Contig-U09604-1 |
Contig ID |
Contig-U09604-1 |
Contig update |
2002. 9.13 |
Contig sequence |
|
Gap |
gap included |
Contig length |
1073 |
Chromosome number (1..6, M) |
2 |
Chromosome length |
8467578 |
Start point |
3769663 |
End point |
3768589 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
1 |
Number of EST |
2 |
Link to clone list |
U09604 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.10 |
Homology vs CSM-cDNA |
|
dna update |
2008.11.16 |
Homology vs DNA |
Query= Contig-U09604-1 (Contig-U09604-1Q) /CSM_Contig/Contig-U09604-1Q.Seq.d (1083 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 894 0.0 4 (BJ428431) Dictyostelium discoideum cDNA clone:ddv11l24, 3' ... 369 0.0 3 (BJ410280) Dictyostelium discoideum cDNA clone:ddv11l24, 5' ... 920 0.0 1 (AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 38 0.019 15 (CP000727) Clostridium botulinum A str. Hall, complete genome. 38 0.020 19 (CR382398) Plasmodium falciparum chromosome 6, complete sequ... 40 0.028 2 (AC182547) Dasypus novemcinctus clone VMRC5-387K24, WORKING ... 52 0.045 1 (CP001056) Clostridium botulinum B str. Eklund 17B, complete... 44 0.057 21 (AC116960) Dictyostelium discoideum chromosome 2 map complem... 34 0.068 9 (AY442208) Drosophila subobscura strain Hierro-20 A+T rich r... 38 0.14 3 (AY442223) Drosophila subobscura strain Agadir-10 A+T rich r... 38 0.14 3 (AY442222) Drosophila subobscura strain Agadir-5 A+T rich re... 38 0.14 3 (AY442220) Drosophila subobscura strain Boquilobo-26 A+T ric... 38 0.14 3 (AY442219) Drosophila subobscura strain Boquilobo-25 A+T ric... 38 0.14 3 (AY442218) Drosophila subobscura strain Lisbon-11 A+T rich r... 38 0.14 3 (AY442217) Drosophila subobscura strain Lisbon-7 A+T rich re... 38 0.14 3 (AY442216) Drosophila subobscura strain Lisbon-4 A+T rich re... 38 0.14 3 (AY442215) Drosophila subobscura strain Escorial-13 A+T rich... 38 0.14 3 (AY442214) Drosophila subobscura strain Escorial-8 A+T rich ... 38 0.14 3 (AY442213) Drosophila subobscura strain Escorial-7 A+T rich ... 38 0.14 3 (AY442212) Drosophila subobscura strain Barcelona-12 A+T ric... 38 0.14 3 (AY442210) Drosophila subobscura strain Palma-1 A+T rich reg... 38 0.14 3 (AY442209) Drosophila subobscura strain Hierro-21 A+T rich r... 38 0.14 3 (AY442207) Drosophila subobscura strain Gomera-12 A+T rich r... 38 0.14 3 (AY442206) Drosophila subobscura strain Gomera-6 A+T rich re... 38 0.14 3 (AY442205) Drosophila subobscura strain Raices-23 A+T rich r... 38 0.14 3 (AY442204) Drosophila subobscura strain Raices-17 A+T rich r... 38 0.14 3 (AY442203) Drosophila subobscura strain Raices-2 A+T rich re... 38 0.14 3 (AY442202) Drosophila subobscura strain Tamadaba-7 A+T rich ... 38 0.14 3 (AY442201) Drosophila subobscura strain Sao Miguel-10 A+T ri... 38 0.14 3 (AY442200) Drosophila subobscura strain Tamadaba-6 A+T rich ... 38 0.14 3 (AY442199) Drosophila subobscura strain Tamadaba-5 A+T rich ... 38 0.14 3 (AY442198) Drosophila subobscura strain Madeira-24N A+T rich... 38 0.14 3 (AY442197) Drosophila subobscura strain Madeira-22N A+T rich... 38 0.14 3 (AY442196) Drosophila subobscura strain Madeira-14N A+T rich... 38 0.14 3 (AY442195) Drosophila subobscura strain Madeira-6N A+T rich ... 38 0.14 3 (AY442194) Drosophila subobscura strain Madeira-6 A+T rich r... 38 0.14 3 (AY442193) Drosophila subobscura strain Madeira-5N A+T rich ... 38 0.14 3 (AY442192) Drosophila subobscura strain Sao Miguel-11 A+T ri... 38 0.14 3 (AY442224) Drosophila subobscura strain Agadir-15 A+T rich r... 38 0.14 3 (AY442211) Drosophila subobscura strain Palma-5 A+T rich reg... 38 0.14 3 (AY442221) Drosophila subobscura strain Boquilobo-32 A+T ric... 38 0.14 3 (AJ132900) Drosophila subobscura mitochondrial A+T-rich regi... 38 0.14 3 (AJ132899) Drosophila subobscura mitochondrial A+T-rich regi... 38 0.14 3 (EK229397) 1095460173089 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.17 2 (AC207708) Glycine tomentella clone gtt1-289d13, WORKING DRA... 48 0.17 3 (EK093554) 1092962019911 Global-Ocean-Sampling_GS-31-01-01-1... 50 0.18 1 (EK077289) 1092961061565 Global-Ocean-Sampling_GS-31-01-01-1... 50 0.18 1 (EK071683) 1092960198630 Global-Ocean-Sampling_GS-31-01-01-1... 50 0.18 1 (FK209055) XABT216511.g1 Gateway compatible cien cDNA librar... 50 0.18 1 (FK196519) XABT208737.g1 Gateway compatible cien cDNA librar... 50 0.18 1 (FF798981) XABT92094.rev Gateway compatible cien cDNA librar... 50 0.18 1 (FF769380) XABT72237.rev Gateway compatible cien cDNA librar... 50 0.18 1 (CP000673) Clostridium kluyveri DSM 555, complete genome. 50 0.18 1 (EK148779) 1095456037038 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.20 2 (AC146752) Medicago truncatula clone mth2-62d4, complete seq... 42 0.21 7 (AF125955) Caenorhabditis elegans cosmid F46E10, complete se... 46 0.35 2 (CR382399) Plasmodium falciparum chromosome 6, complete sequ... 34 0.37 9 (CP000726) Clostridium botulinum A str. ATCC 19397, complete... 40 0.45 15 (AY129212) Phytophthora megasperma isolate 335 cytochrome c ... 42 0.48 2 (DQ365733) Peronospora trivialis strain MG 6-4 cytochrome ox... 42 0.53 2 (AF083031) Guillardia theta nucleomorph chromosome 3, comple... 32 0.59 12 (AC162352) Bos taurus clone CH240-114A21, WORKING DRAFT SEQU... 44 0.67 5 (AL008633) Human DNA sequence from clone RP3-345B16 on chrom... 48 0.70 1 (AC129355) Rattus norvegicus clone CH230-445B4, WORKING DRAF... 48 0.70 1 (AC207707) Glycine tomentella clone gtd1-153c22, WORKING DRA... 48 0.70 1 (AC174247) Strongylocentrotus purpuratus clone R3-33A15, WOR... 48 0.70 1 (FI058696) CHO_OF6617xh17r1.ab1 CHO_OF6 Nicotiana tabacum ge... 48 0.70 1 (FH603819) CHO_OF4488xp22r1.ab1 CHO_OF4 Nicotiana tabacum ge... 48 0.70 1 (ER631456) 1093018453934 Global-Ocean-Sampling_GS-36-01-01-2... 48 0.70 1 (DU229333) 1098589007420 CHORI-243 Ovis aries genomic clone ... 48 0.70 1 (EH622917) CHO_SL020xn05f1.ab1 CHO_SL Nicotiana tabacum cDNA... 48 0.70 1 (EE898440) B13681A FFB Bos taurus cDNA clone B1368 3', mRNA ... 48 0.70 1 (CA758814) BR030026001_BR030_F08_62_064.ab1 OA Oryza sativa ... 48 0.70 1 (AL844509) Plasmodium falciparum chromosome 13. 36 0.78 15 (CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 32 0.88 18 (AC006759) Caenorhabditis elegans clone Y40G12, *** SEQUENCI... 46 0.94 3 (CU672230) Zebrafish DNA sequence from clone CH73-283L9 in l... 42 1.0 3 (X95276) Plasmodium falciparum complete gene map of plastid-... 40 1.1 4 (BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 34 1.3 2 (BZ489503) BONOA29TF BO_1.6_2_KB_tot Brassica oleracea genom... 34 1.3 3 (CU928548) S.lycopersicum DNA sequence *** SEQUENCING IN PRO... 38 1.3 5 (AC116963) Dictyostelium discoideum chromosome 2 map 4657875... 34 1.3 13 (AC116551) Dictyostelium discoideum chromosome 2 map complem... 36 1.4 10 (AC218549) Bos taurus clone CH240-311M12, WORKING DRAFT SEQU... 36 1.4 2 (AE014841) Plasmodium falciparum 3D7 chromosome 11 section 6... 34 1.4 12 (CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 38 1.4 19 (AC222864) Bos taurus clone CH240-436N12, WORKING DRAFT SEQU... 36 1.4 2 (AZ690387) ENTLF44TF Entamoeba histolytica Sheared DNA Entam... 32 1.5 3 (AF193903) Cafeteria roenbergensis mitochondrial DNA, comple... 42 1.6 4 (AE009951) Fusobacterium nucleatum subsp. nucleatum ATCC 255... 36 1.6 15 (BG353517) ps29c10.y1 Trichinella spiralis ML CMVsport jasme... 38 1.6 2 (AC006896) Caenorhabditis elegans clone Y71H2X, *** SEQUENCI... 36 1.7 10 (AC005505) Plasmodium falciparum chromosome 12 clone 3D7, **... 36 1.8 8 (AJ249044) Hylocomium splendens rbcL and atpB gene promoter ... 36 1.9 2 (AJ288379) Hylocomium splendens atpB-rbcL non-coding spacer,... 36 1.9 2 (AJ288378) Hylocomium splendens atpB-rbcL non-coding spacer,... 36 1.9 2 (AJ288377) Hylocomium splendens atpB-rbcL non-coding spacer,... 36 1.9 2 (AJ288376) Hylocomium splendens atpB-rbcL non-coding spacer,... 36 1.9 2 (DQ365701) Bremia lactucae strain HV 759 cytochrome oxidase ... 42 1.9 2
>(AC116986) Dictyostelium discoideum chromosome 2 map 2234041-2567370 strain AX4, complete sequence. Length = 333321
Score = 894 bits (451), Expect(4) = 0.0 Identities = 451/451 (100%) Strand = Plus / Plus
Query: 14 taatagatatgatggattaaataaaagttatttaaatataaatttttattgttctacaac 73 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314630 taatagatatgatggattaaataaaagttatttaaatataaatttttattgttctacaac 314689
Query: 74 taacaatagtagtggtaaaattgactatacaaagttaataccagagaatggaaatatttc 133 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314690 taacaatagtagtggtaaaattgactatacaaagttaataccagagaatggaaatatttc 314749
Query: 134 aaaatcaattacagaaaagattggtaagaatttacattgtaaaagagatcatccattgaa 193 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314750 aaaatcaattacagaaaagattggtaagaatttacattgtaaaagagatcatccattgaa 314809
Query: 194 tattataaagaaaaagattcaatatcattttcaaaataaattatcagatgaagaacataa 253 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314810 tattataaagaaaaagattcaatatcattttcaaaataaattatcagatgaagaacataa 314869
Query: 254 attccaattctttgattcatttgaaccaaaagtaagtgttaaagagaactttgatgaatt 313 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314870 attccaattctttgattcatttgaaccaaaagtaagtgttaaagagaactttgatgaatt 314929
Query: 314 attatttccagtggatcatgttggaagaagtccaaatgatacctactatttcagtaagga 373 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314930 attatttccagtggatcatgttggaagaagtccaaatgatacctactatttcagtaagga 314989
Query: 374 tcaattgttaagaactcatacaagtgcacatcaatctcaacttttacgtgagcaagaaaa 433 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314990 tcaattgttaagaactcatacaagtgcacatcaatctcaacttttacgtgagcaagaaaa 315049
Query: 434 agcattcttggtaacaggtgatgtctatcgt 464 ||||||||||||||||||||||||||||||| Sbjct: 315050 agcattcttggtaacaggtgatgtctatcgt 315080
Score = 369 bits (186), Expect(4) = 0.0 Identities = 186/186 (100%) Strand = Plus / Plus
Query: 703 aacattatctgatatagatattaaaggtgttcaatttcaacaatttagtaaatatccatc 762 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 315626 aacattatctgatatagatattaaaggtgttcaatttcaacaatttagtaaatatccatc 315685
Query: 763 atgctttaaagatgttagtttttggttagaagatgaagaaaactttcatgaaaataaatt 822 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 315686 atgctttaaagatgttagtttttggttagaagatgaagaaaactttcatgaaaataaatt 315745
Query: 823 ctatgaatttgttcgtgaatcatgtggtgatttagttgaaagagttgatttagttgataa 882 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 315746 ctatgaatttgttcgtgaatcatgtggtgatttagttgaaagagttgatttagttgataa 315805
Query: 883 ttttac 888 |||||| Sbjct: 315806 ttttac 315811
Score = 363 bits (183), Expect(4) = 0.0 Identities = 189/192 (98%) Strand = Plus / Plus
Query: 476 tgtggtgttgttcatcctncaatcatgaatnantgtggtttatcgaatgatagagcatgg 535 |||||||||||||||||| ||||||||||| | ||||||||||||||||||||||||||| Sbjct: 315399 tgtggtgttgttcatccttcaatcatgaataattgtggtttatcgaatgatagagcatgg 315458
Query: 536 gcctttggtattggtttagaaagattagcaatgatcctattcaatattcctgatattcgt 595 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 315459 gcctttggtattggtttagaaagattagcaatgatcctattcaatattcctgatattcgt 315518
Query: 596 ttattttggactgaagataatagatttcataatcaatttaaaggagttgataagtctatc 655 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 315519 ttattttggactgaagataatagatttcataatcaatttaaaggagttgataagtctatc 315578
Query: 656 agtacttcatct 667 |||||||||||| Sbjct: 315579 agtacttcatct 315590
Score = 276 bits (139), Expect(4) = 0.0 Identities = 139/139 (100%) Strand = Plus / Plus
Query: 909 cttctcattgctatagaatttattatcgttcaatggatagaaatttaacaaatgaagaga 968 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 315832 cttctcattgctatagaatttattatcgttcaatggatagaaatttaacaaatgaagaga 315891
Query: 969 ttgatattcttcaatttaatttacgtgaaaaattagaaaatcatttatctgttaaattaa 1028 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 315892 ttgatattcttcaatttaatttacgtgaaaaattagaaaatcatttatctgttaaattaa 315951
Query: 1029 gataaatcaattttaaatc 1047 ||||||||||||||||||| Sbjct: 315952 gataaatcaattttaaatc 315970
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,335,981,645 Number of extensions: 83567461 Number of successful extensions: 7203553 Number of sequences better than 10.0: 195 Length of query: 1083 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1059 Effective length of database: 97,308,875,965 Effective search space: 103050099646935 Effective search space used: 103050099646935 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 6.26 |
Homology vs Protein |
Query= Contig-U09604-1 (Contig-U09604-1Q) /CSM_Contig/Contig-U09604-1Q.Seq.d (1083 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
CP000582_327(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 179 2e-43 AF370247_1(AF370247|pid:none) Arabidopsis thaliana putative phen... 174 6e-42 AP008218_1017(AP008218|pid:none) Oryza sativa (japonica cultivar... 173 1e-41 CP001329_160(CP001329|pid:none) Micromonas sp. RCC299 chromosome... 170 9e-41 EU965346_1(EU965346|pid:none) Zea mays clone 285468 ATP binding ... 169 2e-40 CS560074_1(CS560074|pid:none) Sequence 661 from Patent WO2006032... 169 2e-40 EF677046_1(EF677046|pid:none) Picea sitchensis clone WS02760_M15... 169 2e-40 BT055781_1(BT055781|pid:none) Zea mays full-length cDNA clone ZM... 166 1e-39 CR954202_274(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 164 4e-39 BC153383_1(BC153383|pid:none) Danio rerio zgc:173439, mRNA (cDNA... 158 4e-37 CU638743_792(CU638743|pid:none) Podospora anserina genomic DNA c... 154 4e-36 BT059542_1(BT059542|pid:none) Salmo salar clone ssal-rgf-512-008... 153 9e-36 (Q99M01) RecName: Full=Phenylalanyl-tRNA synthetase, mitochondri... 153 1e-35 FN392319_1352(FN392319|pid:none) Pichia pastoris GS115 chromosom... 152 2e-35 (Q6AYQ3) RecName: Full=Phenylalanyl-tRNA synthetase, mitochondri... 152 2e-35 BC123887_1(BC123887|pid:none) Bos taurus phenylalanyl-tRNA synth... 152 3e-35 AK223423_1(AK223423|pid:none) Homo sapiens mRNA for phenylalanin... 151 3e-35 AK312454_1(AK312454|pid:none) Homo sapiens cDNA, FLJ92809, highl... 151 3e-35 (O95363) RecName: Full=Phenylalanyl-tRNA synthetase, mitochondri... 151 3e-35 CR382122_499(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 151 4e-35 CU928169_626(CU928169|pid:none) Kluyveromyces thermotolerans str... 150 7e-35 CR380954_373(CR380954|pid:none) Candida glabrata strain CBS138 c... 150 1e-34 CR382136_913(CR382136|pid:none) Debaryomyces hansenii chromosome... 150 1e-34 AP007159_245(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 147 8e-34 AM428458_1(AM428458|pid:none) Vitis vinifera contig VV78X101107.... 147 8e-34 T49630(T49630)phenylalanyl-tRNA synthetase-related protein [impo... 145 2e-33 AM920427_742(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 144 4e-33 AE016817_96(AE016817|pid:none) Ashbya gossypii (= Eremothecium g... 144 7e-33 BT075794_1(BT075794|pid:none) Caligus rogercresseyi clone crog-e... 139 2e-31 AF265224_1(AF265224|pid:none) Aspergillus nidulans phenylalanyl-... 139 2e-31 AF012089_2(AF012089|pid:none) Drosophila melanogaster cysteine p... 128 4e-28 (O16129) RecName: Full=Probable phenylalanyl-tRNA synthetase, mi... 128 4e-28 AF161438_1(AF161438|pid:none) Homo sapiens HSPC320 mRNA, partial... 127 7e-28 AB096637_1(AB096637|pid:none) Caenorhabditis elegans frs-2 mRNA ... 125 2e-27 AL844505_36(AL844505|pid:none) Plasmodium falciparum 3D7 chromos... 114 6e-24 FN318663_1(FN318663|pid:none) Schistosoma japonicum isolate Anhu... 113 1e-23 FN314327_1(FN314327|pid:none) Schistosoma japonicum isolate Anhu... 113 1e-23 BT061569_1(BT061569|pid:none) Zea mays full-length cDNA clone ZM... 112 2e-23 FN357420_42(FN357420|pid:none) Schistosoma mansoni genome sequen... 111 4e-23 AM452224_1(AM452224|pid:none) Vitis vinifera contig VV79X002984.... 103 8e-21 AK054370_1(AK054370|pid:none) Mus musculus 2 days pregnant adult... 102 2e-20 CR940348_793(CR940348|pid:none) Theileria annulata strain Ankara... 90 2e-16 AM437767_1(AM437767|pid:none) Vitis vinifera contig VV78X201665.... 89 2e-16 BX901896_3(BX901896|pid:none) Zebrafish DNA sequence from clone ... 85 4e-15 BC006136_1(BC006136|pid:none) Homo sapiens ferredoxin-fold antic... 81 7e-14 (Q9BRP7) RecName: Full=Ferredoxin-fold anticodon-binding domain-... 81 7e-14 AK135025_1(AK135025|pid:none) Mus musculus adult male olfactory ... 70 2e-10 (O67087) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 63 2e-08 (A1U2B9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 61 6e-08 (A6GVW9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 60 1e-07 CP001229_457(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 60 1e-07 (Q82VV5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 60 1e-07 (A9NEU5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 60 2e-07 CP000238_427(CP000238|pid:none) Baumannia cicadellinicola str. H... 59 2e-07 CP000323_2292(CP000323|pid:none) Psychrobacter cryohalolentis K5... 59 3e-07 CP000713_2296(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 59 3e-07 (Q4FQ65) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 59 3e-07 CP000450_2252(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 59 3e-07 AP009247_568(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 58 5e-07 (A5FLW1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 58 5e-07 CP001230_72(CP001230|pid:none) Persephonella marina EX-H1, compl... 58 5e-07 (Q2JXF6) RecName: Full=Phenylalanyl-tRNA synthetase beta chain; ... 58 5e-07 CP000513_1002(CP000513|pid:none) Dichelobacter nodosus VCS1703A,... 58 7e-07 (Q7VR67) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 57 1e-06 (A6LTR7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 57 1e-06 AM180355_718(AM180355|pid:none) Clostridium difficile 630 comple... 57 1e-06 (Q3JBZ8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 57 1e-06 (B2V6V0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 57 1e-06 CP001275_621(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 57 1e-06 (Q21KD6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 57 1e-06 CP000304_2311(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 56 2e-06 (A6VYH7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 56 2e-06 (Q8XJ75) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 56 2e-06 (B1M6P5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 56 2e-06 (B2TS55) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 56 2e-06 (Q3Z9I8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 56 2e-06 CP001172_2903(CP001172|pid:none) Acinetobacter baumannii AB307-0... 56 2e-06 (B0VV85) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 56 2e-06 CP000544_424(CP000544|pid:none) Halorhodospira halophila SL1, co... 56 2e-06 (B0V5Q6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 56 2e-06 AM778939_35(AM778939|pid:none) Microcystis aeruginosa PCC 7806 g... 55 3e-06 (A5FS95) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 55 3e-06 CP001339_1433(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 55 3e-06 (A4XTS5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 55 4e-06 (B2IGL6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 55 4e-06 AM295250_751(AM295250|pid:none) Staphylococcus carnosus subsp. c... 55 4e-06 (B3PL12) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 55 4e-06 AY659203_1(AY659203|pid:none) Synthetic construct Peudomonas aer... 55 4e-06 (Q8KAM6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 55 4e-06 (B5EN53) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 55 6e-06 (Q9A9E4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 55 6e-06 AF332624_5(AF332624|pid:none) Azotobacter vinelandii threonyl-tR... 55 6e-06 AJ841297_1(AJ841297|pid:none) Bacillus amyloliquefaciens pheS ge... 54 7e-06 (Q6F872) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 7e-06 (Q3KEX8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 7e-06 (A7H3F0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 7e-06 (Q4L5E3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 7e-06 (A1VZN1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 7e-06 (Q0VNG2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 7e-06 CP000924_758(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 54 7e-06 AM181176_4061(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 54 7e-06 (Q1IC11) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 9e-06 AE017332_105(AE017332|pid:none) Mycoplasma hyopneumoniae 232, co... 54 9e-06 (Q4KEW0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 9e-06 AE017243_267(AE017243|pid:none) Mycoplasma hyopneumoniae J, comp... 54 9e-06 (Q2RHN7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 9e-06 (Q7N3Q0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 9e-06 CP000767_550(CP000767|pid:none) Campylobacter curvus 525.92, com... 54 9e-06 CP001321_631(CP001321|pid:none) Haemophilus parasuis SH0165, com... 54 9e-06 (B2VEL4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 9e-06 (A6WMK4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 CP001083_3267(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 54 1e-05 (Q9K895) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (A8FG17) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (A7GHZ8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 CP000469_1849(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 54 1e-05 (Q7MK39) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (B1KRE3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 CP000446_1800(CP000446|pid:none) Shewanella sp. MR-4, complete g... 54 1e-05 (A5F1W4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 FM954972_1668(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 54 1e-05 (A6QG39) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (Q12NU0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 CR954246_1860(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 54 1e-05 (B5FDX4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 AM285305_115(AM285305|pid:none) Spiroplasma citri GII3-3X chromo... 54 1e-05 CP000563_1842(CP000563|pid:none) Shewanella baltica OS155, compl... 54 1e-05 CP001130_1037(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 54 1e-05 CP000851_2461(CP000851|pid:none) Shewanella pealeana ATCC 700345... 54 1e-05 CP000606_2209(CP000606|pid:none) Shewanella loihica PV-4, comple... 54 1e-05 (Q2YX87) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (Q7NGP0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (B1L0T0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (A5IS24) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (A7MVJ5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (A4SMA8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (Q083K7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 CP000891_1896(CP000891|pid:none) Shewanella baltica OS195, compl... 54 1e-05 CP000792_542(CP000792|pid:none) Campylobacter concisus 13826, co... 54 1e-05 (B6EN08) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (A8FWI2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 54 1e-05 (Q1C733) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (P57229) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 CR378670_38(CR378670|pid:none) Photobacterium profundum SS9; seg... 53 2e-05 CP000776_452(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 53 2e-05 (P59056) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q8CSY9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q6LQ72) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 FP236842_1924(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 53 2e-05 (A6TAI3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q1QWK3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q3BRU1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 AP006725_2976(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 53 2e-05 (Q2P0Z9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q8PJE4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (A4W9M7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 CP001252_2369(CP001252|pid:none) Shewanella baltica OS223, compl... 53 2e-05 (Q5F9U0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q1MRV5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q02NN7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 X53057_1(X53057|pid:none) B. subtilis pheS and pheT genes for ph... 53 2e-05 (P17921) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 AE014075_2048(AE014075|pid:none) Escherichia coli CFT073, comple... 53 2e-05 (Q5QXL7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (B4SQH0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q9I0A3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q9JR76) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (B4T4N2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (B4ETL0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q2YBS2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (A9N238) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 CP000880_1570(CP000880|pid:none) Salmonella enterica subsp. ariz... 53 2e-05 (A7ZMI2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 AF542173_1(AF542173|pid:none) Neisseria elongata phenylalanyl-tR... 53 2e-05 CP000510_1349(CP000510|pid:none) Psychromonas ingrahamii 37, com... 53 2e-05 (A6TNP8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 AM421808_641(AM421808|pid:none) Neisseria meningitidis serogroup... 53 2e-05 V00291_5(V00291|pid:none) E.coli thrS, infC, rplT, pheS, pheT an... 53 2e-05 (B1LE16) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 53 2e-05 (Q5WEJ5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 CP000908_1599(CP000908|pid:none) Methylobacterium extorquens PA1... 52 3e-05 (B8E0D9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (B0U5D9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (A3DBX6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (Q31F18) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (B2I9P4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (A8EZ06) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 CP001600_1804(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 52 3e-05 (B0BUG7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (Q47ZS4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 AL445564_67(AL445564|pid:none) Mycoplasma pulmonis (strain UAB C... 52 3e-05 CP001298_1804(CP001298|pid:none) Methylobacterium chloromethanic... 52 3e-05 CP001029_1575(CP001029|pid:none) Methylobacterium populi BJ001, ... 52 3e-05 (A3MZX4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (B2SZF8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 (Q9PFD7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 3e-05 CP000932_1148(CP000932|pid:none) Campylobacter lari RM2100, comp... 52 3e-05 (Q4QKM4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (A6VP83) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (Q7NCQ2) RecName: Full=Phenylalanyl-tRNA synthetase beta chain; ... 52 4e-05 (Q0I3K7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (A2SH03) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (B0UU57) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (A7GTL0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (P43819) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 CP000361_1986(CP000361|pid:none) Arcobacter butzleri RM4018, com... 52 4e-05 (A9VJM4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 CP000485_3930(CP000485|pid:none) Bacillus thuringiensis str. Al ... 52 4e-05 (A4IXV3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (Q3ABT4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 4e-05 (B0U0C4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 5e-05 (A5N254) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 5e-05 (Q5P7X9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 5e-05 AP009049_2830(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 52 5e-05 (Q3APW3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 5e-05 CP001154_2738(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 52 5e-05 (Q65TL2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 52 5e-05 (P59504) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 6e-05 AE017308_317(AE017308|pid:none) Mycoplasma mobile 163K complete ... 51 6e-05 CP001615_637(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 51 6e-05 AM946015_665(AM946015|pid:none) Streptococcus uberis 0140J compl... 51 6e-05 (B1I4I5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 6e-05 (Q7NYC2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 6e-05 U01668_1(U01668|pid:none) Phagemid cloning vector pKSS, complete... 51 6e-05 CP000781_1917(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 51 6e-05 (A1K4E5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 6e-05 (Q5LZ70) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 6e-05 CP000378_990(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 51 8e-05 (B4RS43) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 8e-05 (B4SB89) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 8e-05 CP000868_1768(CP000868|pid:none) Burkholderia multivorans ATCC 1... 51 8e-05 CP000526_1506(CP000526|pid:none) Burkholderia mallei SAVP1 chrom... 51 8e-05 CP000628_335(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 51 8e-05 (Q8CWX1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 8e-05 AB2608(AB2608) phenylalanyl-tRNA synthetase, alpha-subunit pheS ... 51 8e-05 CP001503_2043(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 51 8e-05 (Q47CM8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 8e-05 (A3NUI8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 51 8e-05 (Q0KBY9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 (B3R4J5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 (A0Q6A6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 (B3EEB7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 CP000487_1200(CP000487|pid:none) Campylobacter fetus subsp. fetu... 50 1e-04 (Q1LP76) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 CP001147_1363(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 50 1e-04 FM204883_883(FM204883|pid:none) Streptococcus equi subsp. equi 4... 50 1e-04 (Q03K19) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 CP000237_208(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 50 1e-04 (Q8Y7Q2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 (B3EKG5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 CP001175_1410(CP001175|pid:none) Listeria monocytogenes HCC23, c... 50 1e-04 CP000725_836(CP000725|pid:none) Streptococcus gordonii str. Chal... 50 1e-04 CP000053_647(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 50 1e-04 CU695239_459(CU695239|pid:none) Ralstonia solanacearum strain Mo... 50 1e-04 CU914168_1143(CU914168|pid:none) Ralstonia solanacearum strain I... 50 1e-04 CP001344_195(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 50 1e-04 CP000683_428(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 50 1e-04 (Q92I39) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 CP000387_866(CP000387|pid:none) Streptococcus sanguinis SK36, co... 50 1e-04 (A8GS12) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 (Q4ULS5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 (B3ERN3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 (Q8XZ25) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 1e-04 AP008955_1640(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 50 1e-04 (Q2KDK0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 (A5IAL3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 (A6UF74) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 (Q6YPX9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 (Q8E5U3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 CP000568_214(CP000568|pid:none) Clostridium thermocellum ATCC 27... 50 2e-04 (Q92ST0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 (B3Q5X1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 AF496405_1(AF496405|pid:none) Lactobacillus delbrueckii subsp. l... 50 2e-04 (Q3K1I9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 (B3PYE2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 50 2e-04 CP001010_856(CP001010|pid:none) Polynucleobacter necessarius sub... 50 2e-04 CP000412_1200(CP000412|pid:none) Lactobacillus delbrueckii subsp... 50 2e-04 (Q1XDE1) RecName: Full=Phenylalanyl-tRNA synthetase beta chain, ... 50 2e-04 (Q72M80) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (A9H167) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (A8YWB7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (Q0C530) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (Q5WT86) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (Q6G5E3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 CP001189_3021(CP001189|pid:none) Gluconacetobacter diazotrophicu... 49 2e-04 (Q8R9C6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 EU277853_1(EU277853|pid:none) Cloning vector pUC57-Bt-pheS, comp... 49 2e-04 CP001047_132(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, ... 49 2e-04 (Q04P74) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (Q5X1H7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (A5D0U1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 2e-04 (B1XYZ7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 (A8Z6A5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 CP000661_2465(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 49 3e-04 AM494475_1141(AM494475|pid:none) Orientia tsutsugamushi Boryong ... 49 3e-04 (Q89WI1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 CP001359_1971(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 49 3e-04 CP001131_1891(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 49 3e-04 (Q13ET5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 (A8ZZ70) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 (Q67QF3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 (A3PGQ9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 CP000552_1430(CP000552|pid:none) Prochlorococcus marinus str. MI... 49 3e-04 CP001150_63(CP001150|pid:none) Rhodobacter sphaeroides KD131 chr... 49 3e-04 (Q836J6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 3e-04 (Q6ANC1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (A4SCK0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (Q038C7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (A8GND9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (Q5FUA1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (B3WF19) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (Q1J1V8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (Q041W8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (Q67QF2) RecName: Full=Phenylalanyl-tRNA synthetase beta chain; ... 49 4e-04 (Q1QS22) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 AP008231_2029(AP008231|pid:none) Synechococcus elongatus PCC 630... 49 4e-04 (Q74IE1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (A6WX16) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 49 4e-04 (Q72HA1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 5e-04 (Q9ZDB5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 5e-04 (P27001) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 5e-04 CP000435_771(CP000435|pid:none) Synechococcus sp. CC9311, comple... 48 5e-04 (B2RLI5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 5e-04 (Q16BG6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 5e-04 (A4J4Z4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 5e-04 (B8DPM8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 5e-04 CP000478_425(CP000478|pid:none) Syntrophobacter fumaroxidans MPO... 48 5e-04 CP001279_868(CP001279|pid:none) Nautilia profundicola AmH, compl... 48 5e-04 (B1IAA1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 7e-04 CP001015_521(CP001015|pid:none) Streptococcus pneumoniae G54, co... 48 7e-04 (A5US42) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 7e-04 (A1BJB6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 7e-04 (Q319M1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 7e-04 CP000551_1465(CP000551|pid:none) Prochlorococcus marinus str. AS... 48 7e-04 CP000921_570(CP000921|pid:none) Streptococcus pneumoniae Taiwan1... 48 7e-04 AE007317_507(AE007317|pid:none) Streptococcus pneumoniae R6, com... 48 7e-04 CP000919_504(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 48 7e-04 CP000422_671(CP000422|pid:none) Pediococcus pentosaceus ATCC 257... 48 7e-04 CP001087_453(CP001087|pid:none) Desulfobacterium autotrophicum H... 48 7e-04 CP001390_3326(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 48 7e-04 (A1UUA8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 7e-04 CP000576_1456(CP000576|pid:none) Prochlorococcus marinus str. MI... 48 7e-04 (Q7V0I7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 7e-04 (A5VKV1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 48 7e-04 BA000034_1348(BA000034|pid:none) Streptococcus pyogenes SSI-1 DN... 47 9e-04 CP001391_101(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 47 9e-04 CP001358_478(CP001358|pid:none) Desulfovibrio desulfuricans subs... 47 9e-04 (Q7VK64) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 9e-04 AM295007_1201(AM295007|pid:none) Streptococcus pyogenes Manfredo... 47 9e-04 (Q21C64) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 9e-04 CP000260_642(CP000260|pid:none) Streptococcus pyogenes MGAS10270... 47 9e-04 CP000924_757(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 47 9e-04 (Q7W7C7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 9e-04 AE009949_651(AE009949|pid:none) Streptococcus pyogenes MGAS8232,... 47 9e-04 (Q9PL83) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (B4R9C6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (A5E8L7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (Q3B6M2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (Q8EPH4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (Q255M0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 AJ937767_5(AJ937767|pid:none) Uncultured delta proteobacterium f... 47 0.001 FM242711_1203(FM242711|pid:none) Listeria monocytogenes Clip8145... 47 0.001 CU469464_80(CU469464|pid:none) Candidatus Phytoplasma mali strai... 47 0.001 CP000384_2959(CP000384|pid:none) Mycobacterium sp. MCS, complete... 47 0.001 (Q3KKK3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (A4YJN0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (O84843) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (Q5KWE4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.001 (Q0AY00) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (Q740J1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (Q7M8Y9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (A6LA92) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 AJ937535_1(AJ937535|pid:none) Guillardia theta partial mRNA for ... 47 0.002 (A0QHB6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (Q11KJ9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (A1TR35) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (Q822B5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (B1VA93) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (A1TAB5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 47 0.002 (Q251I2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.002 (Q7TV42) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.002 CP000554_1920(CP000554|pid:none) Prochlorococcus marinus str. MI... 46 0.002 (Q5L5A8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.002 CP000097_1482(CP000097|pid:none) Synechococcus sp. CC9902, compl... 46 0.002 CP001336_217(CP001336|pid:none) Desulfitobacterium hafniense DCB... 46 0.002 AM884176_208(AM884176|pid:none) Chlamydia trachomatis strain L2/... 46 0.002 (Q7TTU6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.002 CP001291_4641(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 46 0.002 (Q1WTY9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.002 AF136400_5(AF136400|pid:none) Pseudomonas fluorescens threonyl-t... 46 0.002 (Q2LR28) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.002 CP001140_234(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 46 0.003 CT978603_1741(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 46 0.003 (Q04FD8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.003 CP000923_1998(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 46 0.003 (B0TEV9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.003 (Q73IM5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 46 0.003 CP000878_1315(CP000878|pid:none) Prochlorococcus marinus str. MI... 45 0.003 (Q6MMJ2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.003 CP001337_3064(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 45 0.003 (B5EBY3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.003 (Q7VAV9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.003 (A0T0H4) RecName: Full=Phenylalanyl-tRNA synthetase beta chain, ... 45 0.003 CP000909_378(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 45 0.003 (Q5PBV2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.004 CP000463_494(CP000463|pid:none) Rhodopseudomonas palustris BisA5... 45 0.004 CP000828_1312(CP000828|pid:none) Acaryochloris marina MBIC11017,... 45 0.004 (Q11Q26) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.004 (A1KJ66) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.004 (P51346) RecName: Full=Phenylalanyl-tRNA synthetase beta chain, ... 45 0.004 CP001079_36(CP001079|pid:none) Anaplasma marginale str. Florida,... 45 0.004 (A5U306) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.004 (A1B4B8) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.004 AE017245_299(AE017245|pid:none) Mycoplasma synoviae 53, complete... 45 0.004 CP000815_120(CP000815|pid:none) Paulinella chromatophora chromat... 45 0.004 (B6YQ38) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.006 (Q8YMT4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.006 (A8LLH4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 45 0.006 (Q7VBX6) RecName: Full=Phenylalanyl-tRNA synthetase beta chain; ... 45 0.006 CP000951_437(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 45 0.006 CP000480_3649(CP000480|pid:none) Mycobacterium smegmatis str. MC... 44 0.007 CP001145_584(CP001145|pid:none) Coprothermobacter proteolyticus ... 44 0.007 (Q3MB99) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (Q1CSL6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (Q9Z6R6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (B6JMP1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (Q6MT17) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (P56146) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (Q55187) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (A0LFC6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (Q17YI4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 AP008937_1289(AP008937|pid:none) Lactobacillus fermentum IFO 395... 44 0.007 (B5Z848) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 AP009552_3210(AP009552|pid:none) Microcystis aeruginosa NIES-843... 44 0.007 (Q28V93) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (A5G4T3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.007 (B2IUA1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.010 CP000393_3042(CP000393|pid:none) Trichodesmium erythraeum IMS101... 44 0.010 (Q3YSX1) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.010 (Q30S84) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.010 (A9BFH2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.013 AP008955_1641(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 44 0.013 CP000552_951(CP000552|pid:none) Prochlorococcus marinus str. MIT... 44 0.013 CP000553_1682(CP000553|pid:none) Prochlorococcus marinus str. NA... 44 0.013 (Q5FH45) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.013 (Q39VS5) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.013 (Q2SSA0) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.013 CP000509_2419(CP000509|pid:none) Nocardioides sp. JS614, complet... 44 0.013 (Q828C7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.013 (Q3A4N9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 44 0.013 (B3E1T9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 43 0.017 (B1LCK9) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 43 0.017 (A3MUA4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 43 0.017 CP001291_4550(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 43 0.017 (A5IIW2) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 43 0.017 CU466930_511(CU466930|pid:none) Candidatus Cloacamonas acidamino... 43 0.022 (Q7V1J8) RecName: Full=Phenylalanyl-tRNA synthetase beta chain; ... 42 0.028 (A6L2I3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 42 0.028 AM778953_109(AM778953|pid:none) Microcystis aeruginosa PCC 7806 ... 42 0.028 CP000716_1024(CP000716|pid:none) Thermosipho melanesiensis BI429... 42 0.037 (A7HLU6) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 42 0.037 AJ862840_9(AJ862840|pid:none) Streptomyces griseus subsp. griseu... 42 0.037 (Q8R9C7) RecName: Full=Phenylalanyl-tRNA synthetase beta chain; ... 42 0.037 (Q5LAS4) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 42 0.037 CP000853_1939(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 42 0.048 CP000356_2761(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 42 0.048 CP000825_1019(CP000825|pid:none) Prochlorococcus marinus str. MI... 42 0.048 CP000916_1755(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 42 0.048 (Q8ZX61) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 42 0.048 CP000576_990(CP000576|pid:none) Prochlorococcus marinus str. MIT... 41 0.063 (B1AJ99) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 41 0.082 CU179680_68(CU179680|pid:none) Mycoplasma agalactiae PG2 chromos... 41 0.082 (Q47N75) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 41 0.082 CP001359_3551(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 41 0.082 CP001131_3484(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 41 0.082 CP000767_551(CP000767|pid:none) Campylobacter curvus 525.92, com... 40 0.11 CP000551_988(CP000551|pid:none) Prochlorococcus marinus str. AS9... 40 0.11 CP001014_573(CP001014|pid:none) Thermoproteus neutrophilus V24St... 40 0.11 CP000575_256(CP000575|pid:none) Staphylothermus marinus F1, comp... 40 0.11 AP008971_867(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 40 0.11 CP000504_1532(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 40 0.11 CP000394_1505(CP000394|pid:none) Granulibacter bethesdensis CGDN... 40 0.11 CU458896_2312(CU458896|pid:none) Mycobacterium abscessus chromos... 40 0.14 CP001400_1873(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 40 0.14 (Q30S83) RecName: Full=Phenylalanyl-tRNA synthetase beta chain; ... 40 0.14 CP001401_1940(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 40 0.14 CP000251_3421(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 40 0.14 (B5ZBV3) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 40 0.18 EF203478_1(EF203478|pid:none) Pasteuria ramosa isolate P1 PheS (... 39 0.24 CP000481_1261(CP000481|pid:none) Acidothermus cellulolyticus 11B... 39 0.24 AY312991_22(AY312991|pid:none) Alvinella pompejana epibiont 7G3 ... 39 0.24 S77852(S77852) probable phenylalanine-tRNA ligase (EC 6.1.1.20) ... 39 0.24 (Q6F165) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 39 0.24 AE014186_197(AE014186|pid:none) Plasmodium falciparum 3D7 chromo... 39 0.31 CP000479_3000(CP000479|pid:none) Mycobacterium avium 104, comple... 39 0.31 CP000750_3136(CP000750|pid:none) Kineococcus radiotolerans SRS30... 39 0.41 CP000885_3436(CP000885|pid:none) Clostridium phytofermentans ISD... 39 0.41 CP000667_1863(CP000667|pid:none) Salinispora tropica CNB-440, co... 39 0.41 CP001230_71(CP001230|pid:none) Persephonella marina EX-H1, compl... 39 0.41 (Q8G5E7) RecName: Full=Phenylalanyl-tRNA synthetase alpha chain;... 39 0.41
>CP000582_327(CP000582|pid:none) Ostreococcus lucimarinus CCE9901 chromosome 2, complete sequence. Length = 416
Score = 179 bits (453), Expect = 2e-43 Identities = 95/187 (50%), Positives = 119/187 (63%), Gaps = 2/187 (1%) Frame = +2
Query: 476 CGVVHPXIMNXCGLSNDRAWAFGIGLERLAMILFNIPDIRLFWTEDNRFHNQFK-GVDKX 652 CGV+ I+N L N+RAWAFG+GLERLAM+LF+IPDIRLFWT+D RF QFK G+ + Sbjct: 252 CGVMETKILNEASLVNERAWAFGLGLERLAMVLFDIPDIRLFWTDDARFLKQFKPGMFRS 311
Query: 653 XXXXXXXXXXXXXXXXXXXXDIDIKGVQ-FQQFSKYPSCFKDVSFWLEDEENFHENKFYE 829 G+Q F+ +SKYP C+KDVSFWL DE F EN E Sbjct: 312 GGV----------------------GMQKFKSYSKYPPCYKDVSFWLPDESTFTENNLCE 349
Query: 830 FVRESCGDLVERVDLVDNFTNKKLNKTSHCYRIYYRSMDRNLTNEEIDILQFNLREKLEN 1009 VR + GD+VE V L+D F N K +K S+C+RI YRSMDR+LT++EI+ LQ +RE L Sbjct: 350 IVRATAGDIVEEVKLIDEFRNPKTDKVSNCFRISYRSMDRSLTDDEINELQETVRESLVE 409
Query: 1010 HLSVKLR 1030 L V LR Sbjct: 410 KLGVTLR 416
Score = 118 bits (295), Expect = 4e-25 Identities = 61/117 (52%), Positives = 78/117 (66%) Frame = +3
Query: 114 PENGNISKSITEKIGKNLHCKRDHPLNIIKKKIQYHFQNKLSDEEHKFQFFDSFEPKVSV 293 P+N N+++ I EKIG +LH + +HPL I+K I +F ++ F+ FD P VS Sbjct: 51 PDN-NVTEYIFEKIGVDLHRRPEHPLGILKNAIMDYFDETYG--KNAFRMFDDLHPIVSS 107
Query: 294 KENFDELLFPVDHVGRSPNDTYYFSKDQLLRTHTSAHQSQLLREQEKAFLVTGDVYR 464 ENFD +L P DHV RS NDTYY + D +LR HTSAHQ LL++ EK FLVTGDVYR Sbjct: 108 YENFDSVLVPEDHVSRSKNDTYYVTADTVLRCHTSAHQLSLLKQGEKRFLVTGDVYR 164
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 1,328,306,022 Number of extensions: 23491038 Number of successful extensions: 62221 Number of sequences better than 10.0: 558 Number of HSP's gapped: 61805 Number of HSP's successfully gapped: 1000 Length of query: 361 Length of database: 1,040,966,779 Length adjustment: 130 Effective length of query: 231 Effective length of database: 624,409,729 Effective search space: 144238647399 Effective search space used: 144238647399 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
1 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
0 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |