Contig-U09243-1
Contig ID Contig-U09243-1
Contig update 2002. 9.13
Contig sequence
>Contig-U09243-1 (Contig-U09243-1Q) /CSM_Contig/Contig-U09243-1Q.Seq.d
GTGGTCGTGGGAGCGGCGATTGGGCAGTTGCAAGTGGCCATGACGATGGC
TCCATTGGTGTCTGGAATATGAGGACTGGCACACTCCAAGCAACTCTATC
AAATCCATTAAGTAAAGCAGTTTGGCATATTCAATTTAGAAATAATGTAA
TTTACACTTCCTCTGAAAATAATCTTTATAGTTGGAATTTAAATATTGCA
GATGGTTCAGACTCTAA----------TCTAAAACTATAAACACTCAATT
AACTTCAAATAAAGTTTTCAAAGGTCATACTAAATCAATTAAACATTTTC
AAGTTAAAGATAATAGATTAGTTAGTGGTGGTTTAGATAACAAAATTAAA
ATTTGGGATTTAGATAAACCTGGAAATAATTATTTATACACCCTTGTTGG
TCATTCAAAAAGTGTTGATTGGTTAGAATTTAAAAAAGATAAATTAATAA
GTTGTTCAGCTGATCATACAATTAGAGTTTGGGATTTTAATTCGTAAATT
AAATAAAATAATAATAGATTTGCTTTTTAATGTAAAAAAAAAAAAAAAAA
AAAAGGGCGACGGCNGNCNGCTGATCGCAGGCTCNACGTACGCGTGCATG
CGGCGT

Gap gap included
Contig length 596
Chromosome number (1..6, M) 6
Chromosome length 3595308
Start point 713848
End point 713310
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 2
Link to clone list U09243
List of clone(s)

est1=SLI588F,1,218
est2=SLI588Z,219,598
Translated Amino Acid sequence
GRGSGDWAVASGHDDGSIGVWNMRTGTLQATLSNPLSKAVWHIQFRNNVIYTSSENNLYS
WNLNIADGSDS---

---SKTINTQLTSNKVFKGHTKSIKHFQVKDNRLVSGGLDNKIKIWDLDKPGNNYLYTLV
GHSKSVDWLEFKKDKLISCSADHTIRVWDFNS*ik*nnnrfaf*ckkkkkkkgrrxxadr
rlxvrvhaa


Translated Amino Acid sequence (All Frames)
Frame A:
vvvgaaigqlqvamtmaplvsgi*glahskqlyqih*vkqfgifnleim*ftlplkiifi
vgi*ilqmvqtl---

---SKTINTQLTSNKVFKGHTKSIKHFQVKDNRLVSGGLDNKIKIWDLDKPGNNYLYTLV
GHSKSVDWLEFKKDKLISCSADHTIRVWDFNS*ik*nnnrfaf*ckkkkkkkgrrxxadr
rlxvrvhaa

Frame B:
wswerrlgsckwp*rwlhwcleyedwhtpsnsiksik*sslaysi*k*cnlhfl*k*sl*
lefkycrwfrl*---

---lkl*tln*lqikfskvilnqlnifklkiid*lvvv*itklkfgi*inleiiiytpll
viqkvlig*nlkkin**vvqliiqlefgilirklnkiiidllfnvkkkkkkkgdgxxlia
gstyacmrr

Frame C:
GRGSGDWAVASGHDDGSIGVWNMRTGTLQATLSNPLSKAVWHIQFRNNVIYTSSENNLYS
WNLNIADGSDS---

---*nykhsinfk*sfqrsy*in*tfss*r**is*wwfr*qn*nlgfr*twk*lfihpcw
sfkkc*lvri*kr*inklfs*syn*slgf*fvn*ik***icflm*kkkkkkrataxx*sq
axrtracg

own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U09243-1 (Contig-U09243-1Q)
/CSM_Contig/Contig-U09243-1Q.Seq.d
(606 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U09243-1 (Contig-U09243-1Q) /CSM_Contig/Conti... 997 0.0
Contig-U06832-1 (Contig-U06832-1Q) /CSM_Contig/Conti... 42 7e-04
Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Conti... 40 0.003
Contig-U08154-1 (Contig-U08154-1Q) /CSM_Contig/Conti... 40 0.003
Contig-U07886-1 (Contig-U07886-1Q) /CSM_Contig/Conti... 38 0.011
Contig-U14177-1 (Contig-U14177-1Q) /CSM_Contig/Conti... 36 0.042
Contig-U13007-1 (Contig-U13007-1Q) /CSM_Contig/Conti... 36 0.042
Contig-U11895-1 (Contig-U11895-1Q) /CSM_Contig/Conti... 36 0.042
Contig-U09486-1 (Contig-U09486-1Q) /CSM_Contig/Conti... 36 0.042
Contig-U06299-1 (Contig-U06299-1Q) /CSM_Contig/Conti... 36 0.042

>Contig-U09243-1 (Contig-U09243-1Q) /CSM_Contig/Contig-U09243-1Q.Seq.d
Length = 606

Score = 997 bits (503), Expect = 0.0
Identities = 533/533 (100%)
Strand = Plus / Plus


Query: 1 gtggtcgtgggagcggcgattgggcagttgcaagtggccatgacgatggctccattggtg 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 gtggtcgtgggagcggcgattgggcagttgcaagtggccatgacgatggctccattggtg 60


Query: 61 tctggaatatgaggactggcacactccaagcaactctatcaaatccattaagtaaagcag 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tctggaatatgaggactggcacactccaagcaactctatcaaatccattaagtaaagcag 120


Query: 121 tttggcatattcaatttagaaataatgtaatttacacttcctctgaaaataatctttata 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tttggcatattcaatttagaaataatgtaatttacacttcctctgaaaataatctttata 180


Query: 181 gttggaatttaaatattgcagatggttcagactctaannnnnnnnnntctaaaactataa 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 gttggaatttaaatattgcagatggttcagactctaannnnnnnnnntctaaaactataa 240


Query: 241 acactcaattaacttcaaataaagttttcaaaggtcatactaaatcaattaaacattttc 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 acactcaattaacttcaaataaagttttcaaaggtcatactaaatcaattaaacattttc 300


Query: 301 aagttaaagataatagattagttagtggtggtttagataacaaaattaaaatttgggatt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 aagttaaagataatagattagttagtggtggtttagataacaaaattaaaatttgggatt 360


Query: 361 tagataaacctggaaataattatttatacacccttgttggtcattcaaaaagtgttgatt 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 tagataaacctggaaataattatttatacacccttgttggtcattcaaaaagtgttgatt 420


Query: 421 ggttagaatttaaaaaagataaattaataagttgttcagctgatcatacaattagagttt 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 ggttagaatttaaaaaagataaattaataagttgttcagctgatcatacaattagagttt 480


Query: 481 gggattttaattcgtaaattaaataaaataataatagatttgctttttaatgt 533
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 gggattttaattcgtaaattaaataaaataataatagatttgctttttaatgt 533


Score = 79.8 bits (40), Expect = 3e-15
Identities = 52/52 (100%)
Strand = Plus / Plus


Query: 555 gggcgacggcngncngctgatcgcaggctcnacgtacgcgtgcatgcggcgt 606
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 555 gggcgacggcngncngctgatcgcaggctcnacgtacgcgtgcatgcggcgt 606


>Contig-U06832-1 (Contig-U06832-1Q) /CSM_Contig/Contig-U06832-1Q.Seq.d
Length = 333

Score = 42.1 bits (21), Expect = 7e-04
Identities = 21/21 (100%)
Strand = Plus / Minus


Query: 496 aaattaaataaaataataata 516
|||||||||||||||||||||
Sbjct: 140 aaattaaataaaataataata 120


>Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d
Length = 1378

Score = 40.1 bits (20), Expect = 0.003
Identities = 20/20 (100%)
Strand = Plus / Plus


Query: 497 aattaaataaaataataata 516
||||||||||||||||||||
Sbjct: 1347 aattaaataaaataataata 1366


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 15,549
Number of Sequences: 6905
Number of extensions: 15549
Number of successful extensions: 2049
Number of sequences better than 10.0: 311
length of query: 606
length of database: 5,674,871
effective HSP length: 16
effective length of query: 590
effective length of database: 5,564,391
effective search space: 3282990690
effective search space used: 3282990690
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.11.15
Homology vs DNA
Query= Contig-U09243-1 (Contig-U09243-1Q) /CSM_Contig/Contig-U09243-1Q.Seq.d
(606 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU053409) Dictyostelium discoideum slug cDNA, clone SLI588. 607 0.0 2
(AU062235) Dictyostelium discoideum slug cDNA, clone SLI588. 430 e-116 1
(FF310039) 279378249 Pea aphid whole body normalized full le... 58 4e-04 1
(FF309483) 279375474 Pea aphid whole body normalized full le... 58 4e-04 1
(FF307455) 279369150 Pea aphid whole body normalized full le... 58 4e-04 1
(FF296393) 279312608 Pea aphid whole body normalized full le... 58 4e-04 1
(EX629047) 255455878 Pea aphid whole body normalized full le... 58 4e-04 1
(EX616813) 255397431 Pea aphid whole body normalized full le... 58 4e-04 1
(EX609019) 255368553 Pea aphid whole body normalized full le... 58 4e-04 1
(C94168) Dictyostelium discoideum slug cDNA, clone SSG490. 42 5e-04 3
(AU263299) Dictyostelium discoideum vegetative cDNA clone:VS... 42 5e-04 3
(BD140494) Elongation factor-2 kinase (EF-2 kinase) and meth... 42 0.009 3
(AR193041) Sequence 7 from patent US 6346406. 42 0.009 3
(U90946) Dictyostelium discoideum myosin heavy chain kinase ... 42 0.009 3
(AM661962) Entamoeba moshkovskii FIC GSS, clone mosh116c11.q1k. 38 0.020 2
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 36 0.040 12
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 34 0.047 11
(AC016760) Homo sapiens chromosome 13 clone RP11-536M12, WOR... 44 0.056 5
(EK218160) 1095460126663 Global-Ocean-Sampling_GS-31-01-01-1... 36 0.073 2
(DX897205) KBrH028A12R KBrH, Brassica rapa HindIII BAC libra... 32 0.097 3
(AU272521) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 38 0.14 2
(AM477004) Vitis vinifera contig VV78X199368.2, whole genome... 34 0.15 3
(BJ376000) Dictyostelium discoideum cDNA clone:ddc20f20, 3' ... 38 0.17 2
(C92677) Dictyostelium discoideum slug cDNA, clone SSF822. 38 0.19 2
(CU695296) Brassica rapa subsp. pekinensis clone KBrH035H17,... 44 0.20 4
(ES340585) CTZ97-E08.y1d-s SHGC-CTZ Ostreococcus lucimarinus... 40 0.20 3
(AC225119) Solanum lycopersicum cv. Heinz 1706, chromosome 5... 38 0.27 4
(FF296526) 279312375 Pea aphid whole body normalized full le... 34 0.27 2
(AX344564) Sequence 15 from Patent WO0200932. 38 0.33 8
(AY519426) Myrmecocystus testaceus cytochrome oxidase subuni... 48 0.37 1
(AC116987) Dictyostelium discoideum chromosome 2 map 3527441... 36 0.38 5
(DC232857) Plasmodium berghei strain ANKA cDNA clone:SG02602... 34 0.46 3
(AC190065) Macaca mulatta clone CH250-148M8, WORKING DRAFT S... 40 0.47 3
(BD460281) Diagnosis of Diseases Associated with Cell Cycle. 42 0.48 2
(BD452203) Diagnosis of Diseases Associated with Cell Cycle. 42 0.48 2
(AX348604) Sequence 62 from Patent WO0202807. 42 0.48 2
(AX344201) Sequence 48 from Patent WO0200926. 42 0.48 2
(AX251817) Sequence 78 from Patent WO0168911. 42 0.48 2
(CC319147) TAM32-26I4_Sp6.1 TAM32 Gallus gallus genomic clon... 40 0.52 3
(BP522733) Hydra magnipapillata cDNA, clone:hmp_20661. 36 0.52 2
(EX650163) 256740308 Pea aphid whole body normalized full le... 36 0.62 2
(FF316223) 280376959 Pea aphid whole body normalized full le... 36 0.68 2
(FF306861) 279367334 Pea aphid whole body normalized full le... 36 0.71 2
(CN757190) ID0AAA1BF01RM1 ApMS Acyrthosiphon pisum cDNA clon... 36 0.78 2
(AM285304) Spiroplasma citri GII3-3X chromosome, contig Cont... 42 0.83 7
(AC178776) Strongylocentrotus purpuratus clone R3-3001J04, W... 38 0.86 5
(EJ650408) 1092953009130 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.87 2
(AU073007) Dictyostelium discoideum slug cDNA, clone SSF701. 42 0.88 2
(AC023913) Arabidopsis thaliana chromosome 1 BAC F7P12 genom... 40 0.93 4
(AB013393) Arabidopsis thaliana genomic DNA, chromosome 5, P... 40 0.94 3
(AK149829) Mus musculus bone marrow macrophage cDNA, RIKEN f... 36 1.0 2
(CO183674) EC26129.5prime Exelixis FlyTag ML01 pSport-Tag21 ... 34 1.3 3
(AW974691) EST386781 MAGE resequences, MAGM Homo sapiens cDN... 34 1.3 2
(AU037469) Dictyostelium discoideum slug cDNA, clone SSD674. 32 1.4 3
(AY875685) Microplitis demolitor bracovirus segment H, compl... 46 1.5 1
(AC156628) Medicago truncatula chromosome 4 clone mth2-131d1... 46 1.5 1
(AB111058) Allium cepa ALL1 gene for alliinase-like, complet... 46 1.5 1
(AC093874) Homo sapiens BAC clone RP11-624O16 from 4, comple... 46 1.5 1
(ER501691) 1093015400743 Global-Ocean-Sampling_GS-35-01-01-1... 46 1.5 1
(EJ664269) 1092955035703 Global-Ocean-Sampling_GS-30-02-01-1... 46 1.5 1
(EJ615839) 1092963016639 Global-Ocean-Sampling_GS-29-01-01-1... 46 1.5 1
(EJ610693) 1092962042368 Global-Ocean-Sampling_GS-29-01-01-1... 46 1.5 1
(EJ601727) 1092961196240 Global-Ocean-Sampling_GS-29-01-01-1... 46 1.5 1
(EJ304114) 1095390063852 Global-Ocean-Sampling_GS-27-01-01-1... 46 1.5 1
(BX901878) Zebrafish DNA sequence from clone DKEY-11O15 in l... 36 1.5 6
(AL929352) Plasmodium falciparum strain 3D7, chromosome 5, s... 32 1.6 8
(AC175515) Bos taurus clone CH240-274B10, WORKING DRAFT SEQU... 38 1.6 3
(AC172178) Atelerix albiventris clone LB4-380F23, WORKING DR... 40 1.7 2
(AX458634) Sequence 180 from Patent WO0246454. 36 1.7 4
(AC105986) Mus musculus chromosome 15, clone RP24-94B11, com... 34 1.8 6
(CU550718) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 42 1.9 4
(AX346069) Sequence 1140 from Patent WO0200928. 38 2.0 2
(CV903190) PD030G6 mycelium, nitrogen starvation Phytophthor... 34 2.0 2
(AC202462) Medicago truncatula clone mth2-119h7, WORKING DRA... 36 2.1 7
(ET741470) CHO_OF247xc22r1.ab1 CHO_OF Nicotiana tabacum geno... 42 2.2 2
(BB979912) Plasmodium berghei strain ANKA cDNA clone:OK01004... 34 2.4 2
(AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 32 2.4 9
(CZ905004) gz29c05.x1.b.screen Soybean methylation filtered ... 34 2.5 2
(ET741687) CHO_OF247xd21r1.ab1 CHO_OF Nicotiana tabacum geno... 42 2.5 2
(DC227831) Plasmodium berghei strain ANKA cDNA clone:SG01026... 34 2.5 2
(BJ332189) Dictyostelium discoideum cDNA clone:dda38c11, 5' ... 32 2.5 3
(BJ331865) Dictyostelium discoideum cDNA clone:dda37h12, 5' ... 32 2.5 3
(ED704269) GM_WBb0048F11.r GM_WBb Glycine max genomic clone ... 36 2.6 2
(BB972557) Plasmodium berghei strain ANKA cDNA clone:OK00227... 34 2.7 2
(BJ335048) Dictyostelium discoideum cDNA clone:dda48a21, 5' ... 32 2.7 3
(DC224232) Plasmodium berghei strain ANKA cDNA clone:MZ00868... 34 2.8 2
(AX344561) Sequence 12 from Patent WO0200932. 34 2.8 8
(AC000059) Homo sapiens BAC clone CTB-128M16 from 7q11.2-q22... 34 2.8 6
(AC165639) Bos taurus clone CH240-167D16, WORKING DRAFT SEQU... 32 2.8 2
(FH330170) CHO_OF4569xh15r1.ab1 CHO_OF4 Nicotiana tabacum ge... 42 2.8 2
(AC170561) Bos taurus clone CH240-242J12, WORKING DRAFT SEQU... 32 2.9 2
(AU051925) Dictyostelium discoideum slug cDNA, clone SSC410. 42 3.0 2
(FH061522) CHO_OF3600xc09r1.ab1 CHO_OF3 Nicotiana tabacum ge... 42 3.0 2
(CP000263) Buchnera aphidicola str. Cc (Cinara cedri), compl... 34 3.1 11
(EV100513) 0181108 Brassica napus Leaf library Brassica napu... 42 3.3 2
(AF309805) Pneumocystis carinii f. sp. carinii glutathione s... 42 3.4 3
(CQ869600) Sequence 21 from Patent WO2004074320. 34 3.5 5
(BB975088) Plasmodium berghei strain ANKA cDNA clone:OK00490... 34 3.5 3
(BJ330448) Dictyostelium discoideum cDNA clone:dda31h18, 5' ... 32 3.6 3
(BJ375516) Dictyostelium discoideum cDNA clone:ddc19c02, 3' ... 34 3.8 2

>(AU053409) Dictyostelium discoideum slug cDNA, clone SLI588.
Length = 380

Score = 607 bits (306), Expect(2) = 0.0
Identities = 306/306 (100%)
Strand = Plus / Plus


Query: 228 tctaaaactataaacactcaattaacttcaaataaagttttcaaaggtcatactaaatca 287
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 tctaaaactataaacactcaattaacttcaaataaagttttcaaaggtcatactaaatca 60


Query: 288 attaaacattttcaagttaaagataatagattagttagtggtggtttagataacaaaatt 347
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 attaaacattttcaagttaaagataatagattagttagtggtggtttagataacaaaatt 120


Query: 348 aaaatttgggatttagataaacctggaaataattatttatacacccttgttggtcattca 407
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 aaaatttgggatttagataaacctggaaataattatttatacacccttgttggtcattca 180


Query: 408 aaaagtgttgattggttagaatttaaaaaagataaattaataagttgttcagctgatcat 467
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aaaagtgttgattggttagaatttaaaaaagataaattaataagttgttcagctgatcat 240


Query: 468 acaattagagtttgggattttaattcgtaaattaaataaaataataatagatttgctttt 527
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 acaattagagtttgggattttaattcgtaaattaaataaaataataatagatttgctttt 300


Query: 528 taatgt 533
||||||
Sbjct: 301 taatgt 306

Score = 79.8 bits (40), Expect(2) = 0.0
Identities = 52/52 (100%)
Strand = Plus / Plus


Query: 555 gggcgacggcngncngctgatcgcaggctcnacgtacgcgtgcatgcggcgt 606
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 328 gggcgacggcngncngctgatcgcaggctcnacgtacgcgtgcatgcggcgt 379

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 734,313,488
Number of extensions: 50998771
Number of successful extensions: 4696422
Number of sequences better than 10.0: 238
Length of query: 606
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 583
Effective length of database: 93,106,754,628
Effective search space: 54281237948124
Effective search space used: 54281237948124
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 6.25
Homology vs Protein
Query= Contig-U09243-1 (Contig-U09243-1Q) /CSM_Contig/Contig-U09243-1Q.Seq.d
(606 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

EU652317_4(EU652317|pid:none) Philodina roseola GTP binding prot... 75 1e-12
T16607(T16607)hypothetical protein K10B2.1 - Caenorhabditis eleg... 74 3e-12
FN357920_1(FN357920|pid:none) Schistosoma mansoni genome sequenc... 72 9e-12
AL953881_1(AL953881|pid:none) Zebrafish DNA sequence from clone ... 71 2e-11
AX722159_1(AX722159|pid:none) Sequence 17 from Patent WO03024999... 71 2e-11
CR859650_1(CR859650|pid:none) Pongo abelii mRNA; cDNA DKFZp459C1... 71 2e-11
AK032174_1(AK032174|pid:none) Mus musculus adult male olfactory ... 71 2e-11
(Q969H0) RecName: Full=F-box/WD repeat-containing protein 7; Alt... 71 2e-11
AK223449_1(AK223449|pid:none) Homo sapiens mRNA for F-box protei... 71 2e-11
AF383178_1(AF383178|pid:none) Homo sapiens F-box protein FBX30 m... 71 2e-11
AK313417_1(AK313417|pid:none) Homo sapiens cDNA, FLJ93955, highl... 71 3e-11
CR749295_1(CR749295|pid:none) Homo sapiens mRNA; cDNA DKFZp781N0... 71 3e-11
AK295870_1(AK295870|pid:none) Homo sapiens cDNA FLJ54002 complet... 71 3e-11
BC123621_1(BC123621|pid:none) Bos taurus beta-transducin repeat ... 71 3e-11
AF112979_1(AF112979|pid:none) Mus musculus beta-transducin repea... 71 3e-11
U63922_1(U63922|pid:none) Xenopus laevis beta-transducin repeat ... 71 3e-11
BC085125_1(BC085125|pid:none) Rattus norvegicus beta-transducin ... 71 3e-11
AF129530_1(AF129530|pid:none) Homo sapiens chromosome 10 F-box p... 71 3e-11
(Q91854) RecName: Full=Beta-TrCP; AltName: Full=Beta-transducin ... 71 3e-11
AB169034_1(AB169034|pid:none) Macaca fascicularis testis cDNA, c... 71 3e-11
U63921_1(U63921|pid:none) Xenopus laevis beta-transducin repeat ... 71 3e-11
AK156660_1(AK156660|pid:none) Mus musculus activated spleen cDNA... 71 3e-11
AF081887_1(AF081887|pid:none) Mus musculus ubiquitin ligase FWD1... 71 3e-11
AY038079_1(AY038079|pid:none) Mus musculus F-box/WD40 repeat-con... 70 3e-11
AB014596_1(AB014596|pid:none) Homo sapiens mRNA for KIAA0696 pro... 70 3e-11
AB093260_1(AB093260|pid:none) Mus musculus mRNA for mKIAA0696 pr... 70 3e-11
(Q9UKB1) RecName: Full=F-box/WD repeat-containing protein 11; Al... 70 3e-11
BC034261_1(BC034261|pid:none) Mus musculus F-box and WD-40 domai... 70 3e-11
AJ721075_1(AJ721075|pid:none) Gallus gallus mRNA for hypothetica... 70 3e-11
AB033279_1(AB033279|pid:none) Homo sapiens BTRCP2 mRNA for F-box... 70 3e-11
AK149139_1(AK149139|pid:none) Mus musculus 2 days neonate sympat... 70 3e-11
CR860672_1(CR860672|pid:none) Pongo abelii mRNA; cDNA DKFZp459M2... 70 5e-11
BC037320_1(BC037320|pid:none) Homo sapiens F-box and WD-40 domai... 70 6e-11
BC056809_1(BC056809|pid:none) Danio rerio F-box and WD-40 domain... 69 1e-10
BC045356_1(BC045356|pid:none) Danio rerio F-box and WD-40 domain... 69 1e-10
CP001037_4818(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 68 2e-10
CU074270_1(CU074270|pid:none) Podospora anserina genomic DNA, NW... 68 2e-10
(Q61FW2) RecName: Full=F-box/WD repeat-containing protein sel-10... 67 4e-10
AB076893_1(AB076893|pid:none) Ciona intestinalis Ci-betaTrCP mRN... 67 4e-10
(Q00659) RecName: Full=Sulfur metabolite repression control prot... 67 5e-10
U21220_1(U21220|pid:none) Emericella nidulans sulfur metabolite ... 67 5e-10
AP007159_126(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 66 7e-10
AM920437_209(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 66 7e-10
AB070844_1(AB070844|pid:none) Aspergillus oryzae sconB gene for ... 66 7e-10
AF032878_1(AF032878|pid:none) Drosophila melanogaster Slimb (sli... 66 9e-10
CP000117_2838(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 66 9e-10
AM920427_1285(AM920427|pid:none) Penicillium chrysogenum Wiscons... 66 9e-10
(Q01277) RecName: Full=Sulfur controller 2; Short=SCON2... 66 9e-10
AE016820_345(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 65 1e-09
CP000828_5917(CP000828|pid:none) Acaryochloris marina MBIC11017,... 65 1e-09
CR382128_858(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 65 2e-09
AM920435_1436(AM920435|pid:none) Penicillium chrysogenum Wiscons... 64 2e-09
AM270009_6(AM270009|pid:none) Aspergillus niger contig An02c0140... 64 3e-09
AF339101_1(AF339101|pid:none) Heterodera glycines beta-transduci... 64 3e-09
CU633900_125(CU633900|pid:none) Podospora anserina genomic DNA c... 63 7e-09
CP000820_6636(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 63 7e-09
CP000117_4653(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 62 9e-09
AP007175_253(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 62 9e-09
CU928165_104(CU928165|pid:none) Kluyveromyces thermotolerans str... 62 9e-09
(Q9VZF4) RecName: Full=F-box/WD repeat-containing protein 7; Alt... 62 9e-09
CP001037_1323(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 62 1e-08
CP000117_1553(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 61 2e-08
FM992688_103(FM992688|pid:none) Candida dubliniensis CD36 chromo... 60 4e-08
CP000828_2434(CP000828|pid:none) Acaryochloris marina MBIC11017,... 60 4e-08
CU633895_601(CU633895|pid:none) Podospora anserina genomic DNA c... 60 5e-08
CR382136_634(CR382136|pid:none) Debaryomyces hansenii strain CBS... 60 5e-08
CP001037_1914(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 60 5e-08
CP001037_1143(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 60 6e-08
AM270005_42(AM270005|pid:none) Aspergillus niger contig An02c010... 60 6e-08
AP007159_390(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 59 8e-08
CR382124_306(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 59 8e-08
CR382138_317(CR382138|pid:none) Debaryomyces hansenii strain CBS... 59 8e-08
CP001037_148(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 59 8e-08
BC045034_1(BC045034|pid:none) Xenopus laevis U5 snRNP-specific 4... 59 1e-07
(Q00808) RecName: Full=Vegetative incompatibility protein HET-E-... 59 1e-07
CR380958_103(CR380958|pid:none) Candida glabrata strain CBS138 c... 59 1e-07
AF323582_1(AF323582|pid:none) Podospora anserina beta transducin... 59 1e-07
A55532(A55532) myosin-heavy-chain kinase (EC 2.7.1.129) A - slim... 59 1e-07
(P39014) RecName: Full=F-box protein MET30; AltName: Full=Methio... 59 1e-07
AF323584_1(AF323584|pid:none) Podospora anserina beta transducin... 59 1e-07
L26505_1(L26505|pid:none) Saccharomyces cerevisiae Met30p gene, ... 59 1e-07
CP001037_247(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 59 1e-07
CP001344_497(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 58 2e-07
CP000117_1538(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 58 2e-07
(Q4P9P9) RecName: Full=Nuclear distribution protein PAC1; AltNam... 58 2e-07
(A8PTE4) RecName: Full=Mitochondrial division protein 1; 58 2e-07
CU074274_1(CU074274|pid:none) Podospora anserina genomic DNA, NW... 58 2e-07
AB174186_1(AB174186|pid:none) Macaca fascicularis brain cDNA clo... 58 2e-07
CU928178_153(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 58 2e-07
FM992693_193(FM992693|pid:none) Candida dubliniensis CD36 chromo... 58 2e-07
(Q6PE01) RecName: Full=U5 small nuclear ribonucleoprotein 40 kDa... 58 2e-07
AF323583_1(AF323583|pid:none) Podospora anserina beta transducin... 58 2e-07
AF083383_1(AF083383|pid:none) Homo sapiens 38kDa splicing factor... 58 2e-07
AP007163_34(AP007163|pid:none) Aspergillus oryzae RIB40 genomic ... 57 3e-07
AJ719967_1(AJ719967|pid:none) Gallus gallus mRNA for hypothetica... 57 3e-07
CP000828_160(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 57 4e-07
(Q9FNZ1) RecName: Full=Zinc finger CCCH domain-containing protei... 57 5e-07
CP000806_3916(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 57 5e-07
CP001291_1208(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 57 5e-07
AM746676_3634(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 57 5e-07
AB015478_6(AB015478|pid:none) Arabidopsis thaliana genomic DNA, ... 57 5e-07
AF1890(AF1890) WD-repeat protein [imported] - Nostoc sp. (strain... 57 5e-07
AM465443_1(AM465443|pid:none) Vitis vinifera contig VV78X139186.... 57 5e-07
AP009552_1750(AP009552|pid:none) Microcystis aeruginosa NIES-843... 56 7e-07
BC077273_1(BC077273|pid:none) Xenopus laevis cDNA clone IMAGE:40... 56 7e-07
AE1810(AE1810) WD-40 repeat protein [imported] - Nostoc sp. (str... 56 7e-07
CP000828_5861(CP000828|pid:none) Acaryochloris marina MBIC11017,... 56 7e-07
(Q4V7Y7) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 56 7e-07
T22703(T22703)hypothetical protein F55B12.3 - Caenorhabditis ele... 56 9e-07
AK098821_1(AK098821|pid:none) Homo sapiens cDNA FLJ25955 fis, cl... 56 9e-07
(Q93794) RecName: Full=F-box/WD repeat-containing protein sel-10... 56 9e-07
(Q8N136) RecName: Full=WD repeat-containing protein 69; &AC0730... 56 9e-07
AK301861_1(AK301861|pid:none) Homo sapiens cDNA FLJ54195 complet... 56 9e-07
AB264260_1(AB264260|pid:none) Cryptomeria japonica CC2196 gene f... 56 9e-07
AB264259_1(AB264259|pid:none) Cryptomeria japonica CC2196 gene f... 56 9e-07
CP000117_2617(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 56 9e-07
BC052124_1(BC052124|pid:none) Danio rerio WD repeat domain 5, mR... 56 9e-07
CP000117_4826(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 55 1e-06
BC041755_1(BC041755|pid:none) Xenopus laevis coatomer protein co... 55 1e-06
(Q0VC24) RecName: Full=Ribosome biogenesis protein WDR12; AltNam... 55 1e-06
AP008207_519(AP008207|pid:none) Oryza sativa (japonica cultivar-... 55 1e-06
(P61480) RecName: Full=Ribosome biogenesis protein WDR12; AltNam... 55 1e-06
AY685231_1(AY685231|pid:none) Neurospora crassa F-box/WD-40 repe... 55 1e-06
AK111592_1(AK111592|pid:none) Oryza sativa Japonica Group cDNA c... 55 1e-06
(P07834) RecName: Full=Cell division control protein 4; AltName:... 55 1e-06
AM920437_2545(AM920437|pid:none) Penicillium chrysogenum Wiscons... 55 2e-06
BC096500_1(BC096500|pid:none) Xenopus tropicalis hypothetical pr... 55 2e-06
BC051783_1(BC051783|pid:none) Danio rerio small nuclear ribonucl... 55 2e-06
BC077844_1(BC077844|pid:none) Xenopus laevis WD repeat domain 5,... 55 2e-06
AK304219_1(AK304219|pid:none) Homo sapiens cDNA FLJ61545 complet... 55 2e-06
FM992695_153(FM992695|pid:none) Candida dubliniensis CD36 chromo... 55 2e-06
BT075125_1(BT075125|pid:none) Osmerus mordax clone omor-eva-518-... 55 2e-06
(P35606) RecName: Full=Coatomer subunit beta'; AltName: Full=Bet... 55 2e-06
(P35605) RecName: Full=Coatomer subunit beta'; AltName: Full=Bet... 55 2e-06
AG2400(AG2400) WD-repeat protein [imported] - Nostoc sp. (strain... 55 2e-06
S35312(S35312;S39811) coatomer complex beta' chain - bovine &X7... 55 2e-06
AM778950_12(AM778950|pid:none) Microcystis aeruginosa PCC 7806 g... 55 2e-06
CP001287_904(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 55 2e-06
(O55029) RecName: Full=Coatomer subunit beta'; AltName: Full=Bet... 55 2e-06
(Q5M786) RecName: Full=WD repeat-containing protein 5; &BC08100... 55 2e-06
AJ011376_1(AJ011376|pid:none) Homo sapiens mRNA for hypothetical... 55 2e-06
AE016820_549(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 55 2e-06
CP000771_1328(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 55 2e-06
AL953896_5(AL953896|pid:none) Zebrafish DNA sequence from clone ... 55 2e-06
CP000393_1374(CP000393|pid:none) Trichodesmium erythraeum IMS101... 55 2e-06
(Q2KIG2) RecName: Full=WD repeat-containing protein 5; &BC11265... 55 2e-06
DQ147949_1(DQ147949|pid:none) Macaca mulatta clone dl1_d21_t7_05... 55 2e-06
CU928176_715(CU928176|pid:none) Zygosaccharomyces rouxii strain ... 55 2e-06
AM437107_2(AM437107|pid:none) Vitis vinifera contig VV78X011831.... 55 2e-06
BC162672_1(BC162672|pid:none) Danio rerio coatomer protein compl... 55 2e-06
CP000089_3569(CP000089|pid:none) Dechloromonas aromatica RCB, co... 54 3e-06
AK001743_1(AK001743|pid:none) Homo sapiens cDNA FLJ10881 fis, cl... 54 3e-06
CP000117_2804(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 54 3e-06
(P87053) RecName: Full=F-box/WD repeat-containing protein pof1; ... 54 3e-06
CP001344_1358(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 54 3e-06
AK144091_1(AK144091|pid:none) Mus musculus RCB-0559 K-1 . F1 cDN... 54 3e-06
AK299489_1(AK299489|pid:none) Homo sapiens cDNA FLJ51286 complet... 54 3e-06
(Q9GZL7) RecName: Full=Ribosome biogenesis protein WDR12; AltNam... 54 3e-06
BT048825_1(BT048825|pid:none) Salmo salar clone ssal-rgb2-587-14... 54 3e-06
(Q6NVM2) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 54 3e-06
(Q5REE6) RecName: Full=Ribosome biogenesis protein WDR12; AltNam... 54 3e-06
(Q9JJA4) RecName: Full=Ribosome biogenesis protein WDR12; AltNam... 54 3e-06
CR380949_26(CR380949|pid:none) Candida glabrata strain CBS138 ch... 54 3e-06
(Q0CJD8) RecName: Full=Mitochondrial division protein 1; 54 3e-06
CR405685_1(CR405685|pid:none) Zebrafish DNA sequence from clone ... 54 3e-06
(Q9C827) RecName: Full=Coatomer subunit beta'-2; AltName: Full=B... 54 3e-06
AY059431_1(AY059431|pid:none) Mus musculus WD repeat domain 12 (... 54 3e-06
(Q9LJR3) RecName: Full=Protein SPA1-RELATED 3; &AP000413_16(AP0... 54 3e-06
CP000828_3398(CP000828|pid:none) Acaryochloris marina MBIC11017,... 54 3e-06
(Q6CJ50) RecName: Full=Mitochondrial division protein 1; &CR382... 54 3e-06
FN392320_711(FN392320|pid:none) Pichia pastoris GS115 chromosome... 54 3e-06
AL022197_19(AL022197|pid:none) Arabidopsis thaliana DNA chromoso... 54 3e-06
CP000844_164(CP000844|pid:none) Acaryochloris marina MBIC11017 p... 54 3e-06
CP000828_20(CP000828|pid:none) Acaryochloris marina MBIC11017, c... 54 3e-06
CP000807_36(CP000807|pid:none) Cyanothece sp. ATCC 51142 linear ... 54 3e-06
CP001037_5630(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 54 4e-06
AP007175_262(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 54 4e-06
(A2R3Z3) RecName: Full=Mitochondrial division protein 1; 54 4e-06
BA000045_4356(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 54 4e-06
T20593(T20593) hypothetical protein F08G12.2 - Caenorhabditis el... 54 4e-06
AC117072_4(AC117072|pid:none) Dictyostelium discoideum chromosom... 54 4e-06
CR382131_627(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 54 4e-06
AM910994_582(AM910994|pid:none) Plasmodium knowlesi strain H chr... 54 4e-06
(Q4P8R5) RecName: Full=Mitochondrial division protein 1; 54 4e-06
AM270325_97(AM270325|pid:none) Aspergillus niger contig An14c018... 54 4e-06
(Q6CB13) RecName: Full=Mitochondrial division protein 1; &CR382... 54 4e-06
CP001101_2134(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 54 4e-06
CR382128_375(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 54 4e-06
CP000117_3846(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 54 4e-06
FN392321_1125(FN392321|pid:none) Pichia pastoris GS115 chromosom... 53 6e-06
(Q2H139) RecName: Full=Mitochondrial division protein 1; 53 6e-06
CP000117_5003(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 53 6e-06
CP001099_1375(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 53 6e-06
BT077645_1(BT077645|pid:none) Lepeophtheirus salmonis clone lsal... 53 6e-06
AP009552_3821(AP009552|pid:none) Microcystis aeruginosa NIES-843... 53 6e-06
AC011717_4(AC011717|pid:none) Arabidopsis thaliana chromosome 1 ... 53 6e-06
AJ010592_156(AJ010592|pid:none) Guillardia theta DNA for complet... 53 6e-06
CP000393_145(CP000393|pid:none) Trichodesmium erythraeum IMS101,... 53 6e-06
(Q94BM7) RecName: Full=Protein SPA1-RELATED 4; &AY040023_1(AY04... 53 6e-06
(Q9CAA0) RecName: Full=Coatomer subunit beta'-1; AltName: Full=B... 53 6e-06
(Q5BJ90) RecName: Full=Ribosome biogenesis protein wdr12; AltNam... 53 6e-06
AM438365_3(AM438365|pid:none) Vitis vinifera contig VV78X052512.... 53 6e-06
(Q8MY12) RecName: Full=Myosin heavy chain kinase C; Sho... 53 7e-06
AF079447_1(AF079447|pid:none) Dictyostelium discoideum myosin he... 53 7e-06
CR382126_1174(CR382126|pid:none) Kluyveromyces lactis strain NRR... 53 7e-06
CP000501_76(CP000501|pid:none) Pichia stipitis CBS 6054 chromoso... 53 7e-06
CP000393_1925(CP000393|pid:none) Trichodesmium erythraeum IMS101... 53 7e-06
CU633454_96(CU633454|pid:none) Podospora anserina genomic DNA ch... 53 7e-06
AM778957_201(AM778957|pid:none) Microcystis aeruginosa PCC 7806 ... 53 7e-06
CP001037_1432(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 53 7e-06
(Q758R7) RecName: Full=Mitochondrial division protein 1; &AE016... 52 1e-05
BA000039_488(BA000039|pid:none) Thermosynechococcus elongatus BP... 52 1e-05
AG1889(AG1889) WD-40 repeat protein [imported] - Nostoc sp. (str... 52 1e-05
(Q6H8D5) RecName: Full=Coatomer subunit beta'-2; AltName: Full=B... 52 1e-05
CP000686_859(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 52 1e-05
CP000820_3699(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 52 1e-05
AP007155_937(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 52 1e-05
BA000045_1965(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 52 1e-05
S62507(T38502;S62507) hypothetical trp-asp repeat-containing pro... 52 1e-05
EF560718_1(EF560718|pid:none) Homo sapiens clone DKFZp781B1145 A... 52 1e-05
AB037997_1(AB037997|pid:none) Danio rerio hagoromo gene, exons 1... 52 1e-05
AJ243007_1(AJ243007|pid:none) Homo sapiens mRNA for apoptotic pr... 52 1e-05
BT047461_1(BT047461|pid:none) Salmo salar clone ssal-rgb2-603-17... 52 1e-05
AP009552_6258(AP009552|pid:none) Microcystis aeruginosa NIES-843... 52 1e-05
CP000806_2172(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 52 1e-05
AJ243008_1(AJ243008|pid:none) Homo sapiens mRNA for apoptotic pr... 52 1e-05
(P74442) RecName: Full=Uncharacterized WD repeat-containing prot... 52 1e-05
CP000117_2488(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 52 1e-05
BC045316_1(BC045316|pid:none) Danio rerio denticleless homolog (... 52 1e-05
CU638744_464(CU638744|pid:none) Podospora anserina genomic DNA c... 52 1e-05
AB007873_1(AB007873|pid:none) Homo sapiens KIAA0413 mRNA, partia... 52 1e-05
CP000854_3359(CP000854|pid:none) Mycobacterium marinum M, comple... 52 1e-05
AL392174_12(AL392174|pid:none) Arabidopsis thaliana DNA chromoso... 52 1e-05
CP000845_57(CP000845|pid:none) Acaryochloris marina MBIC11017 pl... 52 1e-05
CP000117_2178(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 52 2e-05
AX969918_1(AX969918|pid:none) Sequence 721 from Patent EP1104808. 52 2e-05
CR954210_112(CR954210|pid:none) Ostreococcus tauri strain OTTH05... 52 2e-05
CU928169_663(CU928169|pid:none) Kluyveromyces thermotolerans str... 52 2e-05
(Q6P2Y2) RecName: Full=WD repeat-containing protein 69; &BC0642... 52 2e-05
(Q4WT34) RecName: Full=Pre-mRNA-splicing factor prp46; AltName: ... 51 2e-05
(P49695) RecName: Full=Probable serine/threonine-protein kinase ... 51 2e-05
AP009552_5466(AP009552|pid:none) Microcystis aeruginosa NIES-843... 51 2e-05
(Q2UGU1) RecName: Full=Nuclear distribution protein nudF homolog; 51 2e-05
(Q5FWQ6) RecName: Full=WD repeat-containing protein 69; &BC0892... 51 2e-05
CP001291_1144(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 51 2e-05
(Q55AR8) RecName: Full=U5 small nuclear ribonucleoprotein 40 kDa... 51 2e-05
AY738474_1(AY738474|pid:none) Gemmata sp. Wa1-1 WD-repeat protei... 51 2e-05
(O62621) RecName: Full=Coatomer subunit beta'; AltName: Full=Bet... 51 2e-05
AJ006523_1(AJ006523|pid:none) Drosophila melanogaster mRNA for t... 51 2e-05
CU633438_311(CU633438|pid:none) Podospora anserina genomic DNA c... 51 2e-05
(Q54YD8) RecName: Full=Coatomer subunit beta'; AltName: Full=Bet... 51 2e-05
BA000045_2244(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 51 2e-05
AP007157_632(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 51 2e-05
(O94244) RecName: Full=Histone acetyltransferase type B subunit ... 51 2e-05
AM472166_2(AM472166|pid:none) Vitis vinifera contig VV78X131919.... 51 2e-05
AM270259_12(AM270259|pid:none) Aspergillus niger contig An12c002... 51 2e-05
(Q9D994) RecName: Full=WD repeat-containing protein 38; &AK0072... 51 3e-05
AI2493(AI2493) WD-repeat protein [imported] - Nostoc sp. (strain... 51 3e-05
CP000820_1838(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 51 3e-05
DQ363460_1(DQ363460|pid:none) Ictalurus punctatus clone C145DB06... 51 3e-05
(Q5AXW3) RecName: Full=Mitochondrial division protein 1; 51 3e-05
FN357292_141(FN357292|pid:none) Schistosoma mansoni genome seque... 51 3e-05
BT087438_1(BT087438|pid:none) Zea mays full-length cDNA clone ZM... 51 3e-05
DQ158857_76(DQ158857|pid:none) Bigelowiella natans nucleomorph c... 51 3e-05
AL844505_66(AL844505|pid:none) Plasmodium falciparum 3D7 chromos... 51 3e-05
AM778930_22(AM778930|pid:none) Microcystis aeruginosa PCC 7806 g... 51 3e-05
AP008216_940(AP008216|pid:none) Oryza sativa (japonica cultivar-... 51 3e-05
CU928165_162(CU928165|pid:none) Kluyveromyces thermotolerans str... 51 3e-05
AJ720686_1(AJ720686|pid:none) Gallus gallus mRNA for hypothetica... 51 3e-05
AY457171_1(AY457171|pid:none) Leishmania amazonensis antigenic W... 51 3e-05
AH2195(AH2195) hypothetical protein alr3119 [imported] - Nostoc ... 51 3e-05
AM920431_458(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 51 3e-05
CP000771_798(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 51 3e-05
AY485643_1(AY485643|pid:none) Hordeum vulgare subsp. vulgare BAC... 50 4e-05
CR382135_172(CR382135|pid:none) Debaryomyces hansenii strain CBS... 50 4e-05
AE017347_238(AE017347|pid:none) Cryptococcus neoformans var. neo... 50 4e-05
CU633901_36(CU633901|pid:none) Podospora anserina genomic DNA ch... 50 4e-05
(Q13033) RecName: Full=Striatin-3; AltName: Full=Cell-cycle auto... 50 4e-05
FB841852_1(FB841852|pid:none) Sequence 61125 from Patent WO20080... 50 4e-05
CU633900_158(CU633900|pid:none) Podospora anserina genomic DNA c... 50 4e-05
AK290229_1(AK290229|pid:none) Homo sapiens cDNA FLJ77970 complet... 50 4e-05
FB841850_1(FB841850|pid:none) Sequence 61123 from Patent WO20080... 50 4e-05
(Q5BK30) RecName: Full=WD repeat-containing protein 69; &BC0912... 50 4e-05
AC003974_17(AC003974|pid:none) Arabidopsis thaliana chromosome 2... 50 4e-05
BT075698_1(BT075698|pid:none) Osmerus mordax clone omor-rgc-001-... 50 4e-05
JC2522(JC2522) nuclear autoantigen - human &U17989_1(U17989|pid... 50 4e-05
AP007169_506(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 50 4e-05
AB264266_1(AB264266|pid:none) Chamaecyparis obtusa CC2196 gene f... 50 4e-05
AB018110_4(AB018110|pid:none) Arabidopsis thaliana genomic DNA, ... 50 5e-05
AP007169_287(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 50 5e-05
AP007166_377(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 50 5e-05
FM992695_539(FM992695|pid:none) Candida dubliniensis CD36 chromo... 50 5e-05
(Q5K9G0) RecName: Full=Mitochondrial division protein 1; &AE017... 50 5e-05
CP000828_671(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 50 5e-05
CP001037_1497(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 50 5e-05
AJ243107_1(AJ243107|pid:none) Homo sapiens mRNA for apoptotic pr... 50 5e-05
CP000828_167(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 50 5e-05
(Q2U5Z8) RecName: Full=Mitochondrial division protein 1; 50 5e-05
AC144617_18(AC144617|pid:none) Medicago truncatula clone mth2-7m... 50 5e-05
AB264261_1(AB264261|pid:none) Thujopsis dolabrata CC2196 gene fo... 50 5e-05
(Q8H0T9) RecName: Full=Katanin p80 WD40 repeat-containing subuni... 50 5e-05
(Q93847) RecName: Full=Uncharacterized WD repeat-containing prot... 50 6e-05
(O15736) RecName: Full=Protein tipD; &AF019236_1(AF019236|pid:n... 50 6e-05
AM746676_8405(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 50 6e-05
AF016369_1(AF016369|pid:none) Homo sapiens U4/U6 small nuclear r... 50 6e-05
AL449305_7(AL449305|pid:none) Human DNA sequence from clone RP11... 50 6e-05
CP000581_249(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 50 6e-05
AY597210_1(AY597210|pid:none) Chlamydomonas reinhardtii katanin ... 50 6e-05
AK313131_1(AK313131|pid:none) Homo sapiens cDNA, FLJ93619, highl... 50 6e-05
(Q3MHE2) RecName: Full=U4/U6 small nuclear ribonucleoprotein Prp... 50 6e-05
AP007175_233(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 50 6e-05
EF677745_1(EF677745|pid:none) Picea sitchensis clone WS02774_D16... 50 6e-05
CR457105_1(CR457105|pid:none) Homo sapiens full open reading fra... 50 6e-05
CU633453_76(CU633453|pid:none) Podospora anserina genomic DNA ch... 50 6e-05
CR382129_201(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 49 8e-05
(Q9EPV5) RecName: Full=Apoptotic protease-activating factor 1; ... 49 8e-05
FN392319_485(FN392319|pid:none) Pichia pastoris GS115 chromosome... 49 8e-05
AM462218_2(AM462218|pid:none) Vitis vinifera contig VV78X125617.... 49 8e-05
CP000839_311(CP000839|pid:none) Acaryochloris marina MBIC11017 p... 49 8e-05
AE014188_361(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 49 8e-05
BC031227_1(BC031227|pid:none) Homo sapiens WD repeat domain 88, ... 49 8e-05
EU049596_1(EU049596|pid:none) Branchiostoma floridae Bf-TIR-NBAR... 49 8e-05
AM494967_151(AM494967|pid:none) Leishmania braziliensis chromoso... 49 8e-05
AC007067_21(AC007067|pid:none) Genomic sequence for Arabidopsis ... 49 8e-05
AE016818_787(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 49 8e-05
BT080509_1(BT080509|pid:none) Caligus clemensi clone ccle-evs-50... 49 8e-05
CP001574_321(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 49 8e-05
AE017341_662(AE017341|pid:none) Cryptococcus neoformans var. neo... 49 8e-05
(Q6CKE8) RecName: Full=Pre-mRNA-splicing factor PRP46; AltName: ... 49 8e-05
BC148666_1(BC148666|pid:none) Synthetic construct Homo sapiens c... 49 8e-05
AF323585_1(AF323585|pid:none) Podospora anserina beta transducin... 49 8e-05
(Q6ZMY6) RecName: Full=WD repeat-containing protein 88; AltName:... 49 8e-05
AL939118_27(AL939118|pid:none) Streptomyces coelicolor A3(2) com... 49 8e-05
(Q8I0F4) RecName: Full=Lissencephaly-1 homolog; AltName: Full=Dd... 49 8e-05
AK016201_1(AK016201|pid:none) Mus musculus adult male testis cDN... 49 1e-04
(Q8BG40) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 49 1e-04
(Q9BVA0) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 49 1e-04
AM920436_1182(AM920436|pid:none) Penicillium chrysogenum Wiscons... 49 1e-04
AK010364_1(AK010364|pid:none) Mus musculus ES cells cDNA, RIKEN ... 49 1e-04
CP001037_5275(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 49 1e-04
AP007164_475(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 49 1e-04
AK220340_1(AK220340|pid:none) Mus musculus mRNA for mKIAA0413 pr... 49 1e-04
BC149991_1(BC149991|pid:none) Bos taurus katanin p80 (WD repeat ... 49 1e-04
AX969973_1(AX969973|pid:none) Sequence 776 from Patent EP1104808. 49 1e-04
BC131683_1(BC131683|pid:none) Mus musculus apoptotic peptidase a... 49 1e-04
CP000828_3726(CP000828|pid:none) Acaryochloris marina MBIC11017,... 49 1e-04
(A7THX0) RecName: Full=Mitochondrial division protein 1; 49 1e-04
AK131383_1(AK131383|pid:none) Homo sapiens cDNA FLJ16457 fis, cl... 49 1e-04
(Q9AUR7) RecName: Full=Coatomer subunit alpha-2; AltName: Full=A... 49 1e-04
(Q5ZIU8) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 49 1e-04
AK031630_1(AK031630|pid:none) Mus musculus 13 days embryo male t... 49 1e-04
AY891382_1(AY891382|pid:none) Synthetic construct Homo sapiens c... 49 1e-04
DQ410670_1(DQ410670|pid:none) Gallus gallus brain p80 katanin mR... 49 1e-04
AM502224_3(AM502224|pid:none) Leishmania infantum chromosome 6. 49 1e-04
AE016818_604(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 49 1e-04
BC138055_1(BC138055|pid:none) Mus musculus striatin, calmodulin ... 49 1e-04
(Q9SJT9) RecName: Full=Coatomer subunit alpha-2; AltName: Full=A... 49 1e-04
S19487(S19487;S26657)hypothetical protein YCR072c - yeast (Sacch... 49 1e-04
FB841858_1(FB841858|pid:none) Sequence 61131 from Patent WO20080... 49 1e-04
AC007259_17(AC007259|pid:none) Arabidopsis thaliana chromosome I... 49 1e-04
AY814155_1(AY814155|pid:none) Schistosoma japonicum SJCHGC06272 ... 49 1e-04
AP003216_12(AP003216|pid:none) Oryza sativa Japonica Group genom... 49 1e-04
CU928169_422(CU928169|pid:none) Kluyveromyces thermotolerans str... 49 1e-04
(Q5KDT9) RecName: Full=Histone acetyltransferase type B subunit ... 49 1e-04
CU928165_278(CU928165|pid:none) Kluyveromyces thermotolerans str... 49 1e-04
AP008207_1800(AP008207|pid:none) Oryza sativa (japonica cultivar... 49 1e-04
(Q9FUY2) RecName: Full=Transcriptional corepressor LEUNIG; 49 1e-04
AP007169_1(AP007169|pid:none) Aspergillus oryzae RIB40 genomic D... 49 1e-04
AB095735_1(AB095735|pid:none) Mus musculus ramp mRNA for retinoi... 49 1e-04
(Q9ERG2) RecName: Full=Striatin-3; AltName: Full=Cell-cycle auto... 49 1e-04
AM494961_234(AM494961|pid:none) Leishmania braziliensis chromoso... 49 1e-04
CP001097_2083(CP001097|pid:none) Chlorobium limicola DSM 245, co... 49 1e-04
AH2154(AH2154) WD-repeat protein [imported] - Nostoc sp. (strain... 49 1e-04
AB264263_1(AB264263|pid:none) Chamaecyparis pisifera CC2196 gene... 49 1e-04
AK226299_1(AK226299|pid:none) Arabidopsis thaliana mRNA for hypo... 49 1e-04
AC087851_1(AC087851|pid:none) Oryza sativa chromosome 3 BAC OSJN... 49 1e-04
AK111863_1(AK111863|pid:none) Oryza sativa Japonica Group cDNA c... 49 1e-04
AM989989_35(AM989989|pid:none) Zygosaccharomyces rouxii strain C... 49 1e-04
(P25382) RecName: Full=WD repeat-containing protein YCR072C; &A... 49 1e-04
AD1842(AD1842) WD-40 repeat protein [imported] - Nostoc sp. (str... 48 2e-04
AC149637_4(AC149637|pid:none) Medicago truncatula clone mth2-181... 48 2e-04
EF083131_1(EF083131|pid:none) Picea sitchensis clone WS02722_J02... 48 2e-04
AK303346_1(AK303346|pid:none) Homo sapiens cDNA FLJ53398 complet... 48 2e-04
X89514_24(X89514|pid:none) S.cerevisiae DNA from chromosome XII ... 48 2e-04
EU315009_1(EU315009|pid:none) Carassius auratus S/G2 nuclear aut... 48 2e-04
AP002523_16(AP002523|pid:none) Oryza sativa Japonica Group genom... 48 2e-04
AC146745_23(AC146745|pid:none) Medicago truncatula clone mth2-53... 48 2e-04
(Q55FR9) RecName: Full=Coatomer subunit alpha; AltName: Full=Alp... 48 2e-04
CP000839_340(CP000839|pid:none) Acaryochloris marina MBIC11017 p... 48 2e-04
AK122062_1(AK122062|pid:none) Oryza sativa Japonica Group cDNA c... 48 2e-04
(Q12220) RecName: Full=U3 small nucleolar RNA-associated protein... 48 2e-04
AK000742_1(AK000742|pid:none) Homo sapiens cDNA FLJ20735 fis, cl... 48 2e-04
AF195765_1(AF195765|pid:none) Homo sapiens L2DTL protein (L2DTL)... 48 2e-04
CP001099_247(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 48 2e-04
AX213281_1(AX213281|pid:none) Sequence 1 from Patent WO0159115. 48 2e-04
AL592297_1(AL592297|pid:none) Human DNA sequence from clone RP11... 48 2e-04
AE016816_370(AE016816|pid:none) Ashbya gossypii (= Eremothecium ... 48 2e-04
BT071278_1(BT071278|pid:none) Picea sitchensis clone WS02817_P12... 48 2e-04
(A6ZQL5) RecName: Full=Mitochondrial division protein 1; AltName... 48 2e-04
CP000117_173(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 48 2e-04
(Q0J3D9) RecName: Full=Coatomer subunit alpha-3; AltName: Full=A... 48 2e-04
(Q54R82) RecName: Full=Mitogen-activated protein kinase kinase k... 48 2e-04
FM992693_201(FM992693|pid:none) Candida dubliniensis CD36 chromo... 48 2e-04
CP000501_12(CP000501|pid:none) Pichia stipitis CBS 6054 chromoso... 48 2e-04
DQ151642_1(DQ151642|pid:none) Chlamydomonas reinhardtii WD repea... 48 2e-04
AC091787_21(AC091787|pid:none) Oryza sativa (japonica cultivar-g... 48 2e-04
EF146589_1(EF146589|pid:none) Populus trichocarpa clone WS01210_... 48 2e-04
AB025603_14(AB025603|pid:none) Arabidopsis thaliana genomic DNA,... 48 2e-04
AL772282_6(AL772282|pid:none) Mouse DNA sequence from clone RP23... 48 2e-04
AK090114_1(AK090114|pid:none) Mus musculus RCB-1283 B16 melanoma... 48 2e-04
AL732349_11(AL732349|pid:none) Oryza sativa genomic DNA, chromos... 48 2e-04
AK109741_1(AK109741|pid:none) Oryza sativa Japonica Group cDNA c... 48 2e-04
AL606668_18(AL606668|pid:none) Oryza sativa genomic DNA, chromos... 48 2e-04
CP000492_814(CP000492|pid:none) Chlorobium phaeobacteroides DSM ... 48 2e-04
AM269894_94(AM269894|pid:none) Eimeria tenella chromosome 1, ord... 48 2e-04
BC077858_1(BC077858|pid:none) Xenopus laevis striatin, calmoduli... 48 2e-04
CP000883_38(CP000883|pid:none) Hemiselmis andersenii chromosome ... 48 2e-04
(Q8BHD1) RecName: Full=WD repeat-containing protein 51B; &AK045... 48 2e-04
(Q6C709) RecName: Full=Pre-mRNA-splicing factor PRP46; AltName: ... 48 2e-04
(Q9DAW6) RecName: Full=U4/U6 small nuclear ribonucleoprotein Prp... 48 2e-04
CR380947_110(CR380947|pid:none) Candida glabrata strain CBS138 c... 48 2e-04
CP000498_207(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 48 2e-04
AE014187_454(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 48 2e-04
(Q94A40) RecName: Full=Coatomer subunit alpha-1; AltName: Full=A... 48 2e-04
AF410311_1(AF410311|pid:none) Arabidopsis thaliana AT3g18860/MCB... 48 2e-04
CR382129_35(CR382129|pid:none) Yarrowia lipolytica strain CLIB12... 48 2e-04
GM960771_1(GM960771|pid:none) Sequence 7725 from Patent WO200814... 48 2e-04
AJ243006_1(AJ243006|pid:none) Homo sapiens mRNA for apoptotic pr... 48 2e-04
(Q7ZUV2) RecName: Full=Katanin p80 WD40-containing subunit B1; ... 47 3e-04
AK087389_1(AK087389|pid:none) Mus musculus 0 day neonate eyeball... 47 3e-04
BT078446_1(BT078446|pid:none) Lepeophtheirus salmonis clone lsal... 47 3e-04
FN314118_1(FN314118|pid:none) Schistosoma japonicum isolate Anhu... 47 3e-04
CP001344_3209(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 47 3e-04
AJ580822_1(AJ580822|pid:none) Lotus corniculatus var. japonicus ... 47 3e-04
FN392321_803(FN392321|pid:none) Pichia pastoris GS115 chromosome... 47 3e-04
BT041932_1(BT041932|pid:none) Zea mays full-length cDNA clone ZM... 47 3e-04
FM992691_442(FM992691|pid:none) Candida dubliniensis CD36 chromo... 47 3e-04
AL389891_1(AL389891|pid:none) Neurospora crassa DNA linkage grou... 47 3e-04
AY812578_1(AY812578|pid:none) Schistosoma japonicum SJCHGC09556 ... 47 3e-04
A96638(A96638) hypothetical protein F11P17.7 [imported] - Arabid... 47 3e-04
(Q7RY30) RecName: Full=Nuclear distribution protein pac-1a; AltN... 47 3e-04
FN317489_1(FN317489|pid:none) Schistosoma japonicum isolate Anhu... 47 3e-04
AE017346_214(AE017346|pid:none) Cryptococcus neoformans var. neo... 47 3e-04
CR940353_254(CR940353|pid:none) Theileria annulata strain Ankara... 47 3e-04
GM960745_1(GM960745|pid:none) Sequence 7699 from Patent WO200814... 47 3e-04
CP000842_108(CP000842|pid:none) Acaryochloris marina MBIC11017 p... 47 3e-04
AE014134_53(AE014134|pid:none) Drosophila melanogaster chromosom... 47 3e-04
BC075548_1(BC075548|pid:none) Xenopus tropicalis MGC89488 protei... 47 3e-04
AP009552_1527(AP009552|pid:none) Microcystis aeruginosa NIES-843... 47 3e-04
FN357341_7(FN357341|pid:none) Schistosoma mansoni genome sequenc... 47 3e-04
EU974165_1(EU974165|pid:none) Zea mays clone 441488 pre-mRNA-spl... 47 3e-04
CR954209_40(CR954209|pid:none) Ostreococcus tauri strain OTTH059... 47 3e-04
AJ719451_1(AJ719451|pid:none) Gallus gallus mRNA for hypothetica... 47 3e-04
CP000496_271(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 47 4e-04
AK166351_1(AK166351|pid:none) Mus musculus mammary gland RCB-052... 47 4e-04
AF064071_1(AF064071|pid:none) Mus musculus apoptotic protease ac... 47 4e-04
CT005267_146(CT005267|pid:none) Leishmania major strain Friedlin... 47 4e-04
AM270178_91(AM270178|pid:none) Aspergillus niger contig An08c023... 47 4e-04
(Q3TLR7) RecName: Full=Denticleless protein homolog; AltName: Fu... 47 4e-04
AF052432_1(AF052432|pid:none) Homo sapiens katanin p80 subunit m... 47 4e-04
FN357354_71(FN357354|pid:none) Schistosoma mansoni genome sequen... 47 4e-04
BC097560_1(BC097560|pid:none) Xenopus laevis hypothetical protei... 47 4e-04
AL391737_131(AL391737|pid:none) chromosome I of strain GB-M1 of ... 47 4e-04
(O88879) RecName: Full=Apoptotic protease-activating factor 1; ... 47 4e-04
CP000383_3602(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 47 4e-04
CR382135_388(CR382135|pid:none) Debaryomyces hansenii strain CBS... 47 4e-04
CP000393_3212(CP000393|pid:none) Trichodesmium erythraeum IMS101... 47 4e-04
AK161401_1(AK161401|pid:none) Mus musculus adult male testis cDN... 47 4e-04
AC1842(AC1842) WD-40 repeat protein [imported] - Nostoc sp. (str... 47 4e-04
(Q6S003) RecName: Full=Kinesin-related protein 8; AltName: Full=... 47 4e-04
(Q20168) RecName: Full=Probable coatomer subunit beta'; AltName:... 47 4e-04
CP000584_157(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 47 4e-04
AK292343_1(AK292343|pid:none) Homo sapiens cDNA FLJ77821 complet... 47 5e-04
CP001110_343(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 47 5e-04
(P58405) RecName: Full=Striatin-3; AltName: Full=Cell-cycle auto... 47 5e-04
CU928168_461(CU928168|pid:none) Kluyveromyces thermotolerans str... 47 5e-04
(Q10272) RecName: Full=Pre-rRNA-processing protein crb3/ipi3; &... 47 5e-04
BX294026_14(BX294026|pid:none) Neurospora crassa DNA linkage gro... 47 5e-04
CR380957_5(CR380957|pid:none) Candida glabrata strain CBS138 chr... 47 5e-04
BT039976_1(BT039976|pid:none) Zea mays full-length cDNA clone ZM... 47 5e-04
AC159435_6(AC159435|pid:none) Trypanosoma brucei chromosome 8 cl... 47 5e-04
(Q7S7L4) RecName: Full=Nuclear distribution protein pac-1b; AltN... 47 5e-04
CP000471_286(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 47 5e-04
EU975702_1(EU975702|pid:none) Zea mays clone 497406 ubiquitin li... 47 5e-04
CR382137_891(CR382137|pid:none) Debaryomyces hansenii strain CBS... 47 5e-04
BT088239_1(BT088239|pid:none) Zea mays full-length cDNA clone ZM... 47 5e-04
AE017352_159(AE017352|pid:none) Cryptococcus neoformans var. neo... 47 5e-04
BC140553_1(BC140553|pid:none) Bos taurus striatin, calmodulin bi... 47 5e-04
AP003216_11(AP003216|pid:none) Oryza sativa Japonica Group genom... 47 5e-04
AP003224_20(AP003224|pid:none) Oryza sativa Japonica Group genom... 47 5e-04
AY648754_1(AY648754|pid:none) Danio rerio cotamer alpha mRNA, co... 47 5e-04
CT573083_1(CT573083|pid:none) Zebrafish DNA sequence from clone ... 47 5e-04
AP008207_1799(AP008207|pid:none) Oryza sativa (japonica cultivar... 47 5e-04
(B5DG67) RecName: Full=Ribosome biogenesis protein wdr12; AltNam... 47 5e-04
BC098861_1(BC098861|pid:none) Rattus norvegicus TAF5-like RNA po... 46 7e-04
CP001037_2020(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 46 7e-04
(Q8YTC2) RecName: Full=Uncharacterized WD repeat-containing prot... 46 7e-04
(Q5JTN6) RecName: Full=WD repeat-containing protein 38; &AL3549... 46 7e-04
CP000589_46(CP000589|pid:none) Ostreococcus lucimarinus CCE9901 ... 46 7e-04
EF144965_1(EF144965|pid:none) Populus trichocarpa clone WS0111_D... 46 7e-04

>EU652317_4(EU652317|pid:none) Philodina roseola GTP binding
protein, beta prime coatomer protein complex subunit,
GPCR, beta-transducin repeat containing protein,
speckle-type POZ protein, adenosine kinase, prefoldin
subunit 1, translation initiation factor eIF-4E, Rho
GTPase activating protein, histone H4, histone H3,
histone H2B, histone H2Av, cleft lip and palate
associated transmembrane protein, mitochondrial
ribosomal protein s22, ribosomal protein s15a,
hypothetical protein 20, START domain containing
protein, and filament protein genes, complete cds.
Length = 485

Score = 75.5 bits (184), Expect = 1e-12
Identities = 42/154 (27%), Positives = 81/154 (52%), Gaps = 1/154 (0%)
Frame = +3

Query: 27 VASGHDDGSIGVWNMRTGTLQATLSNPLSKAVWHIQFRNNVIYT-SSENNLYSWNLNIAD 203
+ +G D ++ VWN++TG L TL + +AV H++F + ++ T S + ++ W +N +
Sbjct: 243 IVTGSSDSTVRVWNVKTGELINTLLHHC-EAVLHLRFADGLMVTCSKDRSIAVWQMNSS- 300

Query: 204 GSDSXXXXSKTINTQLTSNKVFKGHTKSIKHFQVKDNRLVSGGLDNKIKIWDLDKPGNNY 383
+T +V GH ++ + +VS D IK+WD +
Sbjct: 301 -------------LDITIKRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVWDTTTC--EF 345

Query: 384 LYTLVGHSKSVDWLEFKKDKLISCSADHTIRVWD 485
+ TL+GH + + L+++ + ++S S+D+TIR+WD
Sbjct: 346 VRTLLGHKRGIACLQYRDNIVVSGSSDNTIRIWD 379

Score = 57.4 bits (137), Expect = 3e-07
Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 7/161 (4%)
Frame = +3

Query: 27 VASGHDDGSIGVWNMRTGTLQATLSNPLSKAVWHIQFRNNVIYT-SSENNLYSWNLNIAD 203
+ S D +I VW+ T TL + + +Q+R+N++ + SS+N + W++
Sbjct: 326 IVSASGDRTIKVWDTTTCEFVRTLLGH-KRGIACLQYRDNIVVSGSSDNTIRIWDIECG- 383

Query: 204 GSDSXXXXSKTINTQLTSNKVFKGHTKSIKHFQVKDNRLVSGGLDNKIKIWDL------D 365
++ +GH + ++ + R+VSG D KIKIWDL
Sbjct: 384 ----------------ACLRILEGHDELVRCIRFDSKRIVSGAYDGKIKIWDLVAALDPR 427

Query: 366 KPGNNYLYTLVGHSKSVDWLEFKKDKLISCSADHTIRVWDF 488
+ + TL H+ V L+F + +++S S D TI ++F
Sbjct: 428 SQSSLCIRTLTEHTGRVFRLQFDEFQIVSSSHDDTILCFNF 468

Score = 51.6 bits (122), Expect = 2e-05
Identities = 38/147 (25%), Positives = 67/147 (45%), Gaps = 4/147 (2%)
Frame = +3

Query: 66 NMRTGTLQAT---LSNPLSKAVWHIQFRNNVIYTS-SENNLYSWNLNIADGSDSXXXXSK 233
N RTG Q + SK V+ +Q+ + I + +N + WN ++
Sbjct: 172 NWRTGNFQLEKIQCRSQNSKGVYCLQYDDEKIVSGLRDNTIKIWNRKTSE---------- 221

Query: 234 TINTQLTSNKVFKGHTKSIKHFQVKDNRLVSGGLDNKIKIWDLDKPGNNYLYTLVGHSKS 413
+V GH S+ Q + +V+G D+ +++W++ K G + TL+ H ++
Sbjct: 222 -------CVQVLTGHNGSVLCLQYDEQIIVTGSSDSTVRVWNV-KTGE-LINTLLHHCEA 272

Query: 414 VDWLEFKKDKLISCSADHTIRVWDFNS 494
V L F +++CS D +I VW NS
Sbjct: 273 VLHLRFADGLMVTCSKDRSIAVWQMNS 299

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 841,916,481
Number of extensions: 15442180
Number of successful extensions: 53947
Number of sequences better than 10.0: 2519
Number of HSP's gapped: 50156
Number of HSP's successfully gapped: 4346
Length of query: 202
Length of database: 1,040,966,779
Length adjustment: 122
Effective length of query: 80
Effective length of database: 650,044,009
Effective search space: 52003520720
Effective search space used: 52003520720
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

PSORT

psg: 0.72 gvh: 0.48 alm: 0.56 top: 0.53 tms: 0.00 mit: 0.23 mip: 0.02
nuc: 0.00 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

52.0 %: nuclear
28.0 %: cytoplasmic
12.0 %: mitochondrial
8.0 %: cytoskeletal

>> prediction for Contig-U09243-1 is nuc

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 1
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0