e-05 4
(EJ057991) 1095456040938 Global-Ocean-Sampling_GS-26-01-01-1... 46 1e-05 2
(EJ082594) 1095460060045 Global-Ocean-Sampling_GS-26-01-01-1... 46 1e-05 2
(EJ944305) 1093018904369 Global-Ocean-Sampling_GS-30-02-01-1... 42 1e-05 3
(EJ959953) 1093018997297 Global-Ocean-Sampling_GS-30-02-01-1... 42 1e-05 3
(EJ800716) 1093017426354 Global-Ocean-Sampling_GS-30-02-01-1... 38 2e-05 4
(EG652260) AGENCOURT_90890787 NICHD_XGC_tropInt_54 Xenopus (... 62 4e-05 1
(EC823814) SME00001840 esmbsro2 Sawyeria marylandensis cDNA,... 62 4e-05 1
(BC154642) Danio rerio cDNA clone MGC:172295 IMAGE:8997270, ... 48 6e-05 3
(EX260638) 1441022_5_N20_068 PY06 Carica papaya cDNA, mRNA s... 50 7e-05 2
(ES398450) MUT01-I16.x1d-t SHGC-MUT Mytilus californianus cD... 46 7e-05 2
(AR318831) Sequence 1381 from patent US 6562958. 60 1e-04 2
(EK393184) 1095469509546 Global-Ocean-Sampling_GS-31-01-01-1... 44 2e-04 2
(CU468230) Acinetobacter baumannii str. SDF, complete genome. 60 2e-04 1
(CU459141) Acinetobacter baumannii str. AYE, complete genome. 60 2e-04 1
(CP000863) Acinetobacter baumannii ACICU, complete genome. 60 2e-04 1
(FC774469) CBBN8356.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 52 2e-04 2
(CZ287051) cp50d06.f Candida parapsilosis Random Genomic Lib... 50 2e-04 2
(CU431972) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 2e-04 2
(CZ287467) cp52g03.r Candida parapsilosis Random Genomic Lib... 50 2e-04 2
(CU441101) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 46 2e-04 2
(CU430327) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 2e-04 2
(DY894028) CeleSEQ13511 Cunninghamella elegans pBluescript (... 50 4e-04 3
(DY892544) CeleSEQ11101 Cunninghamella elegans pBluescript (... 50 5e-04 3
(CU426882) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 40 5e-04 3
(DY886091) CeleSEQ1601 Cunninghamella elegans pBluescript (E... 50 6e-04 3
(DY885774) CeleSEQ1203 Cunninghamella elegans pBluescript (E... 50 6e-04 3
(ER303225) 1092343722134 Global-Ocean-Sampling_GS-34-01-01-1... 46 6e-04 2
(EK074809) 1092961023414 Global-Ocean-Sampling_GS-31-01-01-1... 46 6e-04 2
(DY888295) CeleSEQ5129 Cunninghamella elegans pBluescript (E... 50 6e-04 3
(CU428271) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 40 7e-04 3
(DY886426) CeleSEQ2078 Cunninghamella elegans pBluescript (E... 50 7e-04 3
(EJ560903) 1092959552357 Global-Ocean-Sampling_GS-29-01-01-1... 42 9e-04 2
(EV827264) TT1EP25TV Tetrahymena thermophila SB210 cDNA libr... 46 9e-04 2
(BA000028) Oceanobacillus iheyensis HTE831 DNA, complete gen... 40 0.002 2
(ER317167) 1092344152186 Global-Ocean-Sampling_GS-34-01-01-1... 44 0.003 3
(EJ716096) 1092959419387 Global-Ocean-Sampling_GS-30-02-01-1... 46 0.003 2
(EJ696376) 1092956019667 Global-Ocean-Sampling_GS-30-02-01-1... 46 0.003 2
(BA000037) Vibrio vulnificus YJ016 DNA, chromosome I, comple... 44 0.006 2
(AE016795) Vibrio vulnificus CMCP6 chromosome I complete seq... 44 0.006 2
(EJ932525) 1093018814165 Global-Ocean-Sampling_GS-30-02-01-1... 42 0.006 3
(EJ684098) 1092955161601 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.009 2
(EJ662117) 1092955028120 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.009 2
(CT025212) Xenopus tropicalis finished cDNA, clone TEgg012e04. 54 0.011 1
(BC135303) Xenopus tropicalis hypothetical protein LOC100038... 54 0.011 1
(CR382139) Debaryomyces hansenii chromosome G of strain CBS7... 54 0.011 1
(AM679477) Entamoeba terrapinae GSS, clone terra171b07.q1k. 54 0.011 1
(AM670043) Entamoeba terrapinae GSS, clone terra157c10.p1k. 54 0.011 1
(AM669970) Entamoeba terrapinae GSS, clone terra156h06.q1k. 54 0.011 1
(EJ631787) 1092963593086 Global-Ocean-Sampling_GS-29-01-01-1... 54 0.011 1
(ES676548) CCAX2989.b1 NICHD_XGC_tropEye1 Xenopus (Silurana)... 54 0.011 1
(CU439986) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 40 0.012 2
(ER307839) 1092343767442 Global-Ocean-Sampling_GS-34-01-01-1... 40 0.013 2
(ER557047) 1093015698967 Global-Ocean-Sampling_GS-36-01-01-2... 40 0.027 3
(EU795252) Uncultured bacterium ARCTIC33_F_06 genomic sequence. 38 0.029 2
(DY893594) CeleSEQ12978 Cunninghamella elegans pBluescript (... 50 0.041 2
(CP000521) Acinetobacter baumannii ATCC 17978, complete genome. 52 0.042 1
(EV829134) TT1D170TV Tetrahymena thermophila SB210 cDNA libr... 40 0.042 2
(DY889342) CeleSEQ10852 Cunninghamella elegans pBluescript (... 50 0.044 2
(DY890325) CeleSEQ9291 Cunninghamella elegans pBluescript (E... 46 0.045 2
(EW922315) G894P5164RJ22.T0 Ixodes scapularis Pooled Non-inf... 38 0.082 3
(EK311105) 1095462397285 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.13 2
(EU622482) Clostridium septicum strain ATCC 12464 putative g... 44 0.16 2
(BC056091) Xenopus laevis glycerol kinase, mRNA (cDNA clone ... 50 0.17 1
(EJ481168) 1095403469856 Global-Ocean-Sampling_GS-28-01-01-1... 50 0.17 1
(DY891633) CeleSEQ10371 Cunninghamella elegans pBluescript (... 50 0.17 1
(DY890886) CeleSEQ7362 Cunninghamella elegans pBluescript (E... 50 0.17 1
(BU906788) AGENCOURT_10456061 NICHD_XGC_Emb1 Xenopus laevis ... 50 0.17 1
(EX259975) 1440547_5_K01_005 PY06 Carica papaya cDNA, mRNA s... 50 0.17 1
(EJ886821) 1093018421651 Global-Ocean-Sampling_GS-30-02-01-1... 34 0.25 3
(CL347918) RPCI44_273E12.r RPCI-44 Sus scrofa genomic clone ... 38 0.31 2
(EK404387) 1095469560151 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.32 3
(ER503715) 1093015412462 Global-Ocean-Sampling_GS-35-01-01-1... 34 0.40 3
(CV864867) PDUts1011A12 Porcine testis cDNA library I Sus sc... 38 0.41 2
(EW634350) rtes08_g13.y1 tes Sus scrofa cDNA 5', mRNA sequence. 38 0.42 2
(EJ745861) 1092962059728 Global-Ocean-Sampling_GS-30-02-01-1... 40 0.48 2
(CV875727) PDUts1143A06 Porcine testis cDNA library I Sus sc... 38 0.48 2
(AM750599) Clytia hemisphaerica EST, 5' end sequence, clone ... 38 0.57 2
(EJ395175) 1093011993584 Global-Ocean-Sampling_GS-28-01-01-1... 48 0.65 1
(CO350640) DR_AOV_FL13_C10 adult ovary full-length (TLL) Dan... 48 0.65 1
(CF347381) AGENCOURT_15223917 NIH_ZGC_10 Danio rerio cDNA cl... 48 0.65 1
(CD593046) RK075A3C09.T3 Zebrafish Kidney Marrow cDNA librar... 48 0.65 1
(CP000962) Clostridium botulinum A3 str. Loch Maree, complet... 48 0.65 1
(CP000510) Psychromonas ingrahamii 37, complete genome. 48 0.65 1
(CP000382) Clostridium novyi NT, complete genome. 48 0.65 1
(EK246528) 1095460259959 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.68 2
(EJ962768) 1093022015847 Global-Ocean-Sampling_GS-30-02-01-1... 38 0.71 2
>(BJ410414) Dictyostelium discoideum cDNA clone:ddv12o08, 5' end,
single read.
Length = 563
Score = 761 bits (384), Expect(2) = 0.0
Identities = 384/384 (100%)
Strand = Plus / Plus
Query: 179 tccattacatggtataccaattgcaggtgttttaggtgaccaacaagctgcaatggttgg 238
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 179 tccattacatggtataccaattgcaggtgttttaggtgaccaacaagctgcaatggttgg 238
Query: 239 tcaaatgtgttttgagaagggtcaagctaaaaatacatatggtactggctgtttcttgtt 298
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 239 tcaaatgtgttttgagaagggtcaagctaaaaatacatatggtactggctgtttcttgtt 298
Query: 299 atataatactggtaatgatatagtacattcaagaaatgggttgttaactacggtttgtta 358
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 299 atataatactggtaatgatatagtacattcaagaaatgggttgttaactacggtttgtta 358
Query: 359 tcaatttggtaaagattcaccaccaatttatgcattggagggtggtgtagctgtggcagg 418
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 359 tcaatttggtaaagattcaccaccaatttatgcattggagggtggtgtagctgtggcagg 418
Query: 419 ttctggtgtacgttggttgattgataatatgggtattgcagagagtagtcaagagattga 478
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 419 ttctggtgtacgttggttgattgataatatgggtattgcagagagtagtcaagagattga 478
Query: 479 ggatttggcaaagagtgtacaagatactggtggtatgtattttgtacctgcttttagtgg 538
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 479 ggatttggcaaagagtgtacaagatactggtggtatgtattttgtacctgcttttagtgg 538
Query: 539 attattcgcaccttattggagaga 562
||||||||||||||||||||||||
Sbjct: 539 attattcgcaccttattggagaga 562
Score = 315 bits (159), Expect(2) = 0.0
Identities = 159/159 (100%)
Strand = Plus / Plus
Query: 1 ttacagatgttaccaatgcaagtagaaccatgttaatgaatttgaaaactttatcatggg 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ttacagatgttaccaatgcaagtagaaccatgttaatgaatttgaaaactttatcatggg 60
Query: 61 ataaagaattatgtgatttcttagaagtaccaatagagattttaccaaacattcatagtt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ataaagaattatgtgatttcttagaagtaccaatagagattttaccaaacattcatagtt 120
Query: 121 cttcagaaatatatggtcatgtgacaatgggtgatgatg 159
|||||||||||||||||||||||||||||||||||||||
Sbjct: 121 cttcagaaatatatggtcatgtgacaatgggtgatgatg 159
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 817,026,308
Number of extensions: 47306057
Number of successful extensions: 3088513
Number of sequences better than 10.0: 132
Length of query: 1014
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 990
Effective length of database: 97,308,875,965
Effective search space: 96335787205350
Effective search space used: 96335787205350
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U09606-1 (Contig-U09606-1Q) /CSM_Contig/Contig-U09606-1Q.Seq.d
(1014 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54VT8) RecName: Full=Probable glycerol kinase; EC=2.7... 387 e-136
AL645567_5(AL645567|pid:none) Mouse DNA sequence from clone RP23... 245 1e-67
AK088373_1(AK088373|pid:none) Mus musculus 2 days neonate thymus... 245 1e-67
FJ436399_1(FJ436399|pid:none) Sus scrofa glycerol kinase (GK) mR... 245 1e-67
AL645567_4(AL645567|pid:none) Mouse DNA sequence from clone RP23... 245 1e-67
(Q64516) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 244 2e-67
AK044308_1(AK044308|pid:none) Mus musculus adult retina cDNA, RI... 244 2e-67
AK169525_1(AK169525|pid:none) Mus musculus 3 days neonate thymus... 244 2e-67
BC048274_1(BC048274|pid:none) Homo sapiens glycerol kinase 2, mR... 243 7e-67
I37417(I37417) glycerol kinase - human &X78712_1(X78712|pid:none) 243 7e-67
AJ252550_2(AJ252550|pid:none) Homo sapiens partial GK gene for g... 241 2e-66
AJ252550_1(AJ252550|pid:none) Homo sapiens partial GK gene for g... 241 2e-66
X69886_1(X69886|pid:none) H.sapiens mRNA for glycerol kinase. 241 2e-66
X78711_1(X78711|pid:none) H.sapiens mRNA for glycerol kinase tes... 239 2e-66
(Q14409) RecName: Full=Putative glycerol kinase 3; Shor... 239 2e-66
AK292282_1(AK292282|pid:none) Homo sapiens cDNA FLJ76723 complet... 239 2e-66
(P32189) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 241 3e-66
BC042421_1(BC042421|pid:none) Homo sapiens glycerol kinase, mRNA... 241 3e-66
CR859709_1(CR859709|pid:none) Pongo abelii mRNA; cDNA DKFZp469P1... 241 3e-66
CP001364_3477(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp... 229 8e-66
AK292241_1(AK292241|pid:none) Homo sapiens cDNA FLJ75853 complet... 239 1e-65
CP001337_72(CP001337|pid:none) Chloroflexus aggregans DSM 9485, ... 228 2e-65
CP000431_6205(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 236 4e-65
AE017283_2245(AE017283|pid:none) Propionibacterium acnes KPA1712... 223 5e-65
AP011115_6325(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 234 9e-65
BC056091_1(BC056091|pid:none) Xenopus laevis glycerol kinase, mR... 234 3e-64
CP000454_2227(CP000454|pid:none) Arthrobacter sp. FB24, complete... 228 6e-64
(A1R6X6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 227 2e-63
(A9WS93) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 229 2e-63
AM711867_1850(AM711867|pid:none) Clavibacter michiganensis subsp... 223 2e-63
AP009493_5844(AP009493|pid:none) Streptomyces griseus subsp. gri... 223 5e-63
(Q828K5) RecName: Full=Glycerol kinase 1; EC=2.7.1.30; ... 225 6e-63
(B1MFT1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 233 1e-62
(Q6AGR0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 218 9e-62
FM210760_4(FM210760|pid:none) Streptomyces clavuligerus metH gen... 217 1e-61
AM238664_568(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 224 2e-61
AP008957_2087(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 223 2e-61
AB169144_1(AB169144|pid:none) Macaca fascicularis testis cDNA, c... 224 2e-61
(B2IE09) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 228 2e-61
CP000480_6025(CP000480|pid:none) Mycobacterium smegmatis str. MC... 228 2e-61
(Q9ADA7) RecName: Full=Glycerol kinase 1; EC=2.7.1.30; ... 216 5e-61
AB164062_1(AB164062|pid:none) Bombyx mori BmGK mRNA for glycerol... 230 7e-61
AK294938_1(AK294938|pid:none) Homo sapiens cDNA FLJ61248 complet... 224 7e-61
AP009152_1349(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 220 9e-61
AK076631_1(AK076631|pid:none) Mus musculus adult male testis cDN... 223 1e-60
AM435484_3(AM435484|pid:none) Vitis vinifera contig VV78X259621.... 220 1e-60
AF117733_1(AF117733|pid:none) Mus musculus glycerol kinase-like ... 222 2e-60
(Q826J2) RecName: Full=Glycerol kinase 3; EC=2.7.1.30; ... 223 2e-60
(A1TGD7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 228 2e-60
X68285_1(X68285|pid:none) H.sapiens mRNA for glycerol kinase. 221 3e-60
(Q01V13) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 219 4e-60
AC018849_21(AC018849|pid:none) Arabidopsis thaliana chromosome 1... 216 4e-59
AM408590_3760(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 218 5e-59
(A5U920) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 218 5e-59
CP000854_5142(CP000854|pid:none) Mycobacterium marinum M, comple... 220 5e-59
EF085243_1(EF085243|pid:none) Picea sitchensis clone WS02712_L15... 216 1e-58
CP001276_358(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 211 2e-58
CP000480_6544(CP000480|pid:none) Mycobacterium smegmatis str. MC... 221 3e-58
(Q827G1) RecName: Full=Glycerol kinase 2; EC=2.7.1.30; ... 209 5e-58
(B1LWN6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 202 5e-58
(A5UU55) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 207 5e-58
AP008957_4605(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 214 7e-58
AC135414_7(AC135414|pid:none) Medicago truncatula clone mth2-8n2... 215 2e-57
AE014296_40(AE014296|pid:none) Drosophila melanogaster chromosom... 218 2e-57
(Q9CB81) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 219 2e-57
AE014296_41(AE014296|pid:none) Drosophila melanogaster chromosom... 218 2e-57
AE017344_270(AE017344|pid:none) Cryptococcus neoformans var. neo... 213 5e-57
CR382132_18(CR382132|pid:none) Yarrowia lipolytica strain CLIB12... 206 6e-57
CP000088_785(CP000088|pid:none) Thermobifida fusca YX, complete ... 212 6e-57
EF086410_1(EF086410|pid:none) Picea sitchensis clone WS02725_J09... 216 1e-56
CR931997_1671(CR931997|pid:none) Corynebacterium jeikeium K411 c... 214 4e-56
AM238663_1357(AM238663|pid:none) Streptomyces ambofaciens ATCC 2... 206 5e-56
AE016958_353(AE016958|pid:none) Mycobacterium avium subsp. parat... 212 6e-56
AM889285_266(AM889285|pid:none) Gluconacetobacter diazotrophicus... 203 6e-56
CP000850_4432(CP000850|pid:none) Salinispora arenicola CNS-205, ... 207 4e-55
CP001620_209(CP001620|pid:none) Corynebacterium kroppenstedtii D... 208 5e-55
AY496707_1(AY496707|pid:none) Pandanus amaryllifolius glycerol k... 216 1e-54
BT088513_1(BT088513|pid:none) Zea mays full-length cDNA clone ZM... 215 2e-54
AY377833_1(AY377833|pid:none) Oryza sativa (japonica cultivar-gr... 215 2e-54
AL117265_16(AL117265|pid:none) Oryza sativa genomic DNA, chromos... 215 2e-54
AP008210_2084(AP008210|pid:none) Oryza sativa (japonica cultivar... 215 2e-54
CP000667_494(CP000667|pid:none) Salinispora tropica CNB-440, com... 204 3e-54
CP000667_2424(CP000667|pid:none) Salinispora tropica CNB-440, co... 204 3e-54
CP001601_2380(CP001601|pid:none) Corynebacterium aurimucosum ATC... 202 6e-54
AJ439353_7(AJ439353|pid:none) Anopheles gambiae BAC clone 30E5. 213 6e-54
(A6WXV2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 213 8e-54
CP001087_1813(CP001087|pid:none) Desulfobacterium autotrophicum ... 195 2e-53
(Q21944) RecName: Full=Probable glycerol kinase; EC=2.7... 211 2e-53
AB377226_1(AB377226|pid:none) Trypanosoma vivax mRNA for glycero... 207 3e-53
(Q73LE9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 194 8e-53
AB127973_1(AB127973|pid:none) Trypanosoma congolense mRNA for gl... 201 2e-51
AJ319055_1(AJ319055|pid:none) Trypanosoma brucei mRNA for glycer... 201 3e-51
AB127974_1(AB127974|pid:none) Trypanosoma congolense mRNA for gl... 200 3e-51
AE014296_361(AE014296|pid:none) Drosophila melanogaster chromoso... 198 6e-51
AY051535_1(AY051535|pid:none) Drosophila melanogaster GH18690 fu... 198 6e-51
AP007154_453(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 184 6e-51
CP001321_969(CP001321|pid:none) Haemophilus parasuis SH0165, com... 187 7e-51
CP001032_1480(CP001032|pid:none) Opitutus terrae PB90-1, complet... 190 1e-50
(B1ZGW7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 202 1e-50
AP007155_928(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 188 1e-50
(Q87XL0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 189 1e-50
(A8I8V7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 190 2e-50
(A6TKR6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 188 2e-50
CP001034_2631(CP001034|pid:none) Natranaerobius thermophilus JW/... 187 4e-50
CP001185_648(CP001185|pid:none) Thermosipho africanus TCF52B, co... 187 4e-50
AM920437_1333(AM920437|pid:none) Penicillium chrysogenum Wiscons... 181 5e-50
BX571874_309(BX571874|pid:none) Photorhabdus luminescens subsp. ... 185 6e-50
(Q4ZPI7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 186 6e-50
(Q7MYB6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 185 6e-50
CP000382_2098(CP000382|pid:none) Clostridium novyi NT, complete ... 186 8e-50
CP000010_211(CP000010|pid:none) Burkholderia mallei ATCC 23344 c... 191 8e-50
(A5UHH7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 184 8e-50
(A5UE44) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 184 8e-50
CP000667_497(CP000667|pid:none) Salinispora tropica CNB-440, com... 199 1e-49
(B5ET10) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 188 1e-49
(Q3K7I5) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 1e-49
AM942759_3180(AM942759|pid:none) Proteus mirabilis strain HI4320... 186 2e-49
BX950851_4240(BX950851|pid:none) Erwinia carotovora subsp. atros... 187 2e-49
(Q1IMB2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 186 2e-49
(A8F679) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 2e-49
CU459141_777(CU459141|pid:none) Acinetobacter baumannii str. AYE... 185 2e-49
(A4QHT1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 189 2e-49
CP000304_1580(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 187 2e-49
CP000863_2915(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 185 2e-49
CP000521_2937(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 185 2e-49
CP000687_378(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 184 2e-49
CP000569_371(CP000569|pid:none) Actinobacillus pleuropneumoniae ... 184 2e-49
CP000746_1576(CP000746|pid:none) Actinobacillus succinogenes 130... 182 2e-49
FM954973_112(FM954973|pid:none) Vibrio splendidus LGP32 chromoso... 186 3e-49
(A7N1R1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 186 3e-49
(Q4QMM7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 182 3e-49
(Q2T0Z3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 189 3e-49
(Q49X93) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 180 3e-49
CP001616_68(CP001616|pid:none) Tolumonas auensis DSM 9187, compl... 179 3e-49
CP000612_2797(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 197 4e-49
(Q87M72) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 186 4e-49
(Q4K734) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 5e-49
(Q9RT38) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 181 5e-49
(B1YWB2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 191 5e-49
(Q4UZR8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 187 5e-49
(A5I5M0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 5e-49
CR378663_232(CR378663|pid:none) Photobacterium profundum SS9; se... 182 7e-49
(A9BJ81) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 7e-49
(Q893Q3) RecName: Full=Glycerol kinase 1; EC=2.7.1.30; ... 181 9e-49
AE005174_4885(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 185 1e-48
AP008232_2172(AP008232|pid:none) Sodalis glossinidius str. 'mors... 187 1e-48
(B7M6X7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 185 1e-48
(B7LUS9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 185 1e-48
(A7ZUE0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 185 1e-48
(Q32A92) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 185 1e-48
AE014073_3215(AE014073|pid:none) Shigella flexneri 2a str. 2457T... 185 1e-48
(Q0BC36) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 191 1e-48
(Q3BYR0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 186 1e-48
(A7GH02) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 177 1e-48
(B1IKJ7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 177 1e-48
CP001581_2974(CP001581|pid:none) Clostridium botulinum A2 str. K... 177 1e-48
AM180355_1430(AM180355|pid:none) Clostridium difficile 630 compl... 186 1e-48
CP000817_1609(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 189 1e-48
(A8AL00) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 185 1e-48
(Q4J7A3) RecName: Full=Glycerol kinase 2; EC=2.7.1.30; ... 175 1e-48
(A9MI40) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 184 2e-48
(Q8PQG7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 185 2e-48
(B0K643) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 2e-48
CP000583_82(CP000583|pid:none) Ostreococcus lucimarinus CCE9901 ... 195 2e-48
(A1SZE1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 182 3e-48
(A0KAA1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 190 3e-48
CP001083_2900(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 177 3e-48
CP000969_1304(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 177 3e-48
AE014075_4775(AE014075|pid:none) Escherichia coli CFT073, comple... 184 3e-48
(Q8FBC3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 184 3e-48
(Q88NX8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 180 3e-48
(Q7MI93) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 182 7e-48
CP000227_1005(CP000227|pid:none) Bacillus cereus Q1, complete ge... 178 7e-48
(A0RAP3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 178 7e-48
CP000702_1349(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 174 7e-48
JE0391(JE0391)glycerol kinase (EC 2.7.1.30) - Flavobacterium men... 185 1e-47
AF543471_2(AF543471|pid:none) Uncultured bacterium plasmid pAK11... 184 1e-47
BA000035_2717(BA000035|pid:none) Corynebacterium efficiens YS-31... 181 2e-47
CU468135_114(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 182 2e-47
(Q8ZKP3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 181 2e-47
(B7HG04) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 177 2e-47
(Q5L091) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 2e-47
CP000480_6541(CP000480|pid:none) Mycobacterium smegmatis str. MC... 192 2e-47
FP236842_134(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 182 2e-47
(Q92BH6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 2e-47
(Q71ZD2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 3e-47
CP001175_1012(CP001175|pid:none) Listeria monocytogenes HCC23, c... 179 3e-47
(Q8Y6Z2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 3e-47
(A0AIY7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 3e-47
(A1VA10) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 174 3e-47
CP000813_867(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 179 4e-47
(A4G1Q7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 4e-47
(Q81U58) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 178 4e-47
(O66131) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 177 4e-47
(B5XTD4) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 180 5e-47
(P57944) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 178 5e-47
AM286415_96(AM286415|pid:none) Yersinia enterocolitica subsp. en... 177 6e-47
CP000438_1427(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 178 6e-47
CP000949_1103(CP000949|pid:none) Pseudomonas putida W619, comple... 178 6e-47
(A6SUL1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 6e-47
(Q7UTP4) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 181 8e-47
(Q98QY9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 8e-47
CP000557_1201(CP000557|pid:none) Geobacillus thermodenitrificans... 176 1e-46
CP000783_3712(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 178 2e-46
CP001022_708(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 176 2e-46
AP006627_3374(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 182 2e-46
(A6QGJ8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 174 2e-46
(Q51390) RecName: Full=Glycerol kinase 1; EC=2.7.1.30; ... 176 3e-46
DQ272742_5(DQ272742|pid:none) Uncultured Bacteroidetes bacterium... 182 3e-46
(Q3AB25) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 187 4e-46
CR954203_79(CR954203|pid:none) Ostreococcus tauri strain OTTH059... 187 4e-46
CP000826_4781(CP000826|pid:none) Serratia proteamaculans 568, co... 177 4e-46
(Q749I1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 175 4e-46
AY570697_1(AY570697|pid:none) Dictyocaulus viviparus isolate L3i... 187 6e-46
(A6LCZ1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 186 8e-46
(B8DL62) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 172 9e-46
(Q67Q63) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 172 1e-45
(A5ISI2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 171 1e-45
(Q15Q03) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 177 1e-45
AE003849_2254(AE003849|pid:none) Xylella fastidiosa 9a5c, comple... 180 1e-45
AP008230_4810(AP008230|pid:none) Desulfitobacterium hafniense Y5... 185 2e-45
AE009952_46(AE009952|pid:none) Yersinia pestis KIM, complete gen... 173 2e-45
AP008955_5037(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 185 2e-45
CP000352_2231(CP000352|pid:none) Ralstonia metallidurans CH34, c... 167 2e-45
(Q9KDW8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 2e-45
(A8H995) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 184 3e-45
CP001111_3519(CP001111|pid:none) Stenotrophomonas maltophilia R5... 184 3e-45
CP001400_462(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 169 3e-45
(A8MG11) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 184 4e-45
(Q891B8) RecName: Full=Glycerol kinase 2; EC=2.7.1.30; ... 184 4e-45
AY458643_35(AY458643|pid:none) Uncultured marine bacterium 561 c... 184 4e-45
(Q5V4I4) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 173 6e-45
CP001401_482(CP001401|pid:none) Sulfolobus islandicus M.16.27, c... 169 6e-45
(B2SF32) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 7e-45
(A4IW85) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 7e-45
AM910994_23(AM910994|pid:none) Plasmodium knowlesi strain H chro... 183 7e-45
AY871959_1(AY871959|pid:none) Synthetic construct hypothetical p... 183 7e-45
(Q316D5) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 167 7e-45
AM743169_3898(AM743169|pid:none) Stenotrophomonas maltophilia K2... 183 9e-45
(B0TWZ7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 9e-45
(Q7P1G2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 183 9e-45
CP000502_153(CP000502|pid:none) Pichia stipitis CBS 6054 chromos... 183 9e-45
AM260479_2443(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 166 9e-45
CP001365_1110(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 174 9e-45
(B0U3F2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 180 1e-44
(A7Z2U3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 171 1e-44
AM167904_3049(AM167904|pid:none) Bordetella avium 197N complete ... 173 2e-44
CP000090_2194(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 165 2e-44
(A7NE12) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 181 3e-44
(Q662C3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 167 6e-44
(Q6FDN3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 172 6e-44
(Q97XW1) RecName: Full=Glycerol kinase 1; EC=2.7.1.30; ... 163 8e-44
CP001399_1004(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 163 8e-44
CP001106_133(CP001106|pid:none) Eubacterium eligens ATCC 27750 p... 180 8e-44
CP001472_797(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 166 1e-43
AF542057_1(AF542057|pid:none) Bacillus subtilis var. natto glyce... 170 1e-43
CP001348_2535(CP001348|pid:none) Clostridium cellulolyticum H10,... 172 1e-43
(Q8XUY1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 167 1e-43
(B1Y1L9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 174 1e-43
(A0L1Q5) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 1e-43
AM236080_3569(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 163 2e-43
CP000251_3446(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 179 2e-43
(Q1CXI5) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 2e-43
(Q0HE70) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 2e-43
(Q0HZS9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 179 2e-43
AM494971_299(AM494971|pid:none) Leishmania braziliensis chromoso... 172 2e-43
(Q18JE8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 167 2e-43
CP000133_3082(CP000133|pid:none) Rhizobium etli CFN 42, complete... 166 2e-43
(P47284) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 170 3e-43
EU184757_1(EU184757|pid:none) Eufriesea pulchra glycerol kinase ... 178 3e-43
(B2UF87) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 167 4e-43
CP001615_881(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 177 4e-43
(A1S2E6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 177 5e-43
CP001359_3577(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 177 5e-43
CP001131_3510(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 177 5e-43
CP001098_803(CP001098|pid:none) Halothermothrix orenii H 168, co... 177 5e-43
CU694391_190(CU694391|pid:none) Ralstonia solanacearum strain Mo... 166 6e-43
CU914168_2798(CU914168|pid:none) Ralstonia solanacearum strain I... 166 6e-43
AM502253_318(AM502253|pid:none) Leishmania infantum chromosome 35. 171 8e-43
(A8FQ89) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 9e-43
CR954247_536(CR954247|pid:none) Pseudoalteromonas haloplanktis s... 176 9e-43
CP001020_802(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 171 1e-42
(A9KCL1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 171 1e-42
AJ512637_1(AJ512637|pid:none) Mycoplasma mycoides subsp. mycoide... 176 1e-42
(Q2SSQ8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 1e-42
(B6IQI0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 168 1e-42
(A6WIC0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 1e-42
CP000096_1890(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 176 1e-42
(O34153) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 176 1e-42
CP001252_408(CP001252|pid:none) Shewanella baltica OS223, comple... 176 1e-42
EU184755_1(EU184755|pid:none) Euglossa imperialis glycerol kinas... 175 2e-42
(Q1WVJ0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 164 2e-42
CP001322_2582(CP001322|pid:none) Desulfatibacillum alkenivorans ... 168 2e-42
(A3CZL0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 174 3e-42
(A1REY5) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 174 3e-42
CP000323_1038(CP000323|pid:none) Psychrobacter cryohalolentis K5... 157 4e-42
CR382139_1038(CR382139|pid:none) Debaryomyces hansenii strain CB... 174 4e-42
(Q10Y19) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 159 5e-42
(A9KY18) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 174 6e-42
AE017308_294(AE017308|pid:none) Mycoplasma mobile 163K complete ... 170 9e-42
CP000302_340(CP000302|pid:none) Shewanella denitrificans OS217, ... 173 1e-41
(Q12GA2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 173 1e-41
AY391774_1(AY391774|pid:none) Pichia farinosa glycerol kinase GU... 172 2e-41
CP000492_2501(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 172 2e-41
(A3QIN4) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 172 2e-41
(A4XXN1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 164 2e-41
CP001140_879(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 171 3e-41
EU184759_1(EU184759|pid:none) Bombus diversus glycerol kinase (g... 171 4e-41
(Q3K3A6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 171 4e-41
(B0R6S2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 162 4e-41
AM180355_761(AM180355|pid:none) Clostridium difficile 630 comple... 160 4e-41
CP000049_232(CP000049|pid:none) Borrelia turicatae 91E135, compl... 163 4e-41
CU179680_448(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 171 5e-41
EU184761_1(EU184761|pid:none) Cephalotrigona capitata glycerol k... 171 5e-41
EU016561_16(EU016561|pid:none) Uncultured marine microorganism H... 171 5e-41
EU184762_1(EU184762|pid:none) Meliponula bocandei glycerol kinas... 171 5e-41
(Q38XX6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 159 6e-41
EU184760_1(EU184760|pid:none) Trigona fuscipennis glycerol kinas... 170 6e-41
EU016581_16(EU016581|pid:none) Uncultured marine microorganism H... 170 6e-41
EU016573_29(EU016573|pid:none) Uncultured marine microorganism H... 170 6e-41
CP000127_2597(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 170 6e-41
AM902716_526(AM902716|pid:none) Bordetella petrii strain DSM 128... 161 8e-41
(A9BRV2) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 166 8e-41
(B5EB79) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 157 8e-41
CP000348_1244(CP000348|pid:none) Leptospira borgpetersenii serov... 170 8e-41
(B5E3S7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 169 1e-40
FM211187_2082(FM211187|pid:none) Streptococcus pneumoniae ATCC 7... 169 1e-40
EU016562_22(EU016562|pid:none) Uncultured marine microorganism H... 169 1e-40
CP000920_2018(CP000920|pid:none) Streptococcus pneumoniae P1031,... 169 1e-40
(B2INK5) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 169 1e-40
CP000918_2147(CP000918|pid:none) Streptococcus pneumoniae 70585,... 169 1e-40
CP000505_1116(CP000505|pid:none) Thermofilum pendens Hrk 5, comp... 163 1e-40
(Q1QVQ3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 164 1e-40
(B0SG67) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 165 1e-40
(Q5FHZ6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 160 1e-40
(A5VUC1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 159 1e-40
(A9WYC6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 159 1e-40
(Q0VRN6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 160 1e-40
AE008918_825(AE008918|pid:none) Brucella melitensis 16M chromoso... 159 1e-40
CP001099_1821(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 169 1e-40
(Q21S75) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 169 1e-40
(Q5P212) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 157 2e-40
CP000423_637(CP000423|pid:none) Lactobacillus casei ATCC 334, co... 169 2e-40
(Q07K31) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 162 2e-40
CP000713_1634(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 148 3e-40
CP001349_1188(CP001349|pid:none) Methylobacterium nodulans ORS 2... 164 3e-40
CP000423_2510(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 168 3e-40
FM177140_2742(FM177140|pid:none) Lactobacillus casei BL23 comple... 168 3e-40
AE017244_363(AE017244|pid:none) Mycoplasma hyopneumoniae 7448, c... 164 4e-40
(Q2IZ89) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 161 4e-40
AM746676_7630(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 167 4e-40
EF488214_1(EF488214|pid:none) Brachyspira pilosicoli strain 95/1... 167 4e-40
(A1W309) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 167 4e-40
CP000407_714(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 167 5e-40
AM946015_1401(AM946015|pid:none) Streptococcus uberis 0140J comp... 167 5e-40
(A3CPV3) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 167 7e-40
(Q8FWK8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 157 8e-40
(O34154) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 166 9e-40
CP000382_2101(CP000382|pid:none) Clostridium novyi NT, complete ... 166 9e-40
CP001357_1918(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 166 9e-40
(Q7VSU7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 158 1e-39
(Q88YD9) RecName: Full=Glycerol kinase 2; EC=2.7.1.30; ... 166 1e-39
CP001392_368(CP001392|pid:none) Diaphorobacter sp. TPSY, complet... 166 2e-39
CR382125_19(CR382125|pid:none) Kluyveromyces lactis strain NRRL ... 166 2e-39
CP000376_407(CP000376|pid:none) Silicibacter sp. TM1040 mega pla... 166 2e-39
(P75064) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 165 2e-39
(Q8NZW9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 165 2e-39
(Q1J5E4) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 165 2e-39
(Q48RX6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 165 2e-39
CP000264_3683(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 164 2e-39
(B6YT00) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 164 3e-39
CP000820_2050(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 164 3e-39
(Q9X6C9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 162 4e-39
(A1U326) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 156 4e-39
CP001160_507(CP001160|pid:none) Thalassiosira pseudonana CCMP133... 164 6e-39
(A4YLX6) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 157 9e-39
CP000774_2689(CP000774|pid:none) Parvibaculum lavamentivorans DS... 163 1e-38
CP000771_401(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 163 1e-38
CP000249_1638(CP000249|pid:none) Frankia sp. CcI3, complete geno... 162 2e-38
EF089399_16(EF089399|pid:none) Uncultured marine bacterium EB0_3... 162 2e-38
CP000425_1357(CP000425|pid:none) Lactococcus lactis subsp. cremo... 161 3e-38
AF274062_1(AF274062|pid:none) Lactobacillus rhamnosus ATP-depend... 161 3e-38
AP008227_142(AP008227|pid:none) Thermus thermophilus HB8 plasmid... 161 3e-38
AE017354_1388(AE017354|pid:none) Legionella pneumophila subsp. p... 154 3e-38
AB012099_1(AB012099|pid:none) Thermococcus kodakaraensis KOD1 Pk... 161 4e-38
CP000628_2501(CP000628|pid:none) Agrobacterium radiobacter K84 c... 161 4e-38
(O93623) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 161 4e-38
CP000449_2611(CP000449|pid:none) Maricaulis maris MCS10, complet... 161 4e-38
CP000675_1488(CP000675|pid:none) Legionella pneumophila str. Cor... 153 4e-38
CP000490_1534(CP000490|pid:none) Paracoccus denitrificans PD1222... 160 5e-38
CR628336_1372(CR628336|pid:none) Legionella pneumophila str. Par... 153 6e-38
CP001129_1547(CP001129|pid:none) Streptococcus equi subsp. zooep... 160 6e-38
AM406671_1084(AM406671|pid:none) Lactococcus lactis subsp. cremo... 160 6e-38
(A2SM29) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 160 8e-38
AE006470_185(AE006470|pid:none) Chlorobium tepidum TLS, complete... 159 1e-37
CP000739_912(CP000739|pid:none) Sinorhizobium medicae WSM419 pla... 159 1e-37
CP000301_2206(CP000301|pid:none) Rhodopseudomonas palustris BisB... 154 1e-37
(Q03DS8) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 159 1e-37
CP001194_106(CP001194|pid:none) Rhizobium leguminosarum bv. trif... 159 1e-37
(Q88ZF1) RecName: Full=Glycerol kinase 1; EC=2.7.1.30; ... 159 1e-37
(Q5LWR1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 159 1e-37
CP000416_227(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 159 2e-37
CT573213_4465(CT573213|pid:none) Frankia alni str. ACN14A chromo... 159 2e-37
FM204884_374(FM204884|pid:none) Streptococcus equi subsp. zooepi... 158 2e-37
CP001150_976(CP001150|pid:none) Rhodobacter sphaeroides KD131 ch... 157 7e-37
(A1WKB4) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 157 7e-37
(Q98M73) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 156 9e-37
(A4WRT7) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 156 1e-36
(B5RL65) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 156 1e-36
CP000135_26(CP000135|pid:none) Rhizobium etli CFN 42 plasmid p42... 155 2e-36
(Q0AEC9) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 155 2e-36
CP001077_325(CP001077|pid:none) Rhizobium etli CIAT 652 plasmid ... 155 2e-36
AY372455_24(AY372455|pid:none) Uncultured marine alpha proteobac... 155 3e-36
(A3PJB4) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 155 3e-36
CP000806_972(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 154 6e-36
CP001037_1450(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 154 6e-36
(Q8YW05) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 153 8e-36
CP000139_346(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 150 1e-35
FN357374_6(FN357374|pid:none) Schistosoma mansoni genome sequenc... 152 1e-35
(A6W2C1) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 151 3e-35
CP000248_2428(CP000248|pid:none) Novosphingobium aromaticivorans... 150 5e-35
AE013599_1436(AE013599|pid:none) Drosophila melanogaster chromos... 150 5e-35
(P74260) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 150 7e-35
EU622482_1(EU622482|pid:none) Clostridium septicum strain ATCC 1... 149 1e-34
CP000435_550(CP000435|pid:none) Synechococcus sp. CC9311, comple... 148 3e-34
CP000633_2413(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 148 3e-34
EU186381_50(EU186381|pid:none) Agrobacterium rhizogenes plasmid ... 145 5e-34
NRL(1GLAG2) Glycerol kinase (EC 2.7.1.30) complex with glycerol ... 136 5e-34
(B7K2C0) RecName: Full=Glycerol kinase; EC=2.7.1.30; Al... 147 7e-34
CR940348_234(CR940348|pid:none) Theileria annulata strain Ankara... 147 7e-34
AP009153_818(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 146 1e-33
CP000230_3450(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 144 1e-33
AB039932_45(AB039932|pid:none) Agrobacterium rhizogenes plasmid ... 144 1e-33
A87401(A87401) glycerol kinase [imported] - Caulobacter crescent... 144 6e-33
CP000927_1712(CP000927|pid:none) Caulobacter sp. K31, complete g... 144 6e-33
CP000828_1618(CP000828|pid:none) Acaryochloris marina MBIC11017,... 142 2e-32
CT978603_1382(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 140 9e-32
CP000110_492(CP000110|pid:none) Synechococcus sp. CC9605, comple... 139 2e-31
CP000248_84(CP000248|pid:none) Novosphingobium aromaticivorans D... 138 3e-31
AL445066_165(AL445066|pid:none) Thermoplasma acidophilum complet... 135 4e-31
CP000158_1319(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 130 7e-29
AE016853_2359(AE016853|pid:none) Pseudomonas syringae pv. tomato... 118 1e-26
AF496515_1(AF496515|pid:none) Lactobacillus delbrueckii subsp. l... 122 2e-26
AD0402(AD0402) glycerol kinase (EC 2.7.1.30) [imported] - Yersin... 117 2e-26
CP000901_829(CP000901|pid:none) Yersinia pestis Angola, complete... 117 2e-26
CP000033_1401(CP000033|pid:none) Lactobacillus acidophilus NCFM,... 122 3e-26
CP000511_3855(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 116 5e-25
AE004091_1489(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 116 1e-24
CU928158_2423(CU928158|pid:none) Escherichia fergusonii ATCC 354... 113 2e-24
CP000384_3518(CP000384|pid:none) Mycobacterium sp. MCS, complete... 114 3e-24
CP001616_1809(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 111 5e-23
CP000647_580(CP000647|pid:none) Klebsiella pneumoniae subsp. pne... 110 8e-23
AK162119_1(AK162119|pid:none) Mus musculus in vitro fertilized e... 110 8e-23
BC116303_1(BC116303|pid:none) Mus musculus glycerol kinase 5 (pu... 110 8e-23
AK049275_1(AK049275|pid:none) Mus musculus ES cells cDNA, RIKEN ... 110 8e-23
(Q08D86) RecName: Full=Putative glycerol kinase 5; EC=2... 110 8e-23
AL939130_14(AL939130|pid:none) Streptomyces coelicolor A3(2) com... 110 1e-22
(Q6GP95) RecName: Full=Putative glycerol kinase 5; EC=2... 109 1e-22
AP006725_1372(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 108 2e-22
AP008955_4301(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 103 4e-22
CP001191_2012(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 108 4e-22
CP001074_2451(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 103 7e-21
AB069725_1(AB069725|pid:none) Streptococcus pyogenes gkh gene fo... 103 1e-20
AM236080_2719(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 102 2e-20
AF543469_2(AF543469|pid:none) Uncultured bacterium plasmid pAK10... 102 2e-20
AE014296_573(AE014296|pid:none) Drosophila melanogaster chromoso... 94 6e-19
AE014296_574(AE014296|pid:none) Drosophila melanogaster chromoso... 94 6e-19
BT010125_1(BT010125|pid:none) Drosophila melanogaster AT16378 fu... 94 6e-19
AE014296_575(AE014296|pid:none) Drosophila melanogaster chromoso... 94 6e-19
EU677744_1(EU677744|pid:none) Caenorhabditis brenneri clone 16D4... 97 7e-19
AE017261_1484(AE017261|pid:none) Picrophilus torridus DSM 9790, ... 92 3e-17
AF153839_1(AF153839|pid:none) Trypanosoma equiperdum glycerol ki... 91 6e-17
AM440787_1(AM440787|pid:none) Vitis vinifera contig VV78X043499.... 88 4e-16
BT021588_1(BT021588|pid:none) Bos taurus hypothetical protein MG... 82 4e-14
AF153348_1(AF153348|pid:none) Phytomonas sp. glycerol kinase gen... 79 2e-13
AE017262_1042(AE017262|pid:none) Listeria monocytogenes str. 4b ... 79 2e-13
AM747721_1108(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 77 7e-13
AM424723_1(AM424723|pid:none) Vitis vinifera contig VV78X179508.... 77 7e-13
(O29395) RecName: Full=Uncharacterized sugar kinase AF_0866; ... 76 2e-12
CP000820_405(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 75 5e-12
CP000884_1119(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 74 6e-12
AM260480_1184(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 74 6e-12
AF153838_1(AF153838|pid:none) Leishmania braziliensis glycerol k... 74 8e-12
CP000353_1817(CP000353|pid:none) Ralstonia metallidurans CH34 me... 74 1e-11
CP000152_2076(CP000152|pid:none) Burkholderia sp. 383 chromosome... 73 1e-11
AP009386_735(AP009386|pid:none) Burkholderia multivorans ATCC 17... 72 2e-11
CP001393_1918(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 70 9e-11
CP000924_2010(CP000924|pid:none) Thermoanaerobacter pseudethanol... 70 1e-10
CP000758_2441(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 68 6e-10
CP000282_1478(CP000282|pid:none) Saccharophagus degradans 2-40, ... 67 1e-09
CP001337_3612(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 63 1e-09
CP000724_3670(CP000724|pid:none) Alkaliphilus metalliredigens QY... 67 1e-09
T25663(T25663)hypothetical protein C55B6.1 - Caenorhabditis eleg... 65 3e-09
CP000909_3738(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 60 6e-09
CP000686_2811(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 63 2e-08
CP000505_885(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 63 2e-08
CP000702_472(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 62 4e-08
EU605756_1(EU605756|pid:none) Clostridium perfringens strain 57 ... 61 7e-08
CP000968_297(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 60 9e-08
CP000916_229(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 59 3e-07
>(Q54VT8) RecName: Full=Probable glycerol kinase;
EC=2.7.1.30; AltName: Full=ATP:glycerol
3-phosphotransferase; AltName: Full=Glycerokinase;
Short=GK;
Length = 539
Score = 387 bits (993), Expect(2) = e-136
Identities = 188/196 (95%), Positives = 189/196 (96%)
Frame = +3
Query: 3 TDVTNASRTMLMNLKTLSWDKELCDFLEVPIEILPNIHSSSEIYGHVTMGDDEQQQQQHP 182
TDVTNASRTMLMNLKTLSWDKELCDFLEVPIEILPNIHSSSEIYGHVTMGDDEQQQQQHP
Sbjct: 214 TDVTNASRTMLMNLKTLSWDKELCDFLEVPIEILPNIHSSSEIYGHVTMGDDEQQQQQHP 273
Query: 183 LHGIPIAGVLGDQQAAMVGQMCFEKGQAKNTYGTGCFLLYNTGNDIVHSRNGLLTTVCYQ 362
LHGIPIAGVLGDQQAAMVGQMCFEKGQAKNTYGTGCFLLYNTGNDIVHSRNGLLTTVCYQ
Sbjct: 274 LHGIPIAGVLGDQQAAMVGQMCFEKGQAKNTYGTGCFLLYNTGNDIVHSRNGLLTTVCYQ 333
Query: 363 FGKDSPPIYALEGGVAVAGSGVRWLIDNMGIAESSQEIEDLAKSVQDTGGMYFVPAFSGL 542
FGKDSPPIYALEGGVAVAGSGVRWLIDNMGIAESSQEIEDLAKSVQDTGGMYFVPAFSGL
Sbjct: 334 FGKDSPPIYALEGGVAVAGSGVRWLIDNMGIAESSQEIEDLAKSVQDTGGMYFVPAFSGL 393
Query: 543 FAPYWRXXXXCIGVNL 590
FAPYWR + V L
Sbjct: 394 FAPYWRDDARGVMVGL 409
Score = 122 bits (305), Expect(2) = e-136
Identities = 68/118 (57%), Positives = 69/118 (58%)
Frame = +1
Query: 574 VLESTCXQTFXVLXAMQKXSGNKLVKLRVXGGMAKXNXXXXXXXXXXXXPVVKPISLXXX 753
VLESTC QTF VL AMQK SGNKLV+LRV GGMAK N PVVKPISL
Sbjct: 422 VLESTCLQTFEVLDAMQKDSGNKLVELRVDGGMAKNNLLLQIQSDLLGLPVVKPISLETT 481
Query: 754 XXXXXXXXXXXXXVWKXTMXFKIGGKFPPXLDXNHKXXXXXXXXXAISKSLDWIXTKN 927
VWK TM FKIGGKF P LD NHK AISKSLDWI TKN
Sbjct: 482 CFGAAFAAGIATGVWKETMQFKIGGKFTPQLDENHKTQKLKEWKKAISKSLDWIDTKN 539
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,474,675,880
Number of extensions: 28903339
Number of successful extensions: 69463
Number of sequences better than 10.0: 675
Number of HSP's gapped: 68412
Number of HSP's successfully gapped: 980
Length of query: 338
Length of database: 1,040,966,779
Length adjustment: 129
Effective length of query: 209
Effective length of database: 627,614,014
Effective search space: 131171328926
Effective search space used: 131171328926
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|