| Homology vs DNA |
 Query= Contig-U09571-1 (Contig-U09571-1Q) /CSM_Contig/Contig-U09571-1Q.Seq.d
(1374 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ390568) Dictyostelium discoideum cDNA clone:dds22l21, 5' ... 1019 0.0 2
(BJ415683) Dictyostelium discoideum cDNA clone:ddv23i12, 5' ... 955 0.0 2
(BJ430110) Dictyostelium discoideum cDNA clone:ddv6j03, 3' e... 670 0.0 2
(BJ346164) Dictyostelium discoideum cDNA clone:dda30f02, 3' ... 670 0.0 2
(BJ401327) Dictyostelium discoideum cDNA clone:dds22l21, 3' ... 646 0.0 2
(BJ433928) Dictyostelium discoideum cDNA clone:ddv23i12, 3' ... 670 0.0 2
(BJ329880) Dictyostelium discoideum cDNA clone:dda26j13, 5' ... 783 0.0 2
(AU037202) Dictyostelium discoideum slug cDNA, clone SSB605. 571 e-158 1
(BJ429452) Dictyostelium discoideum cDNA clone:ddv3d15, 3' e... 311 e-137 2
(AM805616) Nicotiana tabacum EST, clone nt005001007. 44 8e-07 4
(ET877541) CHO_OF095xm18r1.ab1 CHO_OF Nicotiana tabacum geno... 56 0.004 1
(ET877477) CHO_OF095xm18f1.ab1 CHO_OF Nicotiana tabacum geno... 56 0.004 1
(BJ411865) Dictyostelium discoideum cDNA clone:ddv6j03, 5' e... 56 0.004 1
(DU099208) JBnY032G17F Brassica napus BAC library JBnY Brass... 50 0.23 1
(CE759264) tigr-gss-dog-17000369698402 Dog Library Canis lup... 50 0.23 1
(EH665394) 21G05 Transformed tobacco Lambda Zap II library N... 50 0.23 1
(CJ357459) Molgula tectiformis cDNA, cleaving embryo clone:m... 40 0.24 2
(AC220282) Bos taurus clone CH240-368G3, WORKING DRAFT SEQUE... 40 0.39 7
(AC064864) Homo sapiens BAC clone RP11-407M6 from 2, complet... 38 0.56 6
(AL844506) Plasmodium falciparum chromosome 7. 36 0.59 15
(CP001056) Clostridium botulinum B str. Eklund 17B, complete... 40 0.60 20
(CP000727) Clostridium botulinum A str. Hall, complete genome. 38 0.62 17
(AQ601035) HS_5375_B2_A03_T7A RPCI-11 Human Male BAC Library... 34 0.65 2
(CP000726) Clostridium botulinum A str. ATCC 19397, complete... 38 0.82 17
(CP000716) Thermosipho melanesiensis BI429, complete genome. 42 0.87 21
(AC136124) Rattus norvegicus clone CH230-257B2, WORKING DRAF... 48 0.89 1
(AC134702) Rattus norvegicus clone CH230-174M10, WORKING DRA... 48 0.89 1
(AC126971) Rattus norvegicus clone CH230-17G21, WORKING DRAF... 48 0.89 1
(AC106687) Rattus norvegicus clone CH230-61E13, WORKING DRAF... 48 0.89 1
(AC105681) Rattus norvegicus clone CH230-268I12, *** SEQUENC... 48 0.89 1
(AC220367) Bos taurus clone CH240-360O2, WORKING DRAFT SEQUE... 48 0.89 1
(BH149645) ENTQA72TR Entamoeba histolytica Sheared DNA Entam... 48 0.89 1
(DV794485) Hw_loin_7_050812_H05 Bos taurus CF-24-HW loin cDN... 48 0.89 1
(AJ672839) Bos taurus EST, clone KN224-010_F13. 48 0.89 1
(BB977839) Plasmodium berghei strain ANKA cDNA clone:OK00783... 48 0.89 1
(FC293363) CAGN7062.rev CAGN Nematostella vectensis Nemve mi... 48 0.89 1
(BH985107) oei04h03.g1 B.oleracea002 Brassica oleracea genom... 42 0.93 2
(AC149591) Mus musculus BAC clone RP23-332I9 from 18, comple... 40 1.2 7
(AX345794) Sequence 865 from Patent WO0200928. 40 1.3 4
(CZ031928) OM__Ba0008F07.r OM__Ba Oryza minuta genomic clone... 34 1.4 3
(CZ123671) OA_BBa0012B21.f OA_BBa Oryza alta genomic clone O... 34 1.4 3
(AR925831) Sequence 396 from patent US 7091315. 40 1.8 4
(AE017308) Mycoplasma mobile 163K complete genome. 34 1.9 17
(BX296552) Zebrafish DNA sequence from clone CH211-247P22. 36 2.0 9
(CP000825) Prochlorococcus marinus str. MIT 9215, complete g... 36 2.0 17
(AF063866) Melanoplus sanguinipes entomopoxvirus, complete g... 38 2.5 11
(AC169664) Bos taurus clone CH240-208N7, WORKING DRAFT SEQUE... 36 2.6 7
(AC116960) Dictyostelium discoideum chromosome 2 map complem... 34 3.1 11
(CS468878) Sequence 69 from Patent EP1748080. 36 3.1 12
(CS468877) Sequence 68 from Patent EP1748080. 36 3.1 12
(CS419355) Sequence 69 from Patent WO2006094836. 36 3.1 12
(CS419354) Sequence 68 from Patent WO2006094836. 36 3.1 12
(BN000945) TPA: Homo sapiens IL2RA gene for interleukin 2 re... 46 3.5 1
(BV431548) S237P6296RH4.T0 PortugueseWaterDog Canis familiar... 46 3.5 1
(AC140073) Mus musculus BAC clone RP23-282N20 from chromosom... 46 3.5 1
(AC132419) Mus musculus BAC clone RP23-252B17 from chromosom... 46 3.5 1
(AC122252) Mus musculus BAC clone RP23-170E7 from chromosome... 46 3.5 1
(AC109138) Mus musculus chromosome 19, clone RP23-41B18, com... 46 3.5 1
(BS000535) Pan troglodytes chromosome Y clone:PTB-096E06, co... 46 3.5 1
(AC146218) Pan troglodytes BAC clone CH251-267E2 from Y, com... 46 3.5 1
(AM480710) Vitis vinifera contig VV78X254681.3, whole genome... 46 3.5 1
(DD159039) NOVEL COMPOSITIONS AND METHODS FOR CANCER. 46 3.5 1
(CS788804) Sequence 60 from Patent WO2005031001. 46 3.5 1
(AX695497) Sequence 1124 from Patent WO03008583. 46 3.5 1
(AC115612) Dictyostelium discoideum chromosome 2 map 6245135... 46 3.5 1
(AL157395) Human DNA sequence from clone RP11-414H17 on chro... 46 3.5 1
(AL035691) Human DNA sequence from clone RP1-249F5 on chromo... 46 3.5 1
(AC162155) Rhinolophus ferrumequinum clone VMRC7-270A17, WOR... 46 3.5 1
(AC156731) Bos taurus clone CH240-39O24, WORKING DRAFT SEQUE... 46 3.5 1
(AC156265) Takifugu rubripes, *** SEQUENCING IN PROGRESS ***... 46 3.5 1
(AC135217) Pan troglodytes clone RP43-141G8, WORKING DRAFT S... 46 3.5 1
(AC119541) Rattus norvegicus clone CH230-155L22, *** SEQUENC... 46 3.5 1
(AC103498) Rattus norvegicus clone CH230-31P10, *** SEQUENCI... 46 3.5 1
(CT797468) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.5 1
(AC230902) Bos taurus clone CH240-496K21, WORKING DRAFT SEQU... 46 3.5 1
(AC164192) Bos taurus clone CH240-150N8, *** SEQUENCING IN P... 46 3.5 1
(AZ610264) 1M0435O23F Mouse 10kb plasmid UUGC1M library Mus ... 46 3.5 1
(EJ669174) 1092955052049 Global-Ocean-Sampling_GS-30-02-01-1... 46 3.5 1
(ED044402) AUAC-aau16f12.b1 Ascaris suum whole genome shotgu... 46 3.5 1
(DH783418) Rattus norvegicus DNA, BAC clone: RNB1-372J05, 3'... 46 3.5 1
(CT545009) A BAC library has been constructed from cultivar ... 46 3.5 1
(BZ480189) BONQI08TR BO_1.6_2_KB_tot Brassica oleracea genom... 46 3.5 1
(AG124659) Pan troglodytes DNA, clone: PTB-134K22.F. 46 3.5 1
(ES638029) NVPCU54TR NVPA Nasonia vitripennis cDNA, mRNA seq... 46 3.5 1
(ES614728) NGPAG72TR NGPA Nasonia giraulti cDNA, mRNA sequence. 46 3.5 1
(DV392085) NADB895TF Aedes aegypti infected with Dengue viru... 46 3.5 1
(DV383806) NADAY77TR Aedes aegypti infected with Dengue viru... 46 3.5 1
(DV383804) NADAY77TF Aedes aegypti infected with Dengue viru... 46 3.5 1
(DB948397) Manihot esculenta mRNA, clone: CAS01_030_P14, 3'end. 46 3.5 1
(CO562749) AGENCOURT_28541563 NIH_MGC_249 Rattus norvegicus ... 46 3.5 1
(FF381093) CASLH46TF CASL Manihot esculenta cDNA 5', mRNA se... 46 3.5 1
(AP002981) Homo sapiens genomic DNA, chromosome 8q23, clone:... 44 3.6 6
(EJ305000) 1095390072565 Global-Ocean-Sampling_GS-27-01-01-1... 44 3.8 2
(AC229762) Oryza minuta clone OM__Ba0149B10, complete sequence. 36 4.2 6
(AC139561) Homo sapiens chromosome 8 clone RP13-139C5 map 8,... 40 4.5 2
(BX005018) Zebrafish DNA sequence from clone DKEY-209K18. 38 5.2 5
(DD010736) Diagnosis of known genetic Parameters within the ... 34 5.2 2
(CR511434) mth4-28M5FM3 BAC end, cultivar Jemalong A17 of Me... 34 5.5 2
(CG750615) P045-1-F07.za Ppa EcoRI BAC Library Pristionchus ... 44 5.9 2
(AX346773) Sequence 1844 from Patent WO0200928. 42 5.9 3
>(BJ390568) Dictyostelium discoideum cDNA clone:dds22l21, 5' end,
single read.
Length = 623
Score = 1019 bits (514), Expect(2) = 0.0
Identities = 514/514 (100%)
Strand = Plus / Plus
Query: 270 ttatgacattagtatcaaatattgttggtattgttgtaccagttgttattgcgctgataa 329
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 110 ttatgacattagtatcaaatattgttggtattgttgtaccagttgttattgcgctgataa 169
Query: 330 tacttataattttacttaaaaagagtttattaatattaaaagaaagagaaatcattatac 389
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 170 tacttataattttacttaaaaagagtttattaatattaaaagaaagagaaatcattatac 229
Query: 390 tagaacgttttggacaatatcataatatattacatgctggtgtacattggacaattccat 449
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 230 tagaacgttttggacaatatcataatatattacatgctggtgtacattggacaattccat 289
Query: 450 gggttgatagaccaaaaacattttattattcatattacgttgatacaccaagtggtaaag 509
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 290 gggttgatagaccaaaaacattttattattcatattacgttgatacaccaagtggtaaag 349
Query: 510 agttaagagaaggtttaaatttaacaagaatttcaactcaaaatgaagttttagatttac 569
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 350 agttaagagaaggtttaaatttaacaagaatttcaactcaaaatgaagttttagatttac 409
Query: 570 caaaacaaactgttattacaagagattgtgcatcagttgatttagatgcagttttatcat 629
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 410 caaaacaaactgttattacaagagattgtgcatcagttgatttagatgcagttttatcat 469
Query: 630 ataaaattacaaatccaaaacaaatgatttatagttgtgtaaatttaccaaatatccttt 689
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 470 ataaaattacaaatccaaaacaaatgatttatagttgtgtaaatttaccaaatatccttt 529
Query: 690 caaaactattacaagctcaattaagaaatttagcaggtacattagagattgatcaaatca 749
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 530 caaaactattacaagctcaattaagaaatttagcaggtacattagagattgatcaaatca 589
Query: 750 ttgaagaatcacacctattaaatgctctcactgg 783
||||||||||||||||||||||||||||||||||
Sbjct: 590 ttgaagaatcacacctattaaatgctctcactgg 623
Score = 147 bits (74), Expect(2) = 0.0
Identities = 74/74 (100%)
Strand = Plus / Plus
Query: 188 gttacattcctccctcctccttcctcttcccaatccaacctattcacatacctatacaca 247
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 28 gttacattcctccctcctccttcctcttcccaatccaacctattcacatacctatacaca 87
Query: 248 tattttttatatat 261
||||||||||||||
Sbjct: 88 tattttttatatat 101
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,438,174,985
Number of extensions: 92012015
Number of successful extensions: 8047505
Number of sequences better than 10.0: 120
Length of query: 1374
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1350
Effective length of database: 97,308,875,965
Effective search space: 131366982552750
Effective search space used: 131366982552750
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U09571-1 (Contig-U09571-1Q) /CSM_Contig/Contig-U09571-1Q.Seq.d
(1374 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CP001055_350(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 149 2e-34
AE015924_1144(AE015924|pid:none) Porphyromonas gingivalis W83, c... 147 9e-34
CU466930_1580(CU466930|pid:none) Candidatus Cloacamonas acidamin... 140 1e-31
CP000969_61(CP000969|pid:none) Thermotoga sp. RQ2, complete geno... 119 3e-25
CP000702_61(CP000702|pid:none) Thermotoga petrophila RKU-1, comp... 117 1e-24
CP000916_1709(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 117 1e-24
(O26788) RecName: Full=Uncharacterized protein MTH_692; &AE0006... 112 2e-23
AE016827_834(AE016827|pid:none) Mannheimia succiniciproducens MB... 110 9e-23
CP001185_1641(CP001185|pid:none) Thermosipho africanus TCF52B, c... 109 3e-22
BX950851_1182(BX950851|pid:none) Erwinia carotovora subsp. atros... 109 3e-22
CP001618_2298(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 109 3e-22
CU468135_2452(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 108 6e-22
CP000716_1297(CP000716|pid:none) Thermosipho melanesiensis BI429... 108 6e-22
AM942759_2148(AM942759|pid:none) Proteus mirabilis strain HI4320... 108 6e-22
FP236842_2561(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 107 8e-22
CP000771_711(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 107 1e-21
CP001321_1492(CP001321|pid:none) Haemophilus parasuis SH0165, co... 106 2e-21
CP001503_1238(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 105 3e-21
AP002527_90(AP002527|pid:none) Escherichia coli plasmid R721 gen... 105 3e-21
CP000653_959(CP000653|pid:none) Enterobacter sp. 638, complete g... 105 4e-21
CP001338_926(CP001338|pid:none) Candidatus Methanosphaerula palu... 105 4e-21
CP000243_515(CP000243|pid:none) Escherichia coli UTI89, complete... 105 5e-21
CP000826_1147(CP000826|pid:none) Serratia proteamaculans 568, co... 105 5e-21
(P0AA53) RecName: Full=Protein qmcA; &(P0AA54) RecName: Fu &(P0... 105 5e-21
CP000800_509(CP000800|pid:none) Escherichia coli E24377A, comple... 105 5e-21
CP000868_1269(CP000868|pid:none) Burkholderia multivorans ATCC 1... 104 6e-21
CP000570_2390(CP000570|pid:none) Burkholderia pseudomallei 668 c... 104 6e-21
AP009385_1936(AP009385|pid:none) Burkholderia multivorans ATCC 1... 104 6e-21
CP001074_3761(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 104 8e-21
AE014613_2206(AE014613|pid:none) Salmonella enterica subsp. ente... 104 8e-21
AP006878_1317(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 104 8e-21
CT573213_2057(CT573213|pid:none) Frankia alni str. ACN14A chromo... 104 8e-21
CP000038_456(CP000038|pid:none) Shigella sonnei Ss046, complete ... 103 1e-20
CP001063_380(CP001063|pid:none) Shigella boydii CDC 3083-94, com... 103 1e-20
CP000086_2012(CP000086|pid:none) Burkholderia thailandensis E264... 103 1e-20
CP000963_139(CP000963|pid:none) Clostridium botulinum A3 str. Lo... 103 1e-20
AM181176_5744(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 103 1e-20
AJ248288_22(AJ248288|pid:none) Pyrococcus abyssi complete genome... 103 1e-20
CP001056_1024(CP001056|pid:none) Clostridium botulinum B str. Ek... 103 1e-20
CP000896_807(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 103 2e-20
CP000679_813(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 103 2e-20
CP000614_1881(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 102 2e-20
CP001114_790(CP001114|pid:none) Deinococcus deserti VCD115, comp... 102 2e-20
AC116986_71(AC116986|pid:none) Dictyostelium discoideum chromoso... 102 2e-20
CP000382_1637(CP000382|pid:none) Clostridium novyi NT, complete ... 102 2e-20
CP001120_565(CP001120|pid:none) Salmonella enterica subsp. enter... 102 2e-20
CP000940_189(CP000940|pid:none) Clostridium botulinum B1 str. Ok... 102 2e-20
CP000880_2340(CP000880|pid:none) Salmonella enterica subsp. ariz... 102 2e-20
AE006468_491(AE006468|pid:none) Salmonella enterica subsp. enter... 102 2e-20
CP001186_1926(CP001186|pid:none) Bacillus cereus G9842, complete... 102 3e-20
CU207211_1278(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 102 3e-20
CP000562_500(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 102 3e-20
CP000270_2716(CP000270|pid:none) Burkholderia xenovorans LB400 c... 102 3e-20
AP006725_1199(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 102 4e-20
CP001277_206(CP001277|pid:none) Candidatus Hamiltonella defensa ... 102 4e-20
CP000269_2039(CP000269|pid:none) Janthinobacterium sp. Marseille... 102 4e-20
CP001052_2379(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 102 4e-20
CP000644_3276(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 101 5e-20
AE017224_73(AE017224|pid:none) Brucella abortus biovar 1 str. 9-... 101 5e-20
CP000076_5855(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 101 5e-20
AE008918_19(AE008918|pid:none) Brucella melitensis 16M chromosom... 101 5e-20
CP000449_2217(CP000449|pid:none) Maricaulis maris MCS10, complet... 101 5e-20
AE017282_2959(AE017282|pid:none) Methylococcus capsulatus str. B... 101 5e-20
A71159(A71159) probable membrane protein - Pyrococcus horikoshii... 101 7e-20
CU459003_1858(CU459003|pid:none) Magnetospirillum gryphiswaldens... 100 9e-20
CP001068_1277(CP001068|pid:none) Ralstonia pickettii 12J chromos... 100 9e-20
CP001600_1089(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 100 9e-20
AM420293_2431(AM420293|pid:none) Saccharopolyspora erythraea NRR... 100 1e-19
AP008232_698(AP008232|pid:none) Sodalis glossinidius str. 'morsi... 100 1e-19
CP000769_924(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, co... 100 1e-19
CP001013_1875(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 100 2e-19
AE016877_1916(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 100 2e-19
CP000238_37(CP000238|pid:none) Baumannia cicadellinicola str. Hc... 100 2e-19
CP000575_557(CP000575|pid:none) Staphylothermus marinus F1, comp... 100 2e-19
AP009049_898(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 100 2e-19
CP000759_1504(CP000759|pid:none) Ochrobactrum anthropi ATCC 4918... 100 2e-19
BX842653_140(BX842653|pid:none) Bdellovibrio bacteriovorus compl... 100 2e-19
CP000386_691(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 100 2e-19
CP000728_534(CP000728|pid:none) Clostridium botulinum F str. Lan... 99 3e-19
CP000133_3509(CP000133|pid:none) Rhizobium etli CFN 42, complete... 99 3e-19
AM920689_1296(AM920689|pid:none) Xanthomonas campestris pv. camp... 99 3e-19
CP000448_1802(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 99 3e-19
AL939110_99(AL939110|pid:none) Streptomyces coelicolor A3(2) com... 99 4e-19
CU695238_262(CU695238|pid:none) Ralstonia solanacearum strain Mo... 99 4e-19
AP008229_1695(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 99 4e-19
AE013598_1769(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 99 4e-19
CP000967_3075(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 99 4e-19
AP009152_1373(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 99 5e-19
CP000962_551(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 99 5e-19
FM178380_280(FM178380|pid:none) Aliivibrio salmonicida LFI1238 c... 99 5e-19
AE015927_571(AE015927|pid:none) Clostridium tetani E88, complete... 98 6e-19
CP000090_1845(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 98 6e-19
CU633749_1624(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 98 6e-19
CP000249_1334(CP000249|pid:none) Frankia sp. CcI3, complete geno... 98 8e-19
CP000743_759(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 98 8e-19
CP001616_2511(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 98 8e-19
AE017355_1861(AE017355|pid:none) Bacillus thuringiensis serovar ... 97 1e-18
AM238663_904(AM238663|pid:none) Streptomyces ambofaciens ATCC 23... 97 1e-18
CP000485_1731(CP000485|pid:none) Bacillus thuringiensis str. Al ... 97 1e-18
CP000927_4401(CP000927|pid:none) Caulobacter sp. K31, complete g... 97 1e-18
A98264(A98264) hypothetical 33.7K protein in ushA-tesA intergeni... 97 1e-18
FM954972_2162(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 97 1e-18
CP001358_51(CP001358|pid:none) Desulfovibrio desulfuricans subsp... 97 1e-18
CP001124_322(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 97 1e-18
AE009442_137(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 97 1e-18
BX640415_115(BX640415|pid:none) Bordetella pertussis strain Toha... 97 1e-18
AM260479_1984(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 97 1e-18
BA000045_2174(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 97 1e-18
CR378678_119(CR378678|pid:none) Photobacterium profundum SS9 chr... 97 1e-18
CP001011_137(CP001011|pid:none) Xylella fastidiosa M23, complete... 97 1e-18
A82838(A82838) conserved hypothetical protein XF0185 [imported] ... 97 1e-18
AF065260_1(AF065260|pid:none) Clostridium difficile HflC homolog... 97 1e-18
CP000941_140(CP000941|pid:none) Xylella fastidiosa M12, complete... 97 1e-18
CP000021_170(CP000021|pid:none) Vibrio fischeri ES114 chromosome... 97 2e-18
AE016795_194(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 97 2e-18
CP000390_2707(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 96 2e-18
CP000789_1233(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 96 2e-18
CP000539_2649(CP000539|pid:none) Acidovorax sp. JS42, complete g... 96 2e-18
BA000016_1060(BA000016|pid:none) Clostridium perfringens str. 13... 96 2e-18
CP000352_1452(CP000352|pid:none) Ralstonia metallidurans CH34, c... 96 4e-18
CP000680_4275(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 95 5e-18
CP000764_1496(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 95 5e-18
CP000934_1048(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 95 5e-18
BX950229_1036(BX950229|pid:none) Methanococcus maripaludis strai... 95 7e-18
AE002098_1171(AE002098|pid:none) Neisseria meningitidis MC58, co... 95 7e-18
AE004969_729(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, c... 95 7e-18
CP000159_2176(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 95 7e-18
AF226512_1(AF226512|pid:none) Neisseria meningitidis strain 2059... 95 7e-18
AM167904_1749(AM167904|pid:none) Bordetella avium 197N complete ... 95 7e-18
AF424666_1(AF424666|pid:none) Phytophthora infestans clone MY-11... 94 9e-18
CP001172_685(CP001172|pid:none) Acinetobacter baumannii AB307-02... 94 9e-18
CP000745_287(CP000745|pid:none) Methanococcus maripaludis C7, co... 94 1e-17
CP001322_3727(CP001322|pid:none) Desulfatibacillum alkenivorans ... 94 1e-17
CP000113_3878(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 94 1e-17
CU468230_667(CU468230|pid:none) Acinetobacter baumannii str. SDF... 94 1e-17
AP009493_2467(AP009493|pid:none) Streptomyces griseus subsp. gri... 94 1e-17
CU234118_5917(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 94 1e-17
CP000267_2086(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 94 1e-17
CP000521_3030(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 94 1e-17
AF461430_3(AF461430|pid:none) Sinorhizobium meliloti putative 5'... 93 2e-17
BA000040_7750(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 93 2e-17
CP000356_2198(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 93 3e-17
CP000158_1041(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 93 3e-17
CP000749_1826(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 92 3e-17
CP000529_2004(CP000529|pid:none) Polaromonas naphthalenivorans C... 92 3e-17
CP000482_1594(CP000482|pid:none) Pelobacter propionicus DSM 2379... 92 4e-17
AM114193_724(AM114193|pid:none) Uncultured methanogenic archaeon... 92 4e-17
CP000159_2175(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 92 4e-17
CP001100_1800(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 92 4e-17
CP000510_1783(CP000510|pid:none) Psychromonas ingrahamii 37, com... 92 6e-17
CP001131_921(CP001131|pid:none) Anaeromyxobacter sp. K, complete... 91 7e-17
CP001001_5039(CP001001|pid:none) Methylobacterium radiotolerans ... 91 7e-17
CP001340_3483(CP001340|pid:none) Caulobacter crescentus NA1000, ... 91 7e-17
AB018115_6(AB018115|pid:none) Arabidopsis thaliana genomic DNA, ... 91 7e-17
CP000251_878(CP000251|pid:none) Anaeromyxobacter dehalogenans 2C... 91 1e-16
AE008920_33(AE008920|pid:none) Uncultured marine proteobacterium... 91 1e-16
FN317770_1(FN317770|pid:none) Schistosoma japonicum isolate Anhu... 91 1e-16
BX572595_245(BX572595|pid:none) Rhodopseudomonas palustris CGA00... 91 1e-16
AY596297_1607(AY596297|pid:none) Haloarcula marismortui ATCC 430... 91 1e-16
AP011115_7007(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 90 2e-16
CP000089_260(CP000089|pid:none) Dechloromonas aromatica RCB, com... 90 2e-16
CP000910_1995(CP000910|pid:none) Renibacterium salmoninarum ATCC... 90 2e-16
CP000431_7147(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 90 2e-16
AY085995_1(AY085995|pid:none) Arabidopsis thaliana clone 205622 ... 90 2e-16
CP000283_860(CP000283|pid:none) Rhodopseudomonas palustris BisB5... 90 2e-16
CP001252_487(CP001252|pid:none) Shewanella baltica OS223, comple... 90 2e-16
CP000753_466(CP000753|pid:none) Shewanella baltica OS185, comple... 90 2e-16
CP001620_887(CP001620|pid:none) Corynebacterium kroppenstedtii D... 89 3e-16
CP000503_3581(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 89 4e-16
CR936257_562(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 89 4e-16
CP000474_2099(CP000474|pid:none) Arthrobacter aurescens TC1, com... 89 4e-16
(P72655) RecName: Full=Uncharacterized protein slr1128; &BA0000... 89 4e-16
CP000606_3379(CP000606|pid:none) Shewanella loihica PV-4, comple... 89 5e-16
CP000580_3103(CP000580|pid:none) Mycobacterium sp. JLS, complete... 89 5e-16
AP009384_4273(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 89 5e-16
CP000447_3373(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 89 5e-16
CP000384_3111(CP000384|pid:none) Mycobacterium sp. MCS, complete... 89 5e-16
CP000469_3650(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 88 6e-16
CP000444_448(CP000444|pid:none) Shewanella sp. MR-7, complete ge... 88 6e-16
FN392321_982(FN392321|pid:none) Pichia pastoris GS115 chromosome... 88 8e-16
AE016825_2928(AE016825|pid:none) Chromobacterium violaceum ATCC ... 88 8e-16
AF236372_1(AF236372|pid:none) Zea mays variety Hi-II stomatin-li... 87 1e-15
CR522870_1869(CR522870|pid:none) Desulfotalea psychrophila LSv54... 87 1e-15
CP000454_2168(CP000454|pid:none) Arthrobacter sp. FB24, complete... 87 1e-15
CP000505_823(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 87 1e-15
CP001326_485(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 87 2e-15
AL035602_7(AL035602|pid:none) Arabidopsis thaliana DNA chromosom... 87 2e-15
AE009951_55(AE009951|pid:none) Fusobacterium nucleatum subsp. nu... 87 2e-15
CP000480_3047(CP000480|pid:none) Mycobacterium smegmatis str. MC... 87 2e-15
AC126789_34(AC126789|pid:none) Medicago truncatula clone mth2-36... 86 2e-15
CP000961_4455(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 86 3e-15
AM420293_3697(AM420293|pid:none) Saccharopolyspora erythraea NRR... 86 3e-15
CP000513_352(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 86 3e-15
CP000472_4485(CP000472|pid:none) Shewanella piezotolerans WP3, c... 86 3e-15
CU458896_2694(CU458896|pid:none) Mycobacterium abscessus chromos... 86 3e-15
AE017125_856(AE017125|pid:none) Helicobacter hepaticus ATCC 5144... 86 3e-15
AE010300_2070(AE010300|pid:none) Leptospira interrogans serovar ... 86 3e-15
CP000949_4600(CP000949|pid:none) Pseudomonas putida W619, comple... 84 9e-15
BA000035_1652(BA000035|pid:none) Corynebacterium efficiens YS-31... 84 9e-15
CR931997_963(CR931997|pid:none) Corynebacterium jeikeium K411 co... 84 1e-14
CP001146_1628(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 84 1e-14
AP009044_1622(AP009044|pid:none) Corynebacterium glutamicum R DN... 84 1e-14
CP000511_2715(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 84 1e-14
CP000301_4786(CP000301|pid:none) Rhodopseudomonas palustris BisB... 84 2e-14
BT045045_1(BT045045|pid:none) Salmo salar clone ssal-rgf-510-204... 84 2e-14
AK002793_1(AK002793|pid:none) Mus musculus adult male kidney cDN... 84 2e-14
CP000087_716(CP000087|pid:none) Rickettsia bellii RML369-C, comp... 84 2e-14
AP006618_3486(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 84 2e-14
(Q9UJZ1) RecName: Full=Stomatin-like protein 2; Short=S... 83 2e-14
BC142027_1(BC142027|pid:none) Bos taurus stomatin (EPB72)-like 2... 83 2e-14
CP000931_538(CP000931|pid:none) Shewanella halifaxensis HAW-EB4,... 83 2e-14
AC004472_4(AC004472|pid:none) Homo sapiens chromosome 9, P1 clon... 83 3e-14
AK223102_1(AK223102|pid:none) Homo sapiens mRNA for stomatin (EP... 83 3e-14
(Q4FZT0) RecName: Full=Stomatin-like protein 2; Short=S... 83 3e-14
AY691689_1(AY691689|pid:none) Toxoplasma gondii stomatin-like pr... 83 3e-14
CP000781_1866(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 83 3e-14
AE014299_4015(AE014299|pid:none) Shewanella oneidensis MR-1, com... 83 3e-14
AF161458_1(AF161458|pid:none) Homo sapiens HSPC108 mRNA, complet... 83 3e-14
CP001365_602(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 82 3e-14
BT077843_1(BT077843|pid:none) Lepeophtheirus salmonis clone lsal... 82 3e-14
AE016958_1214(AE016958|pid:none) Mycobacterium avium subsp. para... 82 3e-14
CP000348_1201(CP000348|pid:none) Leptospira borgpetersenii serov... 82 3e-14
CP000117_404(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 82 3e-14
AM180088_506(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 82 5e-14
EF558549_15(EF558549|pid:none) Halorubrum sp. TP009 clone 1 sequ... 82 5e-14
(P63693) RecName: Full=Uncharacterized protein Rv1488/MT1533.2; ... 82 5e-14
BC074573_1(BC074573|pid:none) Xenopus tropicalis MGC69303 protei... 81 8e-14
CP000766_483(CP000766|pid:none) Rickettsia rickettsii str. Iowa,... 81 8e-14
AE006914_452(AE006914|pid:none) Rickettsia conorii str. Malish 7... 81 8e-14
AE004437_255(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 81 1e-13
CP000053_533(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 81 1e-13
CP000447_3374(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 81 1e-13
AJ235271_100(AJ235271|pid:none) Rickettsia prowazekii strain Mad... 81 1e-13
CT573326_4533(CT573326|pid:none) Pseudomonas entomophila str. L4... 80 1e-13
CP001339_1037(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 80 1e-13
CP000563_3783(CP000563|pid:none) Shewanella baltica OS155, compl... 80 2e-13
AL583923_145(AL583923|pid:none) Mycobacterium leprae strain TN c... 80 2e-13
AP004237_111(AP004237|pid:none) Proteus vulgaris plasmid Rts1 DN... 80 2e-13
CP000847_454(CP000847|pid:none) Rickettsia akari str. Hartford, ... 80 2e-13
CP001130_1085(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 80 2e-13
AY094961_1(AY094961|pid:none) Drosophila melanogaster SD03319 fu... 80 2e-13
CP000792_504(CP000792|pid:none) Campylobacter concisus 13826, co... 80 2e-13
AL844502_176(AL844502|pid:none) Plasmodium falciparum 3D7 chromo... 79 3e-13
AK060393_1(AK060393|pid:none) Oryza sativa Japonica Group cDNA c... 79 3e-13
CP000348_1202(CP000348|pid:none) Leptospira borgpetersenii serov... 79 5e-13
CP000240_320(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 78 9e-13
CP000284_86(CP000284|pid:none) Methylobacillus flagellatus KT, c... 78 9e-13
AE015451_4769(AE015451|pid:none) Pseudomonas putida KT2440 compl... 78 9e-13
AE017226_699(AE017226|pid:none) Treponema denticola ATCC 35405, ... 78 9e-13
Z81072_10(Z81072|pid:none) Caenorhabditis elegans Cosmid F30A10,... 77 1e-12
T21562(T21562)hypothetical protein F30A10.5 - Caenorhabditis ele... 77 1e-12
CP001037_6035(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 77 1e-12
CP000713_2344(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 77 2e-12
CP000961_4456(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 76 2e-12
AL672276_16(AL672276|pid:none) Mouse DNA sequence from clone RP2... 75 6e-12
CP000507_413(CP000507|pid:none) Shewanella amazonensis SB2B, com... 75 7e-12
AE006641_2017(AE006641|pid:none) Sulfolobus solfataricus P2, com... 73 2e-11
CP000828_3868(CP000828|pid:none) Acaryochloris marina MBIC11017,... 73 2e-11
CP000821_464(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 73 2e-11
CR378677_305(CR378677|pid:none) Photobacterium profundum SS9 chr... 73 3e-11
AM180252_674(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 73 3e-11
CP000544_1629(CP000544|pid:none) Halorhodospira halophila SL1, c... 72 4e-11
CP000323_2444(CP000323|pid:none) Psychrobacter cryohalolentis K5... 72 6e-11
CP000473_1475(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 71 8e-11
CP000083_4694(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 71 8e-11
CP000489_57(CP000489|pid:none) Paracoccus denitrificans PD1222 c... 71 1e-10
BA000032_1106(BA000032|pid:none) Vibrio parahaemolyticus RIMD 22... 71 1e-10
AM502223_105(AM502223|pid:none) Leishmania infantum chromosome 5. 71 1e-10
CP000393_3656(CP000393|pid:none) Trichodesmium erythraeum IMS101... 70 1e-10
CP000472_4486(CP000472|pid:none) Shewanella piezotolerans WP3, c... 70 1e-10
CR382128_357(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 70 2e-10
AM494942_104(AM494942|pid:none) Leishmania braziliensis chromoso... 70 2e-10
CR936503_1542(CR936503|pid:none) Lactobacillus sakei strain 23K ... 70 2e-10
CP001037_3892(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 70 2e-10
CP001080_767(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 69 3e-10
CP000077_2186(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 69 3e-10
CP000477_1693(CP000477|pid:none) Methanosaeta thermophila PT, co... 69 4e-10
CP000507_1019(CP000507|pid:none) Shewanella amazonensis SB2B, co... 68 7e-10
CP000774_1510(CP000774|pid:none) Parvibaculum lavamentivorans DS... 68 7e-10
CP000926_220(CP000926|pid:none) Pseudomonas putida GB-1, complet... 68 7e-10
BX571659_105(BX571659|pid:none) Wolinella succinogenes, complete... 68 7e-10
CP000267_2112(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 68 9e-10
CP000142_2100(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 68 9e-10
AC159436_21(AC159436|pid:none) Trypanosoma brucei chromosome 5 c... 68 9e-10
AE015451_198(AE015451|pid:none) Pseudomonas putida KT2440 comple... 68 9e-10
CP001145_361(CP001145|pid:none) Coprothermobacter proteolyticus ... 68 9e-10
CP000109_947(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 67 1e-09
CP000252_1553(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 67 1e-09
CP000472_1797(CP000472|pid:none) Shewanella piezotolerans WP3, c... 67 1e-09
CP000027_820(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 67 1e-09
FM177140_1187(FM177140|pid:none) Lactobacillus casei BL23 comple... 67 2e-09
BX640431_124(BX640431|pid:none) Bordetella parapertussis strain ... 67 2e-09
BX571966_628(BX571966|pid:none) Burkholderia pseudomallei strain... 67 2e-09
CP001026_1777(CP001026|pid:none) Burkholderia ambifaria MC40-6 c... 67 2e-09
CP000423_998(CP000423|pid:none) Lactobacillus casei ATCC 334, co... 67 2e-09
CP000099_3352(CP000099|pid:none) Methanosarcina barkeri str. Fus... 67 2e-09
CP000510_1565(CP000510|pid:none) Psychromonas ingrahamii 37, com... 67 2e-09
CP000514_118(CP000514|pid:none) Marinobacter aquaeolei VT8, comp... 67 2e-09
AE008384_2033(AE008384|pid:none) Methanosarcina mazei strain Goe... 67 2e-09
A83590(A83590) probable stomatin-like protein PA0452 [imported] ... 67 2e-09
AM747721_2204(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 66 3e-09
AY658590_1(AY658590|pid:none) Synthetic construct Peudomonas aer... 66 3e-09
CP000152_708(CP000152|pid:none) Burkholderia sp. 383 chromosome ... 66 3e-09
CP000607_1027(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 66 3e-09
AM260479_2695(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 66 3e-09
BA000023_2373(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 66 3e-09
AE000657_631(AE000657|pid:none) Aquifex aeolicus VF5, complete g... 66 3e-09
CP000379_415(CP000379|pid:none) Burkholderia cenocepacia AU 1054... 66 3e-09
CU633749_2203(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 66 3e-09
AY458648_73(AY458648|pid:none) Uncultured marine bacterium 581 c... 65 4e-09
AE010299_895(AE010299|pid:none) Methanosarcina acetivorans str. ... 65 4e-09
CP001034_1716(CP001034|pid:none) Natranaerobius thermophilus JW/... 65 6e-09
AE016828_1281(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 65 6e-09
CP000248_401(CP000248|pid:none) Novosphingobium aromaticivorans ... 65 6e-09
CP000453_1479(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 65 7e-09
CP000575_155(CP000575|pid:none) Staphylothermus marinus F1, comp... 65 7e-09
CP000885_3778(CP000885|pid:none) Clostridium phytofermentans ISD... 65 7e-09
AF034831_3(AF034831|pid:none) Rhizobium etli stomatin like prote... 64 1e-08
CP000010_1137(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 64 1e-08
CP000096_1273(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 64 1e-08
CP000570_2162(CP000570|pid:none) Burkholderia pseudomallei 668 c... 64 1e-08
CP000830_610(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 64 1e-08
CR555306_1481(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 64 1e-08
(Q7PPU9) RecName: Full=Band 7 protein AGAP004871; 64 1e-08
CP000103_1032(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 64 1e-08
CP001140_445(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 64 1e-08
CP001019_484(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com... 64 1e-08
CP000148_806(CP000148|pid:none) Geobacter metallireducens GS-15,... 64 1e-08
CP001408_2263(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 64 1e-08
CP000271_1906(CP000271|pid:none) Burkholderia xenovorans LB400 c... 64 1e-08
CP001034_1715(CP001034|pid:none) Natranaerobius thermophilus JW/... 64 1e-08
(Q58237) RecName: Full=Uncharacterized protein MJ0827; &C64403(... 64 1e-08
AE014298_2935(AE014298|pid:none) Drosophila melanogaster chromos... 64 1e-08
BA000002_1402(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple... 64 1e-08
CP001053_1625(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 64 1e-08
BX571965_1538(BX571965|pid:none) Burkholderia pseudomallei strai... 64 2e-08
CP000478_460(CP000478|pid:none) Syntrophobacter fumaroxidans MPO... 64 2e-08
AP004237_28(AP004237|pid:none) Proteus vulgaris plasmid Rts1 DNA... 64 2e-08
FN357540_1(FN357540|pid:none) Schistosoma mansoni genome sequenc... 64 2e-08
CP001390_3462(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 64 2e-08
AE017354_2895(AE017354|pid:none) Legionella pneumophila subsp. p... 63 2e-08
AE000666_1737(AE000666|pid:none) Methanothermobacter thermautotr... 63 2e-08
CP000675_3157(CP000675|pid:none) Legionella pneumophila str. Cor... 63 2e-08
CP000319_341(CP000319|pid:none) Nitrobacter hamburgensis X14, co... 63 2e-08
CP000113_759(CP000113|pid:none) Myxococcus xanthus DK 1622, comp... 63 2e-08
CP001157_559(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 63 3e-08
CP000749_2600(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 63 3e-08
CP000083_2617(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 62 4e-08
CP000155_1431(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 62 4e-08
CP000492_1121(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 62 4e-08
AF002133_19(AF002133|pid:none) Mycobacterium avium strain GIR10 ... 62 4e-08
CP000264_3992(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 62 4e-08
CP000500_590(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 62 4e-08
AL954747_2469(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 62 6e-08
CP000568_658(CP000568|pid:none) Clostridium thermocellum ATCC 27... 62 6e-08
AY060624_1(AY060624|pid:none) Drosophila melanogaster GH04632 fu... 62 6e-08
FN392320_914(FN392320|pid:none) Pichia pastoris GS115 chromosome... 61 8e-08
AP007255_1812(AP007255|pid:none) Magnetospirillum magneticum AMB... 61 8e-08
FN357293_18(FN357293|pid:none) Schistosoma mansoni genome sequen... 61 8e-08
CP000821_2653(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 61 8e-08
(Q9V0Y1) RecName: Full=Uncharacterized protein PYRAB06580; &AJ2... 61 8e-08
CR382134_271(CR382134|pid:none) Debaryomyces hansenii strain CBS... 61 8e-08
AL935252_281(AL935252|pid:none) Lactobacillus plantarum strain W... 61 1e-07
CP000450_2290(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 61 1e-07
(Q19958) RecName: Full=Stomatin-2; &U40409_8(U40409|pid:none) &... 61 1e-07
CP001099_811(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 60 1e-07
CP000851_1567(CP000851|pid:none) Shewanella pealeana ATCC 700345... 60 1e-07
CP000689_89(CP000689|pid:none) Acidiphilium cryptum JF-5 plasmid... 60 1e-07
CP000300_1666(CP000300|pid:none) Methanococcoides burtonii DSM 6... 60 1e-07
CP000931_1632(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 60 1e-07
CP000141_836(CP000141|pid:none) Carboxydothermus hydrogenoforman... 60 2e-07
(Q19200) RecName: Full=Stomatin-1; &U29378_3(U29378|pid:none) 60 2e-07
CP000302_2175(CP000302|pid:none) Shewanella denitrificans OS217,... 60 2e-07
CP000159_1680(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 60 2e-07
AE014297_24(AE014297|pid:none) Drosophila melanogaster chromosom... 60 2e-07
CP000477_419(CP000477|pid:none) Methanosaeta thermophila PT, com... 60 2e-07
CP000143_3013(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 60 2e-07
CP001197_2030(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 60 2e-07
AE009950_1534(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 60 2e-07
CP000479_3863(CP000479|pid:none) Mycobacterium avium 104, comple... 59 3e-07
CP001108_851(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 59 3e-07
CP001147_1418(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 59 3e-07
CP000116_490(CP000116|pid:none) Thiobacillus denitrificans ATCC ... 59 3e-07
CP000909_3007(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 59 4e-07
CP000440_1736(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 59 4e-07
CP000804_1577(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 59 4e-07
CP001025_1698(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 59 4e-07
BC093290_1(BC093290|pid:none) Danio rerio zgc:112408, mRNA (cDNA... 59 4e-07
AP009552_4622(AP009552|pid:none) Microcystis aeruginosa NIES-843... 59 4e-07
CP000386_2904(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 59 5e-07
CP000381_1049(CP000381|pid:none) Neisseria meningitidis 053442, ... 59 5e-07
AP009385_1741(AP009385|pid:none) Burkholderia multivorans ATCC 1... 59 5e-07
AY744396_10(AY744396|pid:none) Uncultured proteobacterium RedeBA... 59 5e-07
CP000868_1463(CP000868|pid:none) Burkholderia multivorans ATCC 1... 59 5e-07
CP000384_1556(CP000384|pid:none) Mycobacterium sp. MCS, complete... 59 5e-07
AP006878_349(AP006878|pid:none) Thermococcus kodakarensis KOD1 D... 58 7e-07
CP000771_685(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 58 7e-07
CP000855_1063(CP000855|pid:none) Thermococcus onnurineus NA1, co... 58 7e-07
CP000968_326(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 58 7e-07
CT573213_3954(CT573213|pid:none) Frankia alni str. ACN14A chromo... 58 9e-07
CP000812_969(CP000812|pid:none) Thermotoga lettingae TMO, comple... 58 9e-07
AP008957_5851(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 57 1e-06
CP000860_585(CP000860|pid:none) Candidatus Desulforudis audaxvia... 57 1e-06
CP000922_2301(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 57 1e-06
(O83151) RecName: Full=Protein hflK; &AE000520_112(AE000520|pid... 57 2e-06
CP000103_444(CP000103|pid:none) Nitrosospira multiformis ATCC 25... 57 2e-06
BX248583_76(BX248583|pid:none) Blochmannia floridanus complete g... 57 2e-06
CP001503_1394(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 56 3e-06
CP001101_1115(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 56 3e-06
AE017198_1091(AE017198|pid:none) Lactobacillus johnsonii NCC 533... 56 3e-06
AE009439_847(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 56 3e-06
AF093620_1(AF093620|pid:none) Mus musculus stomatin mRNA, comple... 56 3e-06
AM494475_1835(AM494475|pid:none) Orientia tsutsugamushi Boryong ... 56 3e-06
BC099338_1(BC099338|pid:none) Xenopus laevis hypothetical protei... 56 3e-06
AM747720_1872(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 56 3e-06
AP008937_1719(AP008937|pid:none) Lactobacillus fermentum IFO 395... 56 3e-06
(Q5UP73) RecName: Full=Putative band 7 family protein R614; &AY... 56 3e-06
BA000021_185(BA000021|pid:none) Wigglesworthia glossinidia endos... 56 3e-06
CP000016_77(CP000016|pid:none) Candidatus Blochmannia pennsylvan... 55 5e-06
CP000422_1273(CP000422|pid:none) Pediococcus pentosaceus ATCC 25... 55 5e-06
DQ489736_1006(DQ489736|pid:none) Leuconostoc citreum KM20, compl... 55 5e-06
AY142863_1(AY142863|pid:none) Heliobacillus mobilis erythrocyte ... 55 5e-06
CP000958_1809(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 55 5e-06
AE017226_1321(AE017226|pid:none) Treponema denticola ATCC 35405,... 55 6e-06
CP000454_2418(CP000454|pid:none) Arthrobacter sp. FB24, complete... 55 6e-06
AP011115_70(AP011115|pid:none) Rhodococcus opacus B4 DNA, comple... 55 6e-06
CP000432_267(CP000432|pid:none) Rhodococcus jostii RHA1 plasmid ... 55 6e-06
BC091908_1(BC091908|pid:none) Danio rerio stomatin, mRNA (cDNA c... 55 8e-06
Y13473_1(Y13473|pid:none) Brachydanio rerio mRNA for stomatin. 55 8e-06
CP000058_555(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 55 8e-06
JC5221(JC5221) stomatin - mouse &X91043_1(X91043|pid:none) 54 1e-05
CU638744_144(CU638744|pid:none) Podospora anserina genomic DNA c... 54 1e-05
FN357547_27(FN357547|pid:none) Schistosoma mansoni genome sequen... 54 1e-05
AK077435_1(AK077435|pid:none) Mus musculus 8 days embryo whole b... 54 1e-05
BC083895_1(BC083895|pid:none) Rattus norvegicus stomatin, mRNA (... 54 1e-05
BC010703_1(BC010703|pid:none) Homo sapiens stomatin, mRNA (cDNA ... 54 1e-05
AB467286_1(AB467286|pid:none) Canis lupus familiaris STOM mRNA f... 54 1e-05
AM270022_81(AM270022|pid:none) Aspergillus niger contig An02c027... 54 1e-05
FM992695_786(FM992695|pid:none) Candida dubliniensis CD36 chromo... 54 1e-05
CP000109_1090(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 54 2e-05
CP000413_1018(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 54 2e-05
CP000969_987(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 54 2e-05
A72207(A72207) ftsH proteinase activity modulator HflK - Thermot... 54 2e-05
CP000993_190(CP000993|pid:none) Borrelia recurrentis A1, complet... 54 2e-05
CP000947_1750(CP000947|pid:none) Haemophilus somnus 2336, comple... 53 2e-05
BC042356_1(BC042356|pid:none) Xenopus laevis stomatin, mRNA (cDN... 53 2e-05
CP000416_59(CP000416|pid:none) Lactobacillus brevis ATCC 367, co... 53 2e-05
CP000436_494(CP000436|pid:none) Haemophilus somnus 129PT, comple... 53 2e-05
CR937010_22(CR937010|pid:none) uncultured archaeon fos0114d2+13a9. 53 2e-05
CP000048_193(CP000048|pid:none) Borrelia hermsii DAH, complete g... 53 3e-05
AY915256_1(AY915256|pid:none) Schistosoma japonicum SJCHGC03893 ... 53 3e-05
CP000937_1546(CP000937|pid:none) Francisella philomiragia subsp.... 53 3e-05
CP001197_2651(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 53 3e-05
BX950851_3905(BX950851|pid:none) Erwinia carotovora subsp. atros... 53 3e-05
CR522870_1092(CR522870|pid:none) Desulfotalea psychrophila LSv54... 53 3e-05
(Q27433) RecName: Full=Mechanosensory protein 2; &S60260(S60260... 52 4e-05
CP000075_574(CP000075|pid:none) Pseudomonas syringae pv. syringa... 52 4e-05
U41021_2(U41021|pid:none) Caenorhabditis elegans cosmid F14D12, ... 52 4e-05
CP000724_3001(CP000724|pid:none) Alkaliphilus metalliredigens QY... 52 4e-05
CP000384_1473(CP000384|pid:none) Mycobacterium sp. MCS, complete... 52 5e-05
CU928158_4053(CU928158|pid:none) Escherichia fergusonii ATCC 354... 52 5e-05
AP007161_654(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 52 5e-05
(P0ABC7) RecName: Full=Protein hflK; &(P0ABC8) RecName: Fu &AE0... 52 5e-05
CU928145_4591(CU928145|pid:none) Escherichia coli 55989 chromoso... 52 5e-05
CP001601_2079(CP001601|pid:none) Corynebacterium aurimucosum ATC... 52 5e-05
BC092792_1(BC092792|pid:none) Danio rerio zgc:110200, mRNA (cDNA... 52 5e-05
CP000680_630(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 52 5e-05
CP000653_355(CP000653|pid:none) Enterobacter sp. 638, complete g... 52 5e-05
BT082725_1(BT082725|pid:none) Anoplopoma fimbria clone afim-evh-... 52 7e-05
CP000880_3150(CP000880|pid:none) Salmonella enterica subsp. ariz... 52 7e-05
AL939126_48(AL939126|pid:none) Streptomyces coelicolor A3(2) com... 52 7e-05
FP236842_501(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 52 7e-05
CP001280_592(CP001280|pid:none) Methylocella silvestris BL2, com... 52 7e-05
AM920428_1482(AM920428|pid:none) Penicillium chrysogenum Wiscons... 51 9e-05
AE004439_117(AE004439|pid:none) Pasteurella multocida subsp. mul... 51 9e-05
AE014298_2936(AE014298|pid:none) Drosophila melanogaster chromos... 51 9e-05
CP000508_163(CP000508|pid:none) Nocardioides sp. JS614, complete... 51 9e-05
BX284747_27(BX284747|pid:none) Neurospora crassa DNA linkage gro... 51 9e-05
CP000283_3335(CP000283|pid:none) Rhodopseudomonas palustris BisB... 51 9e-05
AE016827_1619(AE016827|pid:none) Mannheimia succiniciproducens M... 51 9e-05
CP001298_2753(CP001298|pid:none) Methylobacterium chloromethanic... 51 1e-04
CP000250_2034(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 51 1e-04
(Q8K914) RecName: Full=Protein hflK; &AE013218_515(AE013218|pid... 51 1e-04
DQ826111_1(DQ826111|pid:none) Lactobacillus helveticus CNRZ32 pu... 51 1e-04
CP000613_1932(CP000613|pid:none) Rhodospirillum centenum SW, com... 51 1e-04
CP000513_567(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 50 1e-04
CP001144_4292(CP001144|pid:none) Salmonella enterica subsp. ente... 50 1e-04
CP000304_3581(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 50 1e-04
CP001600_387(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 50 1e-04
CP001158_520(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 50 1e-04
CP000112_2939(CP000112|pid:none) Desulfovibrio desulfuricans G20... 50 1e-04
CP000886_5321(CP000886|pid:none) Salmonella enterica subsp. ente... 50 1e-04
(P57631) RecName: Full=Protein hflK; &B84996(B84996) &BA000003_... 50 1e-04
CP001138_4298(CP001138|pid:none) Salmonella enterica subsp. ente... 50 1e-04
CP001016_3352(CP001016|pid:none) Beijerinckia indica subsp. indi... 50 1e-04
CP000243_4668(CP000243|pid:none) Escherichia coli UTI89, complet... 50 2e-04
CP000034_4067(CP000034|pid:none) Shigella dysenteriae Sd197, com... 50 2e-04
AE014075_5149(AE014075|pid:none) Escherichia coli CFT073, comple... 50 2e-04
CU651637_4117(CU651637|pid:none) Escherichia coli LF82 chromosom... 50 2e-04
CP000671_448(CP000671|pid:none) Haemophilus influenzae PittEE, c... 50 2e-04
>CP001055_350(CP001055|pid:none) Elusimicrobium minutum Pei191,
complete genome.
Length = 327
Score = 149 bits (377), Expect = 2e-34
Identities = 80/260 (30%), Positives = 149/260 (57%), Gaps = 2/260 (0%)
Frame = +2
Query: 395 RFGQYHNILHAGVHWTIPWVDRPKTFYYSYYVDTPSGKELREGLNLTRISTQNEVLDLPK 574
R G+YH L +G+++ +P+ D P+ + + G+++ L RI + V D P+
Sbjct: 35 RLGKYHATLTSGINFIVPFFDNPRRIDWKRSAEI-GGRQVSYTEMLERIDMRETVYDFPR 93
Query: 575 QTVITRDCASVDLDAVLSYKITNPKQMIYSCVNLPNILSKLLQAQLRNLAGTLEIDQIIE 754
Q+VITRD S++++A++ +++T+P +++Y +LP + KL Q LRN+ G L++DQ +
Sbjct: 94 QSVITRDNVSIEINALIYFQVTDPLRVVYEITSLPVAIEKLTQTTLRNVIGELDLDQTLT 153
Query: 755 ESHLLNA-LTGLMASEANKWGVEIVFVKVQR-VEARRLAEVXXXXXXXXXXXXEIIITAK 928
+N+ L ++ +NKWGV++ V++Q + R + E I+ A+
Sbjct: 154 SRETINSKLRHILDDASNKWGVKVNRVELQDIIPPREIKEAMEKQMRAERDKRAAILEAE 213
Query: 929 AHKQTKVIESEGLRDSMIKKAEGEAQEIVSRAKGAAQAKLNSAQAEVKTIKEIARAVGLN 1108
KQ +++++EG +++ IK+AEG Q ++ A G AQAK+ A+AE +K I+ V
Sbjct: 214 GLKQAQILKAEGFKEAEIKRAEGSRQALILEADGQAQAKIRVAEAEATAVKTISDTVAQY 273
Query: 1109 KDSKVDVSKYIITIKYLNAL 1168
+ + Y+I++KY+ AL
Sbjct: 274 SNP----ANYLISLKYIEAL 289
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,308,312,631
Number of extensions: 19800360
Number of successful extensions: 53435
Number of sequences better than 10.0: 709
Number of HSP's gapped: 52613
Number of HSP's successfully gapped: 711
Length of query: 458
Length of database: 1,040,966,779
Length adjustment: 132
Effective length of query: 326
Effective length of database: 618,001,159
Effective search space: 201468377834
Effective search space used: 201468377834
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|