Contig-U09219-1 |
Contig ID |
Contig-U09219-1 |
Contig update |
2002. 9.13 |
Contig sequence |
|
Gap |
gap included |
Contig length |
1566 |
Chromosome number (1..6, M) |
6 |
Chromosome length |
3595308 |
Start point |
2164481 |
End point |
2162914 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
7 |
Number of EST |
8 |
Link to clone list |
U09219 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.10 |
Homology vs CSM-cDNA |
|
dna update |
2008.11.15 |
Homology vs DNA |
Query= Contig-U09219-1 (Contig-U09219-1Q) /CSM_Contig/Contig-U09219-1Q.Seq.d (1576 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ435601) Dictyostelium discoideum cDNA clone:ddv27k15, 3' ... 1136 0.0 3 (BJ345784) Dictyostelium discoideum cDNA clone:dda28f23, 3' ... 1098 0.0 3 (AU271353) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 743 0.0 2 (BJ325959) Dictyostelium discoideum cDNA clone:dda3m03, 5' e... 708 0.0 2 (BJ411024) Dictyostelium discoideum cDNA clone:ddv2p18, 5' e... 696 0.0 1 (AU062005) Dictyostelium discoideum slug cDNA, clone SLH167. 563 0.0 2 (AU039217) Dictyostelium discoideum slug cDNA, clone SLH167. 527 e-145 1 (DV944286) Cm_mx1_11d01_SP6 Green Shore Crab Multiple Tissue... 84 3e-23 3 (FC815937) Sr_pAMT7_04k03_T7 S. ratti mixed stage pAMP Stron... 52 1e-16 6 (AF494043) Physarum polycephalum chaperonin containing TCP-1... 46 3e-15 6 (FD455194) EGGB003TR Haematobia irritans eggs Haematobia irr... 70 3e-15 4 (FE233175) CAPG2143.fwd CAPG Naegleria gruberi amoeba stage ... 52 1e-14 4 (FC820384) Sr_pAMT7_017i18_T7 S. ratti mixed stage pAMP Stro... 52 2e-14 5 (FE246207) CAPG9297.fwd CAPG Naegleria gruberi amoeba stage ... 52 2e-14 4 (FE232479) CAPG1770.fwd CAPG Naegleria gruberi amoeba stage ... 52 2e-14 4 (FD463661) LARW080TR Haematobia irritans 1st Instar Larvae H... 78 4e-14 3 (FD457058) EGGBB58TR Haematobia irritans eggs Haematobia irr... 78 5e-14 3 (CT837212) Oryza sativa (indica cultivar-group) cDNA clone:O... 46 4e-13 6 (FE236993) CAPG416.fwd CAPG Naegleria gruberi amoeba stage N... 52 8e-13 4 (FC819114) Sr_pAMT7_013o03_T7 S. ratti mixed stage pAMP Stro... 48 8e-13 3 (FC819567) Sr_pAMT7_015d07_T7 S. ratti mixed stage pAMP Stro... 48 8e-13 3 (CD420780) ku91d08.y1 Strongyloides ratti PA female naive pA... 48 8e-13 3 (BI515354) BB160019A10G09.5 Bee Brain Normalized Library, BB... 68 8e-13 3 (DB752439) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB746254) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB730747) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB731404) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB746598) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB729013) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB750694) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB729029) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB746223) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB735529) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB751218) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB731484) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (DB742423) Apis mellifera head cDNA, RIKEN full-length enric... 68 8e-13 3 (FE234786) CAPG3009.fwd CAPG Naegleria gruberi amoeba stage ... 52 8e-13 4 (EH283119) Q1_Reed_UM_Mg_cDNA1_06_66B09.F 14d_emb Meleagris ... 64 4e-12 3 (EX718916) Q3_Reed_Cardiac_1d_16wk_02_F11_166.F 1d_16wk_card... 64 4e-12 3 (EH283700) Q1_Reed_um_mg_cDNA1_02_72H09.F 14d_emb Meleagris ... 64 4e-12 3 (EX718064) Q2_Reed_Cardiac_1d16wk_08_M20_317.F 1d_16wk_cardi... 64 5e-12 3 (FG183404) AGN_PNL206df1_a9.trimmed.seq AGN_PNL Nicotiana ta... 68 5e-12 3 (EH283987) Q2_Reed_UM_Mg_cDNA1_05_40H05.F 14d_emb Meleagris ... 64 5e-12 3 (EH293761) Q4_Reed_18d_tembryo_07_F24_374.F 14d_emb Meleagri... 64 5e-12 3 (EH293009) Q3_Reed_18d_tembryo_04_B11_162.F 14d_emb Meleagri... 64 5e-12 3 (EH293346) Q4_Reed_18d_tembryo_02_P14_224.F 14d_emb Meleagri... 64 5e-12 3 (EH292203) Q2_Reed_18d_tembryo_01_G10_151.F 14d_emb Meleagri... 64 5e-12 3 (EH292491) Q2_Reed_18d_tembryo_05_E04_053.F 14d_emb Meleagri... 64 5e-12 3 (EH291678) Q1_Reed_18d_tembryo_01_C19_291.F 14d_emb Meleagri... 64 6e-12 3 (EH292325) Q2_Reed_18d_tembryo_02_G08_119.F 14d_emb Meleagri... 64 6e-12 3 (EH285005) Q1_Reed_1DPH_cDNA_08_E19_293.F 1d_posthatch Melea... 64 6e-12 3 (EH292664) Q2_Reed_18d_tembryo_06_M08_125.F 14d_emb Meleagri... 64 6e-12 3 (EC758595) PPE00001284 Agencourt Biosciences Agen-0020 Non-n... 44 7e-12 5 (FD455117) EGGAZ50TR Haematobia irritans eggs Haematobia irr... 70 1e-11 3 (DB732866) Apis mellifera head cDNA, RIKEN full-length enric... 64 1e-11 3 (EL568333) Physarum10605 Physarum polycephalum starvation st... 44 1e-11 5 (EY188404) LLAE0032C Spider Loxosceles laeta cDNA library Lo... 50 1e-11 5 (BI323688) kt66c02.y1 Strongyloides ratti L2 pAMP1 v1 Chiape... 52 2e-11 5 (BP704646) Xenopus laevis NBRP cDNA clone:XL512a18ex, 5' end. 44 4e-11 5 (FC810513) Sr_pASP6_04k03_SP6 S. ratti mixed stage pAMP Stro... 52 1e-10 5 (FC813691) Sr_pASP6_015d07_SP6 S. ratti mixed stage pAMP Str... 52 1e-10 5 (FC811520) Sr_pASP6_07n21_SP6 S. ratti mixed stage pAMP Stro... 52 1e-10 5 (CD762433) GGEZSM1024E03.g Somite associated with neural tub... 60 2e-10 4 (DB752660) Apis mellifera head cDNA, RIKEN full-length enric... 60 2e-10 3 (DB740115) Apis mellifera head cDNA, RIKEN full-length enric... 60 2e-10 3 (BU321858) 603850634F1 CSEQCHN62 Gallus gallus cDNA clone Ch... 60 2e-10 3 (BI743620) kx49f05.y1 Parastrongyloides trichosuri PA pAMP1 ... 52 3e-10 3 (BI742711) kx34c10.y1 Parastrongyloides trichosuri IL pAMP1 ... 52 4e-10 3 (BC060448) Xenopus laevis hypothetical protein LOC398959, mR... 44 4e-10 5 (EL568121) Physarum02650 Physarum polycephalum starvation st... 42 5e-10 5 (DB728694) Apis mellifera head cDNA, RIKEN full-length enric... 58 6e-10 3 (DB750052) Apis mellifera head cDNA, RIKEN full-length enric... 58 6e-10 3 (DB738610) Apis mellifera head cDNA, RIKEN full-length enric... 58 6e-10 3 (DB739166) Apis mellifera head cDNA, RIKEN full-length enric... 58 6e-10 3 (BC084314) Xenopus laevis hypothetical protein LOC398959, mR... 44 9e-10 5 (CD740076) 4028910 1GAL - Chicken Intestinal Lymphocyte Gall... 60 1e-09 3 (EX452369) SSHGR24_6G03 Gigaspora rosea GR24 treated SSH lib... 42 1e-09 4 (BU350736) 603527362F1 CSEQCHN69 Gallus gallus cDNA clone Ch... 60 1e-09 3 (CD727094) 4031458 1GAL - Chicken Intestinal Lymphocyte Gall... 60 1e-09 3 (ES450697) 25667 Myzus persicae 2001-12 (red), Fenton Myzus ... 46 2e-09 3 (CJ388642) Molgula tectiformis cDNA, gonad clone:mtgd005c12,... 54 2e-09 2 (AJ448079) Gallus gallus EST, clone library riken1, clone 18... 60 2e-09 3 (DR425554) naw20a07.y1 Chicken eye (hatched). Unnormalized (... 60 2e-09 3 (CJ396974) Molgula tectiformis cDNA, gonad clone:mtgd029o01,... 54 2e-09 2 (CJ396950) Molgula tectiformis cDNA, gonad clone:mtgd029m23,... 54 2e-09 2 (CJ335204) Molgula tectiformis cDNA, embryo just before hatc... 54 2e-09 2 (CN228417) RJB054A03.ab1 RJtestis Gallus gallus cDNA 5', mRN... 60 2e-09 3 (CJ390758) Molgula tectiformis cDNA, gonad clone:mtgd014l24,... 54 2e-09 2 (BM491738) pgp2n.pk007.e6 Normalized Chicken Pituitary/Hypot... 60 2e-09 3 (AJ441967) Gallus gallus EST, clone library dkfz426, clone 1... 60 2e-09 3 (CJ353109) Molgula tectiformis cDNA, cleaving embryo clone:m... 54 3e-09 2 (CN226552) RJB083C09.ab1 RJtestis Gallus gallus cDNA 5', mRN... 60 3e-09 3 (CJ352783) Molgula tectiformis cDNA, cleaving embryo clone:m... 54 3e-09 2 (BM427292) pgf2n.pk006.f16 Normalized Chicken Abdominal Fat ... 60 3e-09 3 (CJ350880) Molgula tectiformis cDNA, cleaving embryo clone:m... 54 3e-09 2 (BM487004) pgm2n.pk003.e19 Normalized Chicken Breast Muscle,... 60 3e-09 3 (AJ451004) Gallus gallus EST, clone library riken1, clone 27... 60 3e-09 3 (BI393924) pgp1n.pk012.o12 Normalized Chicken Pituitary/Hypo... 60 3e-09 3 (BU400684) 604140641F1 CSEQCHN59 Gallus gallus cDNA clone Ch... 60 3e-09 3 (FE246571) CAPG9489.fwd CAPG Naegleria gruberi amoeba stage ... 52 3e-09 3
>(BJ435601) Dictyostelium discoideum cDNA clone:ddv27k15, 3' end, single read. Length = 617
Score = 1136 bits (573), Expect(3) = 0.0 Identities = 573/573 (100%) Strand = Plus / Minus
Query: 913 tgtcaaccagtagcaaaacatcgattctttcaccgccgataaattaggtaaagccgattt 972 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 617 tgtcaaccagtagcaaaacatcgattctttcaccgccgataaattaggtaaagccgattt 558
Query: 973 ggtcgaagaggttggcaccagtgatggtaagatcgtaaaggtcaccggtattccaaaccc 1032 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 557 ggtcgaagaggttggcaccagtgatggtaagatcgtaaaggtcaccggtattccaaaccc 498
Query: 1033 tggtaaaaccgtcaccgtcttatgtcgtggttcaaataaattggttttagatgaagccga 1092 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 497 tggtaaaaccgtcaccgtcttatgtcgtggttcaaataaattggttttagatgaagccga 438
Query: 1093 acgttccttacacgatgctctctgcgttattcgttccctcgttaaaaagaaattcctcat 1152 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 437 acgttccttacacgatgctctctgcgttattcgttccctcgttaaaaagaaattcctcat 378
Query: 1153 cgctggtggtggtgccccagagattgaagtatcacaacaagtcactgctttctctaaaac 1212 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 377 cgctggtggtggtgccccagagattgaagtatcacaacaagtcactgctttctctaaaac 318
Query: 1213 tctcactggtatcacaagttattgtgttcgtgcttacgctgaggccttggagatcatccc 1272 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 317 tctcactggtatcacaagttattgtgttcgtgcttacgctgaggccttggagatcatccc 258
Query: 1273 ttacactcttgctgaaaatgttggtcttcatccaatctctatcgtcaccgaattaagaaa 1332 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 257 ttacactcttgctgaaaatgttggtcttcatccaatctctatcgtcaccgaattaagaaa 198
Query: 1333 taaacatgctcaaggtgaaataaactctggtatcaatgttagaaaaggcgcaatcacaaa 1392 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 197 taaacatgctcaaggtgaaataaactctggtatcaatgttagaaaaggcgcaatcacaaa 138
Query: 1393 tatcctccaagaaaatgttgtacagccacttttagtctcaacttctgctttaactttagc 1452 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 137 tatcctccaagaaaatgttgtacagccacttttagtctcaacttctgctttaactttagc 78
Query: 1453 aactgaaaccgttgtaatgttattaaagattga 1485 ||||||||||||||||||||||||||||||||| Sbjct: 77 aactgaaaccgttgtaatgttattaaagattga 45
Score = 32.2 bits (16), Expect(3) = 0.0 Identities = 16/16 (100%) Strand = Plus / Minus
Query: 1488 atattgcaactgcaag 1503 |||||||||||||||| Sbjct: 43 atattgcaactgcaag 28
Score = 30.2 bits (15), Expect(3) = 0.0 Identities = 15/15 (100%) Strand = Plus / Minus
Query: 1504 ataaacgttactttt 1518 ||||||||||||||| Sbjct: 26 ataaacgttactttt 12
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,557,114,303 Number of extensions: 91390699 Number of successful extensions: 8229851 Number of sequences better than 10.0: 2351 Length of query: 1576 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1552 Effective length of database: 97,308,875,965 Effective search space: 151023375497680 Effective search space used: 151023375497680 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 6.25 |
Homology vs Protein |
Query= Contig-U09219-1 (Contig-U09219-1Q) /CSM_Contig/Contig-U09219-1Q.Seq.d (1576 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q54CL2) RecName: Full=T-complex protein 1 subunit delta; ... 334 e-158 AF494043_1(AF494043|pid:none) Physarum polycephalum chaperonin c... 273 e-125 AM451055_3(AM451055|pid:none) Vitis vinifera contig VV78X158485.... 260 e-113 AB003589_1(AB003589|pid:none) Glycine max cct-d gene for group I... 258 e-112 AK067672_1(AK067672|pid:none) Oryza sativa Japonica Group cDNA c... 250 e-110 BT061541_1(BT061541|pid:none) Zea mays full-length cDNA clone ZM... 252 e-109 AC068924_12(AC068924|pid:none) Oryza sativa chromosome 10 BAC OS... 241 e-105 CR761022_1(CR761022|pid:none) Xenopus tropicalis finished cDNA, ... 236 e-104 AE017347_133(AE017347|pid:none) Cryptococcus neoformans var. neo... 233 e-104 AB170073_1(AB170073|pid:none) Macaca fascicularis brain cDNA clo... 236 e-104 BC073652_1(BC073652|pid:none) Xenopus laevis MGC82994 protein, m... 235 e-104 (P50991) RecName: Full=T-complex protein 1 subunit delta; ... 234 e-103 (Q5R637) RecName: Full=T-complex protein 1 subunit delta; ... 234 e-103 U38846_1(U38846|pid:none) Human stimulator of TAR RNA binding (S... 234 e-103 AJ251587_1(AJ251587|pid:none) Gallus gallus mRNA for chaperonin ... 233 e-103 AK303082_1(AK303082|pid:none) Homo sapiens cDNA FLJ51167 complet... 233 e-103 (Q2T9X2) RecName: Full=T-complex protein 1 subunit delta; ... 236 e-103 BC084314_1(BC084314|pid:none) Xenopus laevis hypothetical protei... 234 e-102 AK146242_1(AK146242|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 234 e-102 (P80315) RecName: Full=T-complex protein 1 subunit delta; ... 234 e-102 BC060448_1(BC060448|pid:none) Xenopus laevis hypothetical protei... 234 e-102 AK167846_1(AK167846|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 234 e-102 L25913_1(L25913|pid:none) Mus musculus chaperonin mRNA, complete... 229 e-101 CP000586_93(CP000586|pid:none) Ostreococcus lucimarinus CCE9901 ... 215 e-100 CR954206_114(CR954206|pid:none) Ostreococcus tauri strain OTTH05... 216 e-100 AE014134_2310(AE014134|pid:none) Drosophila melanogaster chromos... 227 4e-99 (P53451) RecName: Full=T-complex protein 1 subunit delta; ... 225 2e-98 BC065324_1(BC065324|pid:none) Danio rerio chaperonin containing ... 224 2e-97 AP007167_352(AP007167|pid:none) Aspergillus oryzae RIB40 genomic... 207 3e-96 (P47208) RecName: Full=T-complex protein 1 subunit delta; ... 217 9e-95 AM920435_605(AM920435|pid:none) Penicillium chrysogenum Wisconsi... 204 3e-94 CR940347_934(CR940347|pid:none) Theileria annulata strain Ankara... 202 6e-94 T49506(T49506)probable chaperonin CCT4 [imported] - Neurospora c... 209 9e-93 BX842624_23(BX842624|pid:none) Neurospora crassa DNA linkage gro... 209 9e-93 AY850329_1(AY850329|pid:none) Magnaporthe grisea T-complex prote... 206 9e-93 CU633438_860(CU633438|pid:none) Podospora anserina genomic DNA c... 206 1e-92 AF050465_1(AF050465|pid:none) Schizosaccharomyces pombe chaperon... 204 1e-91 FN357297_46(FN357297|pid:none) Schistosoma mansoni genome sequen... 206 4e-91 FN318612_1(FN318612|pid:none) Schistosoma japonicum isolate Anhu... 206 6e-91 FN314284_1(FN314284|pid:none) Schistosoma japonicum isolate Anhu... 206 6e-91 (Q6BXF6) RecName: Full=T-complex protein 1 subunit delta; ... 195 1e-90 FM992691_250(FM992691|pid:none) Candida dubliniensis CD36 chromo... 194 3e-90 (P39078) RecName: Full=T-complex protein 1 subunit delta; ... 191 5e-89 AY811515_1(AY811515|pid:none) Schistosoma japonicum SJCHGC09549 ... 206 7e-89 CT005260_132(CT005260|pid:none) Leishmania major strain Friedlin... 200 9e-89 AM502248_427(AM502248|pid:none) Leishmania infantum chromosome 30. 200 4e-88 (Q6FQT2) RecName: Full=T-complex protein 1 subunit delta; ... 187 8e-88 (Q6CL82) RecName: Full=T-complex protein 1 subunit delta; ... 184 3e-87 CU928180_79(CU928180|pid:none) Kluyveromyces thermotolerans stra... 181 2e-85 AL844509_562(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 196 5e-85 AM910993_132(AM910993|pid:none) Plasmodium knowlesi strain H chr... 194 1e-84 (Q6C100) RecName: Full=T-complex protein 1 subunit delta; ... 167 2e-80 AY223304_1(AY223304|pid:none) Schistosoma japonicum clone ZZD584... 182 3e-69 BT072570_1(BT072570|pid:none) Salmo salar clone ssal-rgf-530-297... 225 2e-65 AB430834_1(AB430834|pid:none) Delia antiqua DaCCT4 mRNA for chap... 159 3e-61 AF165818_37(AF165818|pid:none) Guillardia theta nucleomorph chro... 132 1e-58 DQ016992_1(DQ016992|pid:none) Ipomoea batatas putative cytosolic... 229 2e-58 AF322045_1(AF322045|pid:none) Malawimonas jakobiformis chaperoni... 162 6e-55 DQ206541_1(DQ206541|pid:none) Suberites fuscus isolate TOA56 cha... 179 1e-54 EF215231_1(EF215231|pid:none) Callithrix jacchus clone I20-47.3_... 215 4e-54 DQ206616_1(DQ206616|pid:none) Monosiga brevicollis isolate TOA56... 173 5e-50 AC142094_10(AC142094|pid:none) Medicago truncatula clone mth2-34... 194 6e-48 AC144931_26(AC144931|pid:none) Medicago truncatula clone mth2-22... 194 6e-48 EU969149_1(EU969149|pid:none) Zea mays clone 326385 unknown mRNA. 169 5e-47 AJ627421_32(AJ627421|pid:none) Uncultured crenarchaeote genomic ... 138 3e-46 CP000505_291(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 146 2e-45 EU016652_44(EU016652|pid:none) Uncultured Group I marine crenarc... 132 1e-44 (O28821) RecName: Full=Thermosome subunit beta; AltName: Full=Th... 129 3e-44 CP001338_32(CP001338|pid:none) Candidatus Methanosphaerula palus... 137 5e-44 AE008384_1379(AE008384|pid:none) Methanosarcina mazei strain Goe... 139 1e-43 CP000780_198(CP000780|pid:none) Candidatus Methanoregula boonei ... 133 2e-43 AE009950_1974(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 127 2e-43 BA000023_1352(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 135 3e-43 C72686(C72686)probable thermosome subunit APE0907 - Aeropyrum pe... 127 3e-43 (Q9YDK6) RecName: Full=Thermosome subunit alpha; AltName: Full=T... 127 3e-43 AE010299_86(AE010299|pid:none) Methanosarcina acetivorans str. C... 137 4e-43 AE017199_142(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 131 4e-43 (Q58405) RecName: Full=Thermosome subunit; AltName: Full=Chapero... 126 1e-42 CP000866_1573(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 129 1e-42 CP000682_1688(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 131 2e-42 CP000855_712(CP000855|pid:none) Thermococcus onnurineus NA1, com... 126 2e-42 AE000666_215(AE000666|pid:none) Methanothermobacter thermautotro... 125 4e-42 (O26320) RecName: Full=Thermosome subunit alpha; AltName: Full=T... 125 4e-42 CP000099_1174(CP000099|pid:none) Methanosarcina barkeri str. Fus... 138 6e-42 (Q53546) RecName: Full=Thermosome subunit; AltName: Full=Hyperth... 121 6e-42 BA000011_507(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 127 8e-42 AY488152_1(AY488152|pid:none) Cryptosporidium parvum genotype Ia... 129 1e-41 CP000102_113(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 125 2e-41 CP000852_27(CP000852|pid:none) Caldivirga maquilingensis IC-167,... 132 2e-41 AY283769_1(AY283769|pid:none) Thermococcus litoralis thermosome ... 124 2e-41 CP000575_893(CP000575|pid:none) Staphylothermus marinus F1, comp... 126 2e-41 CP000743_1008(CP000743|pid:none) Methanococcus aeolicus Nankai-3... 122 2e-41 AM114193_1113(AM114193|pid:none) Uncultured methanogenic archaeo... 128 4e-41 CR937007_37(CR937007|pid:none) uncultured archaeon fos122a6+28b5. 124 4e-41 AM114193_49(AM114193|pid:none) Uncultured methanogenic archaeon ... 123 4e-41 AE017261_735(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 121 5e-41 (O93624) RecName: Full=Thermosome subunit; AltName: Full=Chapero... 122 2e-40 CP000852_7(CP000852|pid:none) Caldivirga maquilingensis IC-167, ... 129 2e-40 CP000559_204(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 126 2e-40 CP001404_1400(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 125 3e-40 CP000504_950(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 128 3e-40 BA000011_1152(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 118 3e-40 CP000493_462(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 130 9e-40 (O24732) RecName: Full=Thermosome subunit beta; AltName: Full=Th... 120 1e-39 (Q9V2S9) RecName: Full=Thermosome subunit alpha; AltName: Full=T... 123 2e-39 CP000561_1748(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 132 2e-39 AL445066_51(AL445066|pid:none) Thermoplasma acidophilum complete... 115 2e-39 (P48424) RecName: Full=Thermosome subunit alpha; AltName: Full=T... 115 2e-39 CP000477_756(CP000477|pid:none) Methanosaeta thermophila PT, com... 124 2e-39 CP000562_2334(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 124 2e-39 CP000660_1638(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 130 3e-39 BA000023_356(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 113 3e-39 C72512(C72512)probable thermosome, subunit APE2072 - Aeropyrum p... 122 3e-39 CP000660_2064(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 124 3e-39 (O24735) RecName: Full=Thermosome subunit beta; AltName: Full=Th... 113 3e-39 (P48425) RecName: Full=Thermosome subunit beta; AltName: Full=Th... 122 3e-39 CP000504_495(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 130 6e-39 CP001014_1491(CP001014|pid:none) Thermoproteus neutrophilus V24S... 130 6e-39 CP000493_885(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 136 1e-38 CP001399_1800(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 112 1e-38 (P28488) RecName: Full=Thermosome subunit beta; AltName: Full=Th... 112 1e-38 DQ206485_1(DQ206485|pid:none) Platynereis dumerilii isolate TOA5... 163 1e-38 AY534910_8(AY534910|pid:none) Uncultured marine group II euryarc... 123 3e-38 AY223856_1(AY223856|pid:none) Acidianus tengchongenses chaperoni... 113 4e-38 AJ006550_1(AJ006550|pid:none) Pyrodictium occultum thsB gene. &... 125 1e-37 EU686616_10(EU686616|pid:none) Uncultured marine group II euryar... 116 1e-37 CP000254_941(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 115 1e-37 S54118(S54118) chaperonin-like complex (CliC) - Methanopyrus kan... 106 2e-37 AF149924_1(AF149924|pid:none) Sulfolobus acidocaldarius chaperon... 108 2e-37 CP001140_1030(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 120 1e-36 AF149920_1(AF149920|pid:none) Sulfolobus solfataricus chaperonin... 105 1e-36 AY596297_2588(AY596297|pid:none) Haloarcula marismortui ATCC 430... 120 2e-36 CP000816_893(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 114 4e-36 AJ719421_1(AJ719421|pid:none) Gallus gallus partial mRNA for hyp... 154 1e-35 CP001140_1258(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 109 2e-35 AY596297_2550(AY596297|pid:none) Haloarcula marismortui ATCC 430... 113 2e-35 (Q9V2T3) RecName: Full=Thermosome subunit beta; AltName: Full=Th... 111 3e-35 (O30561) RecName: Full=Thermosome subunit 1; AltName: Full=Heat ... 123 8e-35 CP000477_901(CP000477|pid:none) Methanosaeta thermophila PT, com... 119 1e-34 AM114193_1013(AM114193|pid:none) Uncultured methanogenic archaeo... 123 4e-34 AE004437_1707(AE004437|pid:none) Halobacterium sp. NRC-1, comple... 113 2e-33 CP001365_2627(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 120 2e-33 EF082422_1(EF082422|pid:none) Picea sitchensis clone WS0293_L23 ... 144 1e-32 BC064254_1(BC064254|pid:none) Xenopus tropicalis chaperonin cont... 125 1e-31 CP000780_318(CP000780|pid:none) Candidatus Methanoregula boonei ... 119 1e-31 CP000300_1816(CP000300|pid:none) Methanococcoides burtonii DSM 6... 137 8e-31 AE010299_1635(AE010299|pid:none) Methanosarcina acetivorans str.... 112 1e-30 CP000099_3061(CP000099|pid:none) Methanosarcina barkeri str. Fus... 115 1e-30 (P41988) RecName: Full=T-complex protein 1 subunit alpha; ... 105 2e-30 CP001365_413(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 104 2e-30 CP001338_2567(CP001338|pid:none) Candidatus Methanosphaerula pal... 128 5e-30 AY389704_1(AY389704|pid:none) Hyacinthus orientalis chaperonin T... 135 5e-30 BC124890_1(BC124890|pid:none) Xenopus laevis chaperonin containi... 115 5e-29 AC141435_23(AC141435|pid:none) Medicago truncatula clone mth2-21... 117 7e-29 EU016595_17(EU016595|pid:none) Uncultured Group I marine crenarc... 130 1e-28 AL590442_52(AL590442|pid:none) chromosome II of strain GB-M1 of ... 130 2e-28 AF226723_1(AF226723|pid:none) Giardia intestinalis chaperonin su... 129 2e-28 AF442546_1(AF442546|pid:none) Physarum polycephalum CCT chaperon... 107 5e-28 CP000477_720(CP000477|pid:none) Methanosaeta thermophila PT, com... 127 9e-28 AF226724_1(AF226724|pid:none) Giardia intestinalis chaperonin su... 107 1e-27 EF145314_1(EF145314|pid:none) Populus trichocarpa clone WS01123_... 117 1e-27 AF322046_1(AF322046|pid:none) Reclinomonas americana strain 5039... 92 1e-27 AP000383_4(AP000383|pid:none) Arabidopsis thaliana genomic DNA, ... 107 2e-27 CT005272_717(CT005272|pid:none) Leishmania major strain Friedlin... 99 2e-27 FN357483_22(FN357483|pid:none) Schistosoma mansoni genome sequen... 125 4e-27 BC080140_1(BC080140|pid:none) Xenopus tropicalis cct8 protein, m... 105 6e-27 AY810269_1(AY810269|pid:none) Schistosoma japonicum SJCHGC05482 ... 124 7e-27 FN315154_1(FN315154|pid:none) Schistosoma japonicum isolate Anhu... 124 7e-27 FN315153_1(FN315153|pid:none) Schistosoma japonicum isolate Anhu... 124 7e-27 AY389884_1(AY389884|pid:none) Uncultured archaeon clone NBFF33 p... 124 7e-27 FN320274_1(FN320274|pid:none) Schistosoma japonicum isolate Anhu... 124 7e-27 CP001575_409(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 112 8e-27 AF097668_1(AF097668|pid:none) Mesembryanthemum crystallinum T-co... 111 8e-27 AK293437_1(AK293437|pid:none) Homo sapiens cDNA FLJ51711 complet... 124 1e-26 AK301985_1(AK301985|pid:none) Homo sapiens cDNA FLJ54333 complet... 124 1e-26 AK302383_1(AK302383|pid:none) Homo sapiens cDNA FLJ52362 complet... 124 1e-26 (P48643) RecName: Full=T-complex protein 1 subunit epsilon; ... 124 1e-26 AK290393_1(AK290393|pid:none) Homo sapiens cDNA FLJ78433 complet... 124 1e-26 D43950_1(D43950|pid:none) Homo sapiens mRNA for KIAA0098 protein... 124 1e-26 BC002971_1(BC002971|pid:none) Homo sapiens, clone IMAGE:3543711,... 124 1e-26 AK302368_1(AK302368|pid:none) Homo sapiens cDNA FLJ52361 complet... 124 1e-26 AK316376_1(AK316376|pid:none) Homo sapiens cDNA, FLJ79275 comple... 124 1e-26 AK303086_1(AK303086|pid:none) Homo sapiens cDNA FLJ53116 complet... 124 1e-26 BC009454_1(BC009454|pid:none) Homo sapiens, clone IMAGE:3534054,... 124 1e-26 BC097574_1(BC097574|pid:none) Xenopus laevis cDNA clone MGC:1147... 103 1e-26 AK301760_1(AK301760|pid:none) Homo sapiens cDNA FLJ58784 complet... 123 2e-26 AB455150_1(AB455150|pid:none) Methanobrevibacter oralis cpn60 ge... 123 2e-26 CP001323_214(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 106 2e-26 AY398321_1(AY398321|pid:none) Danio rerio clone RK074A2D01 chape... 123 2e-26 AE013599_1470(AE013599|pid:none) Drosophila melanogaster chromos... 122 3e-26 AY251813_1(AY251813|pid:none) Bigelowiella natans chaperonin-con... 122 3e-26 (Q5RF02) RecName: Full=T-complex protein 1 subunit epsilon; ... 122 5e-26 EU959414_1(EU959414|pid:none) Zea mays clone 218090 unknown mRNA. 121 6e-26 AC116979_86(AC116979|pid:none) Dictyostelium discoideum chromoso... 96 1e-25 CR936257_502(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 120 1e-25 AM180088_2115(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 120 1e-25 AJ851489_1(AJ851489|pid:none) Gallus gallus mRNA for hypothetica... 120 1e-25 CR380953_178(CR380953|pid:none) Candida glabrata strain CBS138 c... 105 1e-25 AE014297_840(AE014297|pid:none) Drosophila melanogaster chromoso... 105 2e-25 AC152752_1(AC152752|pid:none) Medicago truncatula clone mth2-89c... 107 2e-25 AY389968_1(AY389968|pid:none) Xenopus laevis chaperonin subunit ... 103 2e-25 (P40412) RecName: Full=T-complex protein 1 subunit epsilon; ... 119 2e-25 AB027708_1(AB027708|pid:none) Carassius auratus mRNA for CCT (ch... 119 2e-25 CP000254_2467(CP000254|pid:none) Methanospirillum hungatei JF-1,... 119 2e-25 U43896_1(U43896|pid:none) Dictyostelium discoideum molecular cha... 102 3e-25 AB008158_1(AB008158|pid:none) Dictyostelium discoideum DdTcp-1 m... 102 3e-25 (P42932) RecName: Full=T-complex protein 1 subunit theta; ... 97 3e-25 AB022161_1(AB022161|pid:none) Mus musculus Cctq gene for chapero... 97 3e-25 AK145918_1(AK145918|pid:none) Mus musculus 14 days pregnant adul... 97 3e-25 AY823273_1(AY823273|pid:none) Notothenia coriiceps TCP1-theta mR... 96 3e-25 AE017343_363(AE017343|pid:none) Cryptococcus neoformans var. neo... 95 3e-25 AB196462_1(AB196462|pid:none) Oncorhynchus mykiss CCT8 mRNA for ... 95 3e-25 EF678303_1(EF678303|pid:none) Picea sitchensis clone WS02913_J08... 119 4e-25 (Q32L40) RecName: Full=T-complex protein 1 subunit alpha; ... 100 4e-25 BC068901_1(BC068901|pid:none) Xenopus laevis t-complex polypepti... 100 4e-25 EF147285_1(EF147285|pid:none) Populus trichocarpa clone WS0122_E... 96 4e-25 U25632_1(U25632|pid:none) Caenorhabditis elegans chaperonin CCT-... 118 5e-25 CP000562_270(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 118 5e-25 (P80316) RecName: Full=T-complex protein 1 subunit epsilon; ... 118 7e-25 AK150390_1(AK150390|pid:none) Mus musculus bone marrow macrophag... 118 7e-25 CP000745_755(CP000745|pid:none) Methanococcus maripaludis C7, co... 118 7e-25 AK129056_1(AK129056|pid:none) Mus musculus mRNA for mKIAA0098 pr... 118 7e-25 D89272_1(D89272|pid:none) Schizosaccharomyces pombe mRNA, partia... 87 7e-25 (P78921) RecName: Full=Probable T-complex protein 1 subunit thet... 87 7e-25 AM114193_2942(AM114193|pid:none) Uncultured methanogenic archaeo... 117 9e-25 CR940352_704(CR940352|pid:none) Theileria annulata strain Ankara... 117 9e-25 AY891878_1(AY891878|pid:none) Synthetic construct Homo sapiens c... 100 9e-25 (Q4R5G2) RecName: Full=T-complex protein 1 subunit alpha; ... 98 9e-25 BC050492_1(BC050492|pid:none) Danio rerio chaperonin containing ... 93 9e-25 (P47207) RecName: Full=T-complex protein 1 subunit beta; ... 117 1e-24 (Q6EE31) RecName: Full=T-complex protein 1 subunit theta; ... 96 1e-24 (Q3ZCI9) RecName: Full=T-complex protein 1 subunit theta; ... 96 1e-24 (P18279) RecName: Full=T-complex protein 1 subunit alpha; ... 100 2e-24 BC044673_1(BC044673|pid:none) Xenopus laevis similar to t-comple... 100 2e-24 AF143494_1(AF143494|pid:none) Xenopus laevis t-complex polypepti... 99 2e-24 AF442545_1(AF442545|pid:none) Physarum polycephalum CCT chaperon... 100 2e-24 EF144830_1(EF144830|pid:none) Populus trichocarpa clone WS01118_... 94 2e-24 CR954208_255(CR954208|pid:none) Ostreococcus tauri strain OTTH05... 116 2e-24 CR382128_623(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 99 2e-24 AK222490_1(AK222490|pid:none) Homo sapiens mRNA for chaperonin c... 95 2e-24 D42052_1(D42052|pid:none) Homo sapiens cosmid Q7A10 (D21S246) in... 95 2e-24 CU633895_466(CU633895|pid:none) Podospora anserina genomic DNA c... 115 3e-24 AF506229_1(AF506229|pid:none) Danio rerio chaperonin-containing ... 115 3e-24 (P40413) RecName: Full=T-complex protein 1 subunit epsilon; ... 115 3e-24 BX284754_5(BX284754|pid:none) Neurospora crassa DNA linkage grou... 115 4e-24 AK153430_1(AK153430|pid:none) Mus musculus bone marrow macrophag... 83 6e-24 AK167529_1(AK167529|pid:none) Mus musculus 14 days pregnant adul... 99 8e-24 AK166828_1(AK166828|pid:none) Mus musculus blastocyst blastocyst... 99 8e-24 EF085165_1(EF085165|pid:none) Picea sitchensis clone WS0282_A10 ... 95 8e-24 AK151445_1(AK151445|pid:none) Mus musculus bone marrow macrophag... 82 8e-24 AL589878_2(AL589878|pid:none) Mouse DNA sequence from clone RP23... 82 8e-24 EU967891_1(EU967891|pid:none) Zea mays clone 306858 T-complex pr... 114 1e-23 AF143493_1(AF143493|pid:none) Danio rerio t-complex polypeptide ... 100 1e-23 BC044397_1(BC044397|pid:none) Danio rerio t-complex polypeptide ... 100 1e-23 A45915_1(A45915|pid:none) Sequence 54 from Patent WO9520654. 99 1e-23 BC045040_1(BC045040|pid:none) Xenopus laevis chaperonin containi... 95 1e-23 AF164028_1(AF164028|pid:none) Danio rerio clone TA2 t-complex po... 99 1e-23 AY389916_1(AY389916|pid:none) Protopterus dolloi chaperonin subu... 98 1e-23 AY054210_1(AY054210|pid:none) Arabidopsis thaliana AT5g20890/F22... 114 1e-23 AM180088_398(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 114 1e-23 AM270081_39(AM270081|pid:none) Aspergillus niger contig An04c020... 85 1e-23 AE016819_651(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 113 2e-23 L37350_1(L37350|pid:none) Saccharomyces cerevisiae (clone p701-6... 113 2e-23 AP007155_1086(AP007155|pid:none) Aspergillus oryzae RIB40 genomi... 87 2e-23 (P28480) RecName: Full=T-complex protein 1 subunit alpha; ... 100 2e-23 (Q54TD3) RecName: Full=T-complex protein 1 subunit epsilon; ... 113 2e-23 BC053271_1(BC053271|pid:none) Danio rerio chaperonin containing ... 113 2e-23 FN357435_9(FN357435|pid:none) Schistosoma mansoni genome sequenc... 113 2e-23 AK290767_1(AK290767|pid:none) Homo sapiens cDNA FLJ75037 complet... 113 2e-23 FN357435_11(FN357435|pid:none) Schistosoma mansoni genome sequen... 113 2e-23 AK151068_1(AK151068|pid:none) Mus musculus bone marrow macrophag... 98 2e-23 BC042312_1(BC042312|pid:none) Xenopus laevis hypothetical LOC495... 112 3e-23 AE017351_192(AE017351|pid:none) Cryptococcus neoformans var. neo... 112 3e-23 AF164029_1(AF164029|pid:none) Danio rerio clone T-3-5 t-complex ... 84 3e-23 CP000300_889(CP000300|pid:none) Methanococcoides burtonii DSM 62... 112 4e-23 BC077927_1(BC077927|pid:none) Xenopus laevis chaperonin containi... 112 5e-23 CR936257_283(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 112 5e-23 BC045074_1(BC045074|pid:none) Xenopus laevis chaperonin containi... 112 5e-23 CU633900_580(CU633900|pid:none) Podospora anserina genomic DNA c... 84 5e-23 (Q9V2T7) RecName: Full=Thermosome subunit gamma; AltName: Full=T... 111 6e-23 (Q54ES9) RecName: Full=T-complex protein 1 subunit beta; ... 111 6e-23 A99481(A99481) hypothetical protein thsC [imported] - Sulfolobus... 111 6e-23 AY247845_1(AY247845|pid:none) Sulfolobus islandicus strain Ren1H... 111 6e-23 BT053088_1(BT053088|pid:none) Medicago truncatula clone MTYFL_FM... 91 6e-23 FM992688_11(FM992688|pid:none) Candida dubliniensis CD36 chromos... 87 8e-23 BC089710_1(BC089710|pid:none) Xenopus tropicalis chaperonin cont... 111 8e-23 AY814272_1(AY814272|pid:none) Schistosoma japonicum SJCHGC03237 ... 111 8e-23 FN314087_1(FN314087|pid:none) Schistosoma japonicum isolate Anhu... 111 8e-23 AM482639_3(AM482639|pid:none) Vitis vinifera contig VV78X155167.... 111 8e-23 FN318217_1(FN318217|pid:none) Schistosoma japonicum isolate Anhu... 111 8e-23 AC104709_9(AC104709|pid:none) Oryza sativa (japonica cultivar-gr... 110 1e-22 AK316397_1(AK316397|pid:none) Homo sapiens cDNA, FLJ79296 comple... 110 1e-22 CR457071_1(CR457071|pid:none) Homo sapiens full open reading fra... 110 1e-22 CU638744_714(CU638744|pid:none) Podospora anserina genomic DNA c... 97 1e-22 CR382130_460(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 91 1e-22 BA000023_892(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 110 1e-22 (Q2NKZ1) RecName: Full=T-complex protein 1 subunit eta; ... 110 1e-22 CP000501_234(CP000501|pid:none) Pichia stipitis CBS 6054 chromos... 110 1e-22 AP007155_174(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 110 1e-22 (Q5XIM9) RecName: Full=T-complex protein 1 subunit beta; ... 110 1e-22 CR382137_805(CR382137|pid:none) Debaryomyces hansenii strain CBS... 110 1e-22 AK302157_1(AK302157|pid:none) Homo sapiens cDNA FLJ52359 complet... 110 2e-22 CU638743_680(CU638743|pid:none) Podospora anserina genomic DNA c... 110 2e-22 CU928171_349(CU928171|pid:none) Kluyveromyces thermotolerans str... 110 2e-22 BT045563_1(BT045563|pid:none) Salmo salar clone ssal-rgf-524-370... 110 2e-22 CP001400_2192(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 110 2e-22 AY247838_1(AY247838|pid:none) Sulfolobus islandicus strain M11 h... 110 2e-22 (P80314) RecName: Full=T-complex protein 1 subunit beta; ... 110 2e-22 CP001401_2257(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 110 2e-22 AC011698_7(AC011698|pid:none) Arabidopsis thaliana chromosome II... 91 2e-22 AK222478_1(AK222478|pid:none) Homo sapiens mRNA for chaperonin c... 109 2e-22 AK077781_1(AK077781|pid:none) Mus musculus adult male thymus cDN... 109 2e-22 (Q99832) RecName: Full=T-complex protein 1 subunit eta; ... 109 2e-22 AK293597_1(AK293597|pid:none) Homo sapiens cDNA FLJ54832 complet... 109 2e-22 AK168272_1(AK168272|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 109 2e-22 AF506209_1(AF506209|pid:none) Danio rerio chaperonin-containing ... 109 2e-22 (P80313) RecName: Full=T-complex protein 1 subunit eta; ... 109 2e-22 (Q5R5C8) RecName: Full=T-complex protein 1 subunit eta; ... 109 2e-22 A45921_1(A45921|pid:none) Sequence 60 from Patent WO9520654. 109 2e-22 AM502245_86(AM502245|pid:none) Leishmania infantum chromosome 27. 109 3e-22 BT045297_1(BT045297|pid:none) Salmo salar clone ssal-rgf-517-310... 109 3e-22 AE017343_81(AE017343|pid:none) Cryptococcus neoformans var. neof... 92 4e-22 AF303531_1(AF303531|pid:none) Tetrahymena pyriformis CCTepsilon ... 108 4e-22 CP001399_2328(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 108 4e-22 CP001402_2324(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 108 4e-22 AK010882_1(AK010882|pid:none) Mus musculus 13 days embryo liver ... 86 5e-22 AY507656_1(AY507656|pid:none) Oryctolagus cuniculus chaperonin-c... 108 5e-22 AL034558_36(AL034558|pid:none) Plasmodium falciparum MAL3P2, com... 108 5e-22 AE014298_1317(AE014298|pid:none) Drosophila melanogaster chromos... 108 5e-22 AE014298_1316(AE014298|pid:none) Drosophila melanogaster chromos... 108 5e-22 CP000559_764(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 108 5e-22 EU961440_1(EU961440|pid:none) Zea mays clone 235468 T-complex pr... 108 5e-22 CR940348_674(CR940348|pid:none) Theileria annulata strain Ankara... 108 7e-22 AK297685_1(AK297685|pid:none) Homo sapiens cDNA FLJ50585 complet... 108 7e-22 AF136446_1(AF136446|pid:none) Tetrahymena pyriformis chaperonin-... 93 9e-22 BT002052_1(BT002052|pid:none) Arabidopsis thaliana t-complex pol... 107 9e-22 AK146360_1(AK146360|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 107 9e-22 (O15891) RecName: Full=T-complex protein 1 subunit alpha; ... 107 1e-21 AM910990_335(AM910990|pid:none) Plasmodium knowlesi strain H chr... 107 1e-21 CP000500_628(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 107 1e-21 BC075536_1(BC075536|pid:none) Xenopus tropicalis chaperonin cont... 107 2e-21 AY740420_1(AY740420|pid:none) Sulfolobus islandicus isolate K14-... 107 2e-21 DQ630895_1(DQ630895|pid:none) Gryllus firmus putative accessory ... 107 2e-21 BT043941_1(BT043941|pid:none) Salmo salar clone HM4_2250 chapero... 107 2e-21 DQ630897_1(DQ630897|pid:none) Gryllus pennsylvanicus putative ac... 107 2e-21 AF226714_1(AF226714|pid:none) Trichomonas vaginalis chaperonin s... 93 2e-21 EU965648_1(EU965648|pid:none) Zea mays clone 287725 T-complex pr... 106 2e-21 AK150160_1(AK150160|pid:none) Mus musculus bone marrow macrophag... 106 3e-21 AM910991_300(AM910991|pid:none) Plasmodium knowlesi strain H chr... 106 3e-21 CP000583_308(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 106 3e-21 AE014186_312(AE014186|pid:none) Plasmodium falciparum 3D7 chromo... 106 3e-21 AY389915_1(AY389915|pid:none) Latimeria chalumnae chaperonin sub... 88 3e-21 AP007161_693(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 105 3e-21 AM920428_1398(AM920428|pid:none) Penicillium chrysogenum Wiscons... 105 3e-21 AK102024_1(AK102024|pid:none) Oryza sativa Japonica Group cDNA c... 105 3e-21 CR382126_921(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 105 3e-21 CR548612_295(CR548612|pid:none) Paramecium tetraurelia macronucl... 105 3e-21 (P39076) RecName: Full=T-complex protein 1 subunit beta; ... 105 5e-21 AP007161_168(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 99 6e-21 BT062615_1(BT062615|pid:none) Zea mays full-length cDNA clone ZM... 100 6e-21 CR382139_608(CR382139|pid:none) Debaryomyces hansenii strain CBS... 105 6e-21 FM992688_790(FM992688|pid:none) Candida dubliniensis CD36 chromo... 105 6e-21 CR940352_162(CR940352|pid:none) Theileria annulata strain Ankara... 105 6e-21 CR382138_1016(CR382138|pid:none) Debaryomyces hansenii strain CB... 105 6e-21 U83843_1(U83843|pid:none) Human HIV-1 Nef interacting protein (N... 105 6e-21 CP000102_128(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 99 7e-21 CR382126_966(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 104 8e-21 (O00782) RecName: Full=T-complex protein 1 subunit gamma; ... 104 8e-21 FM992692_469(FM992692|pid:none) Candida dubliniensis CD36 chromo... 104 8e-21 (P42943) RecName: Full=T-complex protein 1 subunit eta; ... 104 8e-21 DQ848962_1(DQ848962|pid:none) Scophthalmus maximus clone sba622 ... 104 8e-21 (Q4R963) RecName: Full=T-complex protein 1 subunit gamma; ... 104 1e-20 (P49368) RecName: Full=T-complex protein 1 subunit gamma; ... 104 1e-20 A38983(S61529;I38892;A38983;S40237) TCP1 ring complex protein TR... 104 1e-20 (P50143) RecName: Full=T-complex protein 1 subunit gamma; ... 104 1e-20 BC008019_1(BC008019|pid:none) Homo sapiens chaperonin containing... 104 1e-20 AL589685_11(AL589685|pid:none) Human DNA sequence from clone RP1... 104 1e-20 AL590443_21(AL590443|pid:none) chromosome III of strain GB-M1 of... 102 1e-20 U17104_1(U17104|pid:none) Human cytoplasmic chaperonin hTRiC5 mR... 103 1e-20 (P39077) RecName: Full=T-complex protein 1 subunit gamma; ... 103 1e-20 AL589685_9(AL589685|pid:none) Human DNA sequence from clone RP11... 103 1e-20 FN392322_116(FN392322|pid:none) Pichia pastoris GS115 chromosome... 103 1e-20 AK300765_1(AK300765|pid:none) Homo sapiens cDNA FLJ57603 complet... 103 1e-20 (Q6P502) RecName: Full=T-complex protein 1 subunit gamma; ... 103 1e-20 AB170730_1(AB170730|pid:none) Macaca fascicularis brain cDNA clo... 103 1e-20 (P80318) RecName: Full=T-complex protein 1 subunit gamma; ... 103 1e-20 U37062_1(U37062|pid:none) Xenopus laevis chaperonin subunit CCTg... 103 1e-20 AB430837_1(AB430837|pid:none) Delia antiqua DaCCT7 mRNA for chap... 103 1e-20 FN392320_907(FN392320|pid:none) Pichia pastoris GS115 chromosome... 103 2e-20 EU961863_1(EU961863|pid:none) Zea mays clone 238706 unknown mRNA. 103 2e-20 AM920437_2246(AM920437|pid:none) Penicillium chrysogenum Wiscons... 103 2e-20 DQ353755_1(DQ353755|pid:none) Ictalurus punctatus isolate C6MMD0... 103 2e-20 L20509_1(L20509|pid:none) Mus musculus matricin mRNA, complete c... 103 2e-20 (Q9HHA2) RecName: Full=Thermosome subunit 3; AltName: Full=Heat ... 103 2e-20 AE016820_278(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 103 2e-20 AC016795_12(AC016795|pid:none) Arabidopsis thaliana chromosome I... 103 2e-20 BT021599_1(BT021599|pid:none) Bos taurus chaperonin containing T... 103 2e-20 AM494960_132(AM494960|pid:none) Leishmania braziliensis chromoso... 103 2e-20 CR380958_359(CR380958|pid:none) Candida glabrata strain CBS138 c... 103 2e-20 AM269971_17(AM269971|pid:none) Aspergillus niger contig An01c024... 103 2e-20 AX705097_1(AX705097|pid:none) Sequence 18 from Patent WO03014351. 103 2e-20 AM494971_384(AM494971|pid:none) Leishmania braziliensis chromoso... 103 2e-20 AF188130_1(AF188130|pid:none) Oxytricha nova clone 11 chaperonin... 103 2e-20 AB367927_1(AB367927|pid:none) Babesia caballi CCTeta gene for et... 102 3e-20 AF494046_1(AF494046|pid:none) Physarum polycephalum chaperonin c... 102 3e-20 CP000496_317(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 102 3e-20 AM180088_171(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 102 4e-20 CR954203_140(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 102 4e-20 CP000081_382(CP000081|pid:none) Leishmania major chromosome 35, ... 102 4e-20 AE016820_683(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 102 4e-20 DQ311149_1(DQ311149|pid:none) Bombyx mori chaperonin subunit 6a ... 102 5e-20 CP001327_351(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 102 5e-20 CR382123_494(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 102 5e-20 AM502250_384(AM502250|pid:none) Leishmania infantum chromosome 32. 101 7e-20 (P54409) RecName: Full=T-complex protein 1 subunit eta; ... 101 7e-20 AB367928_1(AB367928|pid:none) Babesia ovata CCTeta gene for eta ... 101 7e-20 U09480_1(U09480|pid:none) Saccharomyces cerevisiae S288C Bin2p (... 101 7e-20 AM457854_1(AM457854|pid:none) Vitis vinifera contig VV78X103139.... 101 7e-20 CR380952_324(CR380952|pid:none) Candida glabrata strain CBS138 c... 101 7e-20 CR382130_828(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 101 7e-20 FN392321_307(FN392321|pid:none) Pichia pastoris GS115 chromosome... 83 8e-20 CR382133_561(CR382133|pid:none) Debaryomyces hansenii strain CBS... 79 8e-20 CU928173_390(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 101 9e-20 FM992692_164(FM992692|pid:none) Candida dubliniensis CD36 chromo... 101 9e-20 AY823272_1(AY823272|pid:none) Notothenia coriiceps TCP1-beta mRN... 101 9e-20 AB367923_1(AB367923|pid:none) Babesia gibsoni CCTeta gene for et... 101 9e-20 AB194475_1(AB194475|pid:none) Delia antiqua DaTCP-1 mRNA for T-c... 101 9e-20 (P12612) RecName: Full=T-complex protein 1 subunit alpha; ... 100 1e-19 FN318834_1(FN318834|pid:none) Schistosoma japonicum isolate Anhu... 100 1e-19 (P12613) RecName: Full=T-complex protein 1 subunit alpha; ... 100 1e-19 AY814501_1(AY814501|pid:none) Schistosoma japonicum SJCHGC04656 ... 100 1e-19 FN318833_1(FN318833|pid:none) Schistosoma japonicum isolate Anhu... 100 1e-19 BT048857_1(BT048857|pid:none) Salmo salar clone ssal-evd-524-036... 100 1e-19 M21160_1(M21160|pid:none) Yeast (S.cerevisiae) T complex protein... 100 1e-19 (P87153) RecName: Full=Probable T-complex protein 1 subunit eta;... 100 1e-19 BT002737_1(BT002737|pid:none) Arabidopsis thaliana clone C105119... 100 1e-19 AE017341_272(AE017341|pid:none) Cryptococcus neoformans var. neo... 100 1e-19 FN392320_117(FN392320|pid:none) Pichia pastoris GS115 chromosome... 100 1e-19 AK069949_1(AK069949|pid:none) Oryza sativa Japonica Group cDNA c... 100 1e-19 FN357323_17(FN357323|pid:none) Schistosoma mansoni genome sequen... 100 2e-19 EU966804_1(EU966804|pid:none) Zea mays clone 297510 unknown mRNA. 100 2e-19 AC149135_1(AC149135|pid:none) Medicago truncatula chromosome 2 c... 100 2e-19 BT053027_1(BT053027|pid:none) Medicago truncatula clone MTYFL_FM... 100 2e-19 BC153468_1(BC153468|pid:none) Danio rerio chaperonin containing ... 100 2e-19 CR382132_476(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 100 2e-19 BC059558_1(BC059558|pid:none) Danio rerio chaperonin containing ... 100 2e-19 AB366747_1(AB366747|pid:none) Babesia microti CCTeta gene for et... 100 3e-19 AB362585_1(AB362585|pid:none) Babesia microti CCTeta gene for et... 100 3e-19 AB367924_1(AB367924|pid:none) Babesia odocoilei CCTeta gene for ... 100 3e-19 AB366750_1(AB366750|pid:none) Babesia microti CCTeta gene for et... 100 3e-19 EU974895_1(EU974895|pid:none) Zea mays clone 460695 T-complex pr... 100 3e-19 AB366749_1(AB366749|pid:none) Babesia microti CCTeta gene for et... 100 3e-19 AM910996_458(AM910996|pid:none) Plasmodium knowlesi strain H chr... 100 3e-19 AB362581_1(AB362581|pid:none) Babesia microti CCTeta gene for et... 100 3e-19 EU366481_1(EU366481|pid:none) Ovis aries T-complex protein 1 alp... 100 3e-19 CR382121_174(CR382121|pid:none) Kluyveromyces lactis strain NRRL... 100 3e-19 AB362583_1(AB362583|pid:none) Babesia microti CCTeta gene for et... 100 3e-19 AB366755_1(AB366755|pid:none) Babesia microti CCTeta gene for et... 99 3e-19 AB430835_1(AB430835|pid:none) Delia antiqua DaCCT5 mRNA for chap... 99 3e-19 AB367929_1(AB367929|pid:none) Theileria sergenti CCTeta gene for... 99 3e-19 AM502254_59(AM502254|pid:none) Leishmania infantum chromosome 36. 99 3e-19 AB367930_1(AB367930|pid:none) Theileria sergenti CCTeta gene for... 99 3e-19 AY811498_1(AY811498|pid:none) Schistosoma japonicum SJCHGC04813 ... 99 3e-19 AE014188_282(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 99 3e-19 AB367931_1(AB367931|pid:none) Theileria sergenti CCTeta mRNA for... 99 3e-19 AB367933_1(AB367933|pid:none) Theileria equi CCTeta gene for eta... 99 4e-19 AF130110_1(AF130110|pid:none) Homo sapiens clone FLB6303 PRO1633... 99 4e-19 FM992689_863(FM992689|pid:none) Candida dubliniensis CD36 chromo... 99 4e-19 AB367926_1(AB367926|pid:none) Babesia major CCTeta gene for eta ... 99 4e-19 AE016819_300(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 99 4e-19 CP000583_350(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 99 4e-19 AL590451_49(AL590451|pid:none) chromosome IX of strain GB-M1 of ... 99 6e-19 AM480064_3(AM480064|pid:none) Vitis vinifera contig VV78X252384.... 98 7e-19 EF145156_1(EF145156|pid:none) Populus trichocarpa clone WS01121_... 98 7e-19 AM920436_204(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 98 7e-19 CR954203_350(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 98 7e-19 AF167366_1(AF167366|pid:none) Lepeophtheirus salmonis T-complex ... 98 1e-18 CR954213_310(CR954213|pid:none) Ostreococcus tauri strain OTTH05... 98 1e-18 CR382129_782(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 97 1e-18 BC059165_1(BC059165|pid:none) Rattus norvegicus chaperonin conta... 97 1e-18 CP000882_48(CP000882|pid:none) Hemiselmis andersenii chromosome ... 97 1e-18 (P47828) RecName: Full=T-complex protein 1 subunit theta; ... 84 1e-18 AF226716_1(AF226716|pid:none) Trichomonas vaginalis chaperonin s... 78 1e-18 U91327_1(U91327|pid:none) Human chromosome 12p15 BAC clone CIT98... 97 2e-18 CP000594_27(CP000594|pid:none) Ostreococcus lucimarinus CCE9901 ... 97 2e-18 AM910990_322(AM910990|pid:none) Plasmodium knowlesi strain H chr... 97 2e-18 AF442548_1(AF442548|pid:none) Physarum polycephalum CCT chaperon... 97 2e-18 AB050948_1(AB050948|pid:none) Babesia microti TCP-1 mRNA for T-c... 96 3e-18 AF322044_1(AF322044|pid:none) Malawimonas jakobiformis chaperoni... 96 3e-18 CP000860_1980(CP000860|pid:none) Candidatus Desulforudis audaxvi... 96 4e-18 X95602_1(X95602|pid:none) D.melanogaster Cctg gene. 96 4e-18 T33227(T33227)hypothetical protein T10B5.5 - Caenorhabditis eleg... 96 5e-18 AF067947_11(AF067947|pid:none) Caenorhabditis elegans cosmid T10... 96 5e-18 AF067947_10(AF067947|pid:none) Caenorhabditis elegans cosmid T10... 96 5e-18 AY683456_1(AY683456|pid:none) Rattus norvegicus cct-5 protein mR... 95 6e-18 (Q5ZJ54) RecName: Full=T-complex protein 1 subunit zeta; ... 95 8e-18 BT052995_1(BT052995|pid:none) Medicago truncatula clone MTYFL_FM... 95 8e-18 AF083031_54(AF083031|pid:none) Guillardia theta nucleomorph chro... 94 1e-17 Y18419_1(Y18419|pid:none) Drosophila virilis mRNA for t-complex ... 94 1e-17 AL590446_99(AL590446|pid:none) chromosome VI of strain GB-M1 of ... 94 1e-17
>(Q54CL2) RecName: Full=T-complex protein 1 subunit delta; Short=TCP-1-delta; AltName: Full=CCT-delta; Length = 533
Score = 334 bits (857), Expect(2) = e-158 Identities = 175/192 (91%), Positives = 175/192 (91%) Frame = +2
Query: 929 NIDSFTADKLGKADLVEEVGTSDGKIVKVTGIPNPGKTVTVLCRGSNKLVLDEAERSLHD 1108 NIDSFTADKLGKADLVEEVGTSDGKIVKVTGIPNPGKTVTVLCRGSNKLVLDEAERSLHD Sbjct: 342 NIDSFTADKLGKADLVEEVGTSDGKIVKVTGIPNPGKTVTVLCRGSNKLVLDEAERSLHD 401
Query: 1109 ALCVIRSLVKKKFLIAGGGAPEIEVSQQVTAFSKTLTGITSYCVRAYAEALEIIPYTLAE 1288 ALCVIRSLVKKKFLIAGGGAPEIEVSQQVTAFSKTLTGITSYCVRAYAEALEIIPYTLAE Sbjct: 402 ALCVIRSLVKKKFLIAGGGAPEIEVSQQVTAFSKTLTGITSYCVRAYAEALEIIPYTLAE 461
Query: 1289 NVGLHPISIVTELRNKHAQGEINSGINVRKGAITNILQENVVQPXXXXXXXXXXXXXXXX 1468 N GLHPISIVTELRNKHAQGEINSGINVRKGAITNILQENVVQP Sbjct: 462 NAGLHPISIVTELRNKHAQGEINSGINVRKGAITNILQENVVQPLLVSTSALTLATETVV 521
Query: 1469 MLLKIDDIATAR 1504 MLLKIDDIATAR Sbjct: 522 MLLKIDDIATAR 533
Score = 248 bits (634), Expect(2) = e-158 Identities = 124/124 (100%), Positives = 124/124 (100%) Frame = +1
Query: 556 QGLVFDQTASHTAGGPTRIQNAKIGLIQFCLSAPKTYMDNNIVVSDYSKMDKVIKEEPKL 735 QGLVFDQTASHTAGGPTRIQNAKIGLIQFCLSAPKTYMDNNIVVSDYSKMDKVIKEEPKL Sbjct: 218 QGLVFDQTASHTAGGPTRIQNAKIGLIQFCLSAPKTYMDNNIVVSDYSKMDKVIKEEPKL 277
Query: 736 ILEMCRKIQKSGCNVLLVQKSILRDAVNDLSLHYLAKLKILVIKDIERDDIEFICNTIGC 915 ILEMCRKIQKSGCNVLLVQKSILRDAVNDLSLHYLAKLKILVIKDIERDDIEFICNTIGC Sbjct: 278 ILEMCRKIQKSGCNVLLVQKSILRDAVNDLSLHYLAKLKILVIKDIERDDIEFICNTIGC 337
Query: 916 QPVA 927 QPVA Sbjct: 338 QPVA 341
Score = 251 bits (641), Expect = 5e-65 Identities = 136/157 (86%), Positives = 136/157 (86%) Frame = +2
Query: 74 MSXXXXXXXKVLPSRSDFDEKEKEKDVRTSNXXXXXXXXXXXXTSLGPKGMDKMIISPNN 253 MS KVLPSRSDFDEKEKEKDVRTSN TSLGPKGMDKMIISPNN Sbjct: 1 MSAPAAAPAKVLPSRSDFDEKEKEKDVRTSNIVAARAVADAIRTSLGPKGMDKMIISPNN 60
Query: 254 EVLISNDGATILQNLXLRHPAAKMLAELAKAQDIEAGDGTTSVCVIAGSLLGAVSQLMAK 433 EVLISNDGATILQNL LRHPAAKMLAELAKAQDIEAGDGTTSVCVIAGSLLGAVSQLMAK Sbjct: 61 EVLISNDGATILQNLELRHPAAKMLAELAKAQDIEAGDGTTSVCVIAGSLLGAVSQLMAK 120
Query: 434 GIHPSIIXEAFNLALNKSLEVLVSMSVPVSLTDRVSL 544 GIHPSII EAFNLALNKSLEVLVSMSVPVSLTDRVSL Sbjct: 121 GIHPSIISEAFNLALNKSLEVLVSMSVPVSLTDRVSL 157
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 2,196,201,515 Number of extensions: 41935187 Number of successful extensions: 122639 Number of sequences better than 10.0: 2387 Number of HSP's gapped: 120871 Number of HSP's successfully gapped: 3329 Length of query: 525 Length of database: 1,040,966,779 Length adjustment: 133 Effective length of query: 392 Effective length of database: 614,796,874 Effective search space: 241000374608 Effective search space used: 241000374608 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
2 |
AH (FL, L) |
0 |
AF (FL, S) |
2 |
SL (DIR, L) |
1 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
1 |
FC-IC (SUB) |
1 |