| List of clone(s) |
 |
| Homology vs DNA |
Query= Contig-U09155-1 (Contig-U09155-1Q) /CSM_Contig/Contig-U09155-1Q.Seq.d
(1404 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ431300) Dictyostelium discoideum cDNA clone:ddv13m17, 3' ... 1241 0.0 2
(AU061076) Dictyostelium discoideum slug cDNA, clone SLC850. 745 0.0 3
(BJ435599) Dictyostelium discoideum cDNA clone:ddv27k13, 3' ... 739 0.0 4
(AU034317) Dictyostelium discoideum slug cDNA, clone SLC675. 618 0.0 3
(BJ433295) Dictyostelium discoideum cDNA clone:ddv21i12, 3' ... 1013 0.0 2
(BJ428188) Dictyostelium discoideum cDNA clone:ddv11e04, 3' ... 559 0.0 2
(AU034421) Dictyostelium discoideum slug cDNA, clone SLC850. 500 0.0 3
(AU261397) Dictyostelium discoideum vegetative cDNA clone:VS... 500 0.0 3
(AU061030) Dictyostelium discoideum slug cDNA, clone SLC675. 829 0.0 3
(BJ434131) Dictyostelium discoideum cDNA clone:ddv16a02, 3' ... 714 0.0 2
(BJ436273) Dictyostelium discoideum cDNA clone:ddv30k17, 3' ... 720 0.0 1
(BJ434673) Dictyostelium discoideum cDNA clone:ddv24j17, 3' ... 460 e-125 1
(BJ416880) Dictyostelium discoideum cDNA clone:ddv27k13, 5' ... 119 5e-34 2
(BJ413492) Dictyostelium discoideum cDNA clone:ddv16a02, 5' ... 119 5e-34 2
(BJ417535) Dictyostelium discoideum cDNA clone:ddv30m24, 5' ... 119 3e-32 2
(BJ436359) Dictyostelium discoideum cDNA clone:ddv30m24, 3' ... 151 8e-32 1
(BJ410055) Dictyostelium discoideum cDNA clone:ddv11e04, 5' ... 119 2e-30 2
(BJ415079) Dictyostelium discoideum cDNA clone:ddv21i12, 5' ... 119 1e-28 2
(BJ412974) Dictyostelium discoideum cDNA clone:ddv13m17, 5' ... 119 1e-28 2
(BJ417446) Dictyostelium discoideum cDNA clone:ddv30k17, 5' ... 119 3e-22 1
(BJ416027) Dictyostelium discoideum cDNA clone:ddv24j17, 5' ... 119 3e-22 1
(EC853783) HDE00002211 Hyperamoeba dachnaya Non-normalized (... 54 8e-18 5
(EC755736) PPE00010048 Agencourt Biosciences Agen-0020 Non-n... 50 5e-13 3
(EC756847) PPE00005913 Agencourt Biosciences Agen-0020 Non-n... 50 6e-13 3
(EC757580) PPE00004486 Agencourt Biosciences Agen-0020 Non-n... 50 6e-13 3
(EC753306) PPE00007746 Agencourt Biosciences Agen-0020 Non-n... 48 1e-12 3
(EC754719) PPE00010715 Agencourt Biosciences Agen-0020 Non-n... 50 1e-10 3
(EC756458) PPE00004748 Agencourt Biosciences Agen-0020 Non-n... 50 1e-10 3
(EC757061) PPE00004622 Agencourt Biosciences Agen-0020 Non-n... 50 1e-10 3
(EC758874) PPE00003692 Agencourt Biosciences Agen-0020 Non-n... 50 1e-10 3
(EX305126) PvEST2373 Bean pod tissue cDNA Entry Library Phas... 62 5e-07 2
(EI452766) PV_GBa0052P22.f PV_GBa Phaseolus vulgaris genomic... 62 6e-05 1
(EC762946) PPE00008214 Agencourt Biosciences Agen-0020 Non-n... 48 7e-05 2
(EC041938) 3483124 BG03 Ustilago maydis cDNA clone 1472569, ... 56 2e-04 2
(AC217587) Populus trichocarpa clone POP031-F05, complete se... 60 2e-04 1
(EC830383) TDE00002643 Advantage polymerase (lib1_td_adv) Ta... 50 4e-04 2
(CR382132) Yarrowia lipolytica chromosome F of strain CLIB12... 58 0.001 1
(DV633931) EST1102527 Dulce mature fruit library Cucumis mel... 46 0.001 2
(EX811446) CBNA2387.fwd CBNA Phycomyces blakesleeanus NRRL15... 38 0.001 3
(EX854847) CBNF11019.fwd CBNF Phycomyces blakesleeanus NRRL1... 38 0.001 3
(EX834407) CBNB4537.fwd CBNB Phycomyces blakesleeanus NRRL15... 38 0.001 3
(EX820137) CBNA692.fwd CBNA Phycomyces blakesleeanus NRRL155... 38 0.001 3
(EX819393) CBNA6551.fwd CBNA Phycomyces blakesleeanus NRRL15... 38 0.001 3
(EX818617) CBNA6173.fwd CBNA Phycomyces blakesleeanus NRRL15... 38 0.001 3
(FE860930) CAFY891.fwd CAFY Pichia stipitis oxygen limited x... 46 0.001 3
(FE846876) CAFI965.fwd CAFI Pichia stipitis aerobic dextrose... 46 0.001 3
(FE856103) CAFU453.fwd CAFU Pichia stipitis oxygen limited d... 46 0.001 3
(FE856184) CAFU495.fwd CAFU Pichia stipitis oxygen limited d... 46 0.001 3
(FE856619) CAFU727.fwd CAFU Pichia stipitis oxygen limited d... 46 0.001 3
(CD477703) eca01-11ms1-c06 Eca01 Eschscholzia californica cD... 42 0.004 2
(FE857407) CAFW438.fwd CAFW Pichia stipitis oxygen limited x... 46 0.004 3
(CD480683) eca01-12ms1-c06 Eca01 Eschscholzia californica cD... 42 0.005 2
(DY892538) CeleSEQ11095 Cunninghamella elegans pBluescript (... 52 0.006 2
(DY892797) CeleSEQ11809 Cunninghamella elegans pBluescript (... 52 0.007 2
(EH022883) MMC_31_F07 Haploid cells grown in Minimal Media m... 50 0.012 2
(FE861048) CAFY954.fwd CAFY Pichia stipitis oxygen limited x... 46 0.016 2
(DT738702) EST1172551 Aquilegia cDNA library Aquilegia formo... 42 0.019 2
(DT744099) EST1177948 Aquilegia cDNA library Aquilegia formo... 42 0.019 2
(DR927755) EST1119294 Aquilegia cDNA library Aquilegia formo... 42 0.020 2
(DT743702) EST1177551 Aquilegia cDNA library Aquilegia formo... 42 0.021 2
(DT769856) EST1203706 Aquilegia cDNA library Aquilegia formo... 42 0.022 2
(DR928141) EST1119680 Aquilegia cDNA library Aquilegia formo... 42 0.023 2
(DT734760) EST1168610 Aquilegia cDNA library Aquilegia formo... 42 0.023 2
(DR931254) EST1122793 Aquilegia cDNA library Aquilegia formo... 42 0.024 2
(DR952343) EST1143882 Aquilegia cDNA library Aquilegia formo... 42 0.024 2
(DT738701) EST1172550 Aquilegia cDNA library Aquilegia formo... 42 0.025 2
(FD671727) CBHU1841.fwd CBHU Mycosphaerella fijiensis MfEST3... 46 0.031 2
(CF640035) D22_E12 Filamentous Forced Diploid Ustilago maydi... 48 0.036 2
(DX738299) 2508243 VV03 Ustilago maydis genomic clone 107561... 48 0.046 2
(DX704582) 2490840 VV03 Ustilago maydis genomic clone 107211... 48 0.047 2
(CD489361) T22_C04 Teliospore Ustilago maydis cDNA 5', mRNA ... 48 0.049 2
(CF672887) RTCNT1_74_D06.g1_A029 Root control Pinus taeda cD... 44 0.050 3
(EC049767) 3198363 BG03 Ustilago maydis cDNA clone 1425645, ... 48 0.050 2
(EC045329) 3173315 BG03 Ustilago maydis cDNA clone 1426340, ... 48 0.050 2
(EH022523) MMC_27_E09 Haploid cells grown in Minimal Media m... 48 0.053 2
(EH022630) MMC_28_G04 Haploid cells grown in Minimal Media m... 48 0.053 2
(EH021246) HCM_12_C11 Haploid cells grown in Complete Media ... 48 0.053 2
(EH018238) HCM_24_C01 Haploid cells grown in Complete Media ... 48 0.054 2
(EH019087) HCM_34_C10 Haploid cells grown in Complete Media ... 48 0.054 2
(EH020342) HCM_48_F12 Haploid cells grown in Complete Media ... 48 0.056 2
(EH024344) MMC_49_G07 Haploid cells grown in Minimal Media m... 48 0.056 2
(DX766841) 2568669 VV07 Ustilago maydis genomic clone 111109... 48 0.056 2
(FG466816) 011203KAKA002335HT (KAKA) Dormant kiwifruit buds ... 52 0.058 1
(FG465924) 011124KAKA001234HT (KAKA) Dormant kiwifruit buds ... 52 0.058 1
(FD755844) Afi04_144_C05_C014.g1 Aristolochia fimbriata flow... 52 0.058 1
(FD750892) Afi04_69_D07_C014.b1 Aristolochia fimbriata flowe... 52 0.058 1
(EH025548) MMC_10_C09 Haploid cells grown in Minimal Media m... 48 0.060 2
(EH025143) MMC_59_E03 Haploid cells grown in Minimal Media m... 48 0.060 2
(CF642752) D55_E09 Filamentous Forced Diploid Ustilago maydi... 48 0.061 2
(DX682977) 2491566 VV03 Ustilago maydis genomic clone 107190... 48 0.061 2
(EH018015) HCM_21_D04 Haploid cells grown in Complete Media ... 48 0.062 2
(EH018988) HCM_33_C01 Haploid cells grown in Complete Media ... 48 0.062 2
(DX719262) 2188183 VV03 Ustilago maydis genomic clone 892097... 48 0.063 2
(EH024417) MMC_50_F08 Haploid cells grown in Minimal Media m... 48 0.063 2
(CF642303) D50_A09 Filamentous Forced Diploid Ustilago maydi... 48 0.063 2
(EH018944) HCM_32_G06 Haploid cells grown in Complete Media ... 48 0.063 2
(CF638815) D07_C09 Filamentous Forced Diploid Ustilago maydi... 48 0.071 2
(EC759517) PPE00001914 Agencourt Biosciences Agen-0020 Non-n... 42 0.072 2
(EY236783) CATW9344.fwd CATW Aspergillus niger Pelleted fung... 44 0.077 2
(EY245084) CATY4566.fwd CATY Aspergillus niger fungal filame... 44 0.077 2
>(BJ431300) Dictyostelium discoideum cDNA clone:ddv13m17, 3' end,
single read.
Length = 661
Score = 1241 bits (626), Expect(2) = 0.0
Identities = 640/646 (99%)
Strand = Plus / Minus
Query: 698 acgaataccaaatccaacgtggtaaacgtttaaatgaaagtgctggtctctcccacttat 757
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 acgaataccaaatccaacgtggtaaacgtttaaatgaaagtgctggtctctcccacttat 602
Query: 758 gttcattcatcaaagccgatttcatgcacgtcccagtcgaagataacacctacgattgtg 817
||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||
Sbjct: 601 gttcattcatcaaagccgatttcatgcacgtcccagtcgaanataacacctacgattgtg 542
Query: 818 cctaccaaatcgaagccacttgtcacgccccagatctcgttggtctctacaaggaagtct 877
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 cctaccaaatcgaagccacttgtcacgccccagatctcgttggtctctacaaggaagtct 482
Query: 878 tccgtatcgttaaaccaggcggtttattcggtggttatgaatggattatgaccaacaaat 937
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 tccgtatcgttaaaccaggcggtttattcggtggttatgaatggattatgaccaacaaat 422
Query: 938 tcaacccagaagacccagttgaagtcaacatcaaaaaacaaattgaattaggtaatggtc 997
|||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 tcaacccanaagacccagttgaagtcaacatcaaaaaacaaattgaattaggtaatggtc 362
Query: 998 tcccagatcttgtcaaaccagctgaaatcatcaatgctgccaaagctgctggtttcggaa 1057
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 tcccagatcttgtcaaaccagctgaaatcatcaatgctgccaaagctgctggtttcggaa 302
Query: 1058 gttatcactgctttcgatgttgctgaaacctctgaactcccatggtacttaccattatca 1117
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 gttatcactgctttcgatgttgctgaaacctctgaactcccatggtacttaccattatca 242
Query: 1118 agtggtgtctctatcactggtttcctccacactggtgtcggtcgttacttaactggtaaa 1177
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 agtggtgtctctatcactggtttcctccacactggtgtcggtcgttacttaactggtaaa 182
Query: 1178 ttcactcaactcttggaaattgtcaaattagctccagctggttcatacaacaccaacgtt 1237
||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||
Sbjct: 181 ttcactcaactcttggaaattgtcaaattagctccagctggttcatacaacnccaacgtt 122
Query: 1238 tggttacaaaatgctgctaccttcttagtccaaggtggtgaaaaacaaattttctcccca 1297
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tggttacaaaatgctgctaccttcttagtccaaggtggtgaaaaacaaattttctcccca 62
Query: 1298 atgttcttccttattatgtcgtaaaccaagcactgattaaataaaa 1343
|||||||| |||||||||||||||||||||||| |||||||||||
Sbjct: 61 atgttctttcttattatgtcgtaaaccaagcaccnattaaataaaa 16
Score = 28.2 bits (14), Expect(2) = 0.0
Identities = 14/14 (100%)
Strand = Plus / Minus
Query: 1344 ctttaattcaccca 1357
||||||||||||||
Sbjct: 14 ctttaattcaccca 1
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,208,466,208
Number of extensions: 69133289
Number of successful extensions: 5043551
Number of sequences better than 10.0: 221
Length of query: 1404
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1380
Effective length of database: 97,308,875,965
Effective search space: 134286248831700
Effective search space used: 134286248831700
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U09155-1 (Contig-U09155-1Q) /CSM_Contig/Contig-U09155-1Q.Seq.d
(1404 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BT040089_1(BT040089|pid:none) Zea mays full-length cDNA clone ZM... 158 8e-85
EU961712_1(EU961712|pid:none) Zea mays clone 237812 cycloartenol... 158 8e-85
AF045570_1(AF045570|pid:none) Zea mays (S)-adenosyl-L-methionine... 158 1e-84
(Q6ZIX2) RecName: Full=Cycloartenol-C-24-methyltransferase 1; ... 158 5e-84
T06780(T06780) probable sterol 24-C-methyltransferase (EC 2.1.1.... 159 3e-82
AF042332_1(AF042332|pid:none) Oryza sativa subsp. japonica cyclo... 158 4e-82
AC142396_17(AC142396|pid:none) Medicago truncatula clone mth2-6g... 154 4e-82
U81312_1(U81312|pid:none) Nicotiana tabacum S-adenosyl-methionin... 152 2e-81
(Q9LM02) RecName: Full=Cycloartenol-C-24-methyltransferase; ... 150 4e-81
AC135958_10(AC135958|pid:none) Oryza sativa chromosome 3 BAC OSJ... 157 4e-81
DQ116445_1(DQ116445|pid:none) Gossypium hirsutum 24-sterol C-met... 151 5e-81
BT070871_1(BT070871|pid:none) Picea sitchensis clone WS02757_D16... 153 3e-79
CP000583_379(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 151 1e-73
CR954203_375(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 148 3e-70
AM270315_12(AM270315|pid:none) Aspergillus niger contig An14c008... 149 2e-69
CT005272_246(CT005272|pid:none) Leishmania major strain Friedlin... 134 1e-68
CT005272_247(CT005272|pid:none) Leishmania major strain Friedlin... 134 1e-68
AP007171_244(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 148 5e-68
AM447844_2(AM447844|pid:none) Vitis vinifera contig VV78X026819.... 114 8e-68
AM502254_494(AM502254|pid:none) Leishmania infantum chromosome 36. 136 8e-68
BT042356_1(BT042356|pid:none) Zea mays full-length cDNA clone ZM... 146 2e-66
EU961164_1(EU961164|pid:none) Zea mays clone 233026 cycloartenol... 145 6e-66
FM160650_1(FM160650|pid:none) Aphanomyces euteiches mRNA for ste... 120 1e-65
S72460_1(S72460|pid:none) LIS1/ERG6=putative S-adenosylmethionin... 128 1e-64
CP001325_360(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 121 6e-64
T42375(T42375)probable sterol 24-C-methyltransferase (EC 2.1.1.4... 134 1e-63
D89131_1(D89131|pid:none) Schizosaccharomyces pombe mRNA, partia... 134 1e-63
EU977114_1(EU977114|pid:none) Zea mays clone 999256 cycloartenol... 133 7e-62
FN392321_381(FN392321|pid:none) Pichia pastoris GS115 chromosome... 119 1e-61
AY849610_1(AY849610|pid:none) Magnaporthe grisea sterol 24-C-met... 122 8e-61
FM992690_207(FM992690|pid:none) Candida dubliniensis CD36 chromo... 115 2e-60
(Q5EN22) RecName: Full=Sterol 24-C-methyltransferase; E... 120 3e-60
(Q875K1) RecName: Full=Sterol 24-C-methyltransferase; E... 114 1e-57
(Q9P3R1) RecName: Full=Sterol 24-C-methyltransferase; E... 122 1e-57
AE017342_308(AE017342|pid:none) Cryptococcus neoformans var. neo... 125 6e-57
(Q6BRB7) RecName: Full=Sterol 24-C-methyltransferase; E... 118 8e-57
(Q6C2D9) RecName: Full=Sterol 24-C-methyltransferase; E... 131 9e-57
X53830_1(X53830|pid:none) Yeast PDR4 gene for pdr4 protein. 126 5e-54
EF676116_1(EF676116|pid:none) Picea sitchensis clone WS02710_I13... 129 1e-53
AM494972_260(AM494972|pid:none) Leishmania braziliensis chromoso... 112 2e-53
T03845(T03845) probable sterol 24-C-methyltransferase (EC 2.1.1.... 129 3e-53
BT000750_1(BT000750|pid:none) Arabidopsis thaliana clone RAFL09-... 127 1e-52
(Q39227) RecName: Full=24-methylenesterol C-methyltransferase 2;... 127 1e-52
EU308589_1(EU308589|pid:none) Gossypium hirsutum 24-sterol C-met... 128 2e-51
U71400_1(U71400|pid:none) Arabidopsis thaliana S-adenosyl-methio... 127 3e-51
AY086699_1(AY086699|pid:none) Arabidopsis thaliana clone 2688 mR... 127 1e-50
BT034335_1(BT034335|pid:none) Zea mays full-length cDNA clone ZM... 117 2e-50
BT039535_1(BT039535|pid:none) Zea mays full-length cDNA clone ZM... 117 2e-50
EF146632_1(EF146632|pid:none) Populus trichocarpa clone WS01211_... 125 2e-49
AF042333_1(AF042333|pid:none) Oryza sativa 24-methylene lophenol... 123 1e-47
EU308590_1(EU308590|pid:none) Gossypium hirsutum 24-sterol C-met... 129 3e-47
EU962206_1(EU962206|pid:none) Zea mays clone 240947 24-methylene... 120 7e-47
BT061087_1(BT061087|pid:none) Zea mays full-length cDNA clone ZM... 120 1e-46
EU965209_1(EU965209|pid:none) Zea mays clone 284530 24-methylene... 120 1e-46
BT034685_1(BT034685|pid:none) Zea mays full-length cDNA clone ZM... 107 3e-42
DQ286898_1(DQ286898|pid:none) Paracoccidioides brasiliensis c24-... 108 3e-41
CR954208_235(CR954208|pid:none) Ostreococcus tauri strain OTTH05... 117 3e-38
(Q6FRZ7) RecName: Full=Sterol 24-C-methyltransferase; E... 120 4e-37
AY942652_1(AY942652|pid:none) Candida glabrata strain IHEM 21229... 116 8e-36
AB182921_1(AB182921|pid:none) Citrullus lanatus mRNA for sterol ... 115 4e-34
AC135599_2(AC135599|pid:none) Oryza sativa (japonica cultivar-gr... 91 4e-29
EU310475_1(EU310475|pid:none) Candida glabrata isolate IHEM 2123... 120 7e-28
AP007157_554(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 80 1e-18
AF125448_8(AF125448|pid:none) Caenorhabditis elegans fosmid H14E... 71 2e-16
AM920436_1030(AM920436|pid:none) Penicillium chrysogenum Wiscons... 72 4e-15
T33885(T33885)hypothetical protein H14E04.1 - Caenorhabditis ele... 64 2e-14
CP000686_3425(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 60 3e-14
BA000012_2838(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 69 2e-11
EU827593_22(EU827593|pid:none) Actinosynnema pretiosum subsp. pr... 57 3e-11
EU637013_1(EU637013|pid:none) Brassica napus gamma-tocopherol me... 57 5e-11
AB088119_14(AB088119|pid:none) Streptomyces sp. TP-A0274 stauros... 60 7e-11
EU962808_1(EU962808|pid:none) Zea mays clone 245696 tocopherol O... 58 1e-10
AX575745_1(AX575745|pid:none) Sequence 23 from Patent WO02072848. 57 1e-10
AF104220_1(AF104220|pid:none) Arabidopsis thaliana gamma-tocophe... 56 1e-10
AY087138_1(AY087138|pid:none) Arabidopsis thaliana clone 32143 m... 56 1e-10
BT043281_1(BT043281|pid:none) Zea mays full-length cDNA clone ZM... 57 2e-10
AF381248_1(AF381248|pid:none) Brassica oleracea gamma-tocopherol... 55 2e-10
EU637012_1(EU637012|pid:none) Brassica napus gamma-tocopherol me... 55 2e-10
FJ435093_1(FJ435093|pid:none) Brassica napus gamma-tocopherol me... 55 2e-10
(Q9ZSK1) RecName: Full=Tocopherol O-methyltransferase, chloropla... 55 3e-10
DQ508019_1(DQ508019|pid:none) Brassica napus gamma-tocopherol me... 55 3e-10
CP000239_2147(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 57 3e-10
AJ634706_1(AJ634706|pid:none) Zea mays mRNA for putative gamma-t... 56 4e-10
FJ435091_1(FJ435091|pid:none) Brassica napus gamma-tocopherol me... 54 4e-10
DQ864978_1(DQ864978|pid:none) Brassica juncea gamma-tocopherol m... 55 5e-10
AJ920394_1(AJ920394|pid:none) Triticum aestivum mRNA for g-TMT p... 58 7e-10
AF440781_11(AF440781|pid:none) Streptomyces cinnamonensis polyet... 55 7e-10
EU637014_1(EU637014|pid:none) Brassica napus gamma-tocopherol me... 53 9e-10
AE017282_81(AE017282|pid:none) Methylococcus capsulatus str. Bat... 57 9e-10
CP000850_2254(CP000850|pid:none) Salinispora arenicola CNS-205, ... 58 9e-10
AF216282_1(AF216282|pid:none) Halorhodospira halochloris sarcosi... 55 9e-10
BA000012_1289(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 48 2e-09
EU827593_23(EU827593|pid:none) Actinosynnema pretiosum subsp. pr... 54 2e-09
AB088224_28(AB088224|pid:none) Streptomyces rochei plasmid pSLA2... 46 2e-09
CT971583_376(CT971583|pid:none) Synechococcus WH7803 complete ge... 49 3e-09
CP000110_311(CP000110|pid:none) Synechococcus sp. CC9605, comple... 49 6e-09
EF084302_1(EF084302|pid:none) Picea sitchensis clone WS0283_I02 ... 52 7e-09
AC2071(AC2071) hypothetical protein all2121 [imported] - Nostoc ... 48 7e-09
CP000393_3391(CP000393|pid:none) Trichodesmium erythraeum IMS101... 52 1e-08
CP001390_235(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 56 1e-08
FJ531497_1(FJ531497|pid:none) Streptomyces bingchengensis strain... 51 1e-08
CP000951_2695(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 44 2e-08
CP000083_3200(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 49 2e-08
CP000117_1076(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 45 2e-08
CP000825_1768(CP000825|pid:none) Prochlorococcus marinus str. MI... 47 2e-08
CP000386_169(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 47 2e-08
CP001142_437(CP001142|pid:none) Phaeodactylum tricornutum CCAP 1... 53 3e-08
AX073657_1(AX073657|pid:none) Sequence 1 from Patent WO0104330. ... 47 3e-08
DQ366737_19(DQ366737|pid:none) Uncultured Prochlorococcus marinu... 44 3e-08
AX073663_1(AX073663|pid:none) Sequence 7 from Patent WO0104330. 47 3e-08
AE2031(AE2031) gamma-tocopherol methyltransferase [imported] - N... 53 3e-08
CP000552_1684(CP000552|pid:none) Prochlorococcus marinus str. MI... 43 3e-08
AF527809_14(AF527809|pid:none) Sorghum bicolor clone BAC SB_BBc0... 51 5e-08
CP000239_161(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, comp... 45 6e-08
CP000544_1646(CP000544|pid:none) Halorhodospira halophila SL1, c... 51 6e-08
DQ229828_1(DQ229828|pid:none) Helianthus annuus cultivar NMS373 ... 44 1e-07
AM270353_30(AM270353|pid:none) Aspergillus niger contig An16c001... 50 1e-07
AY647946_1(AY647946|pid:none) Arabidopsis lyrata subsp. petraea ... 52 1e-07
CP000815_519(CP000815|pid:none) Paulinella chromatophora chromat... 43 1e-07
DQ229830_1(DQ229830|pid:none) Helianthus annuus cultivar RHA280 ... 44 1e-07
DQ229831_1(DQ229831|pid:none) Helianthus annuus cultivar LG24 ga... 44 1e-07
AP008231_927(AP008231|pid:none) Synechococcus elongatus PCC 6301... 41 1e-07
CP000031_2198(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 50 2e-07
CP000806_3543(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 49 2e-07
CP001124_1441(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 47 2e-07
DQ229829_1(DQ229829|pid:none) Helianthus annuus cultivar R112 ga... 44 2e-07
AB071405_7(AB071405|pid:none) Lechevalieria aerocolonigenes rebe... 49 2e-07
CP000806_2727(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 43 3e-07
BA000039_1725(BA000039|pid:none) Thermosynechococcus elongatus B... 42 3e-07
CT573071_1881(CT573071|pid:none) Kuenenia stuttgartiensis genome... 52 3e-07
AY962639_1(AY962639|pid:none) Medicago truncatula gamma tocopher... 47 4e-07
CP000393_1875(CP000393|pid:none) Trichodesmium erythraeum IMS101... 44 4e-07
BX548174_1747(BX548174|pid:none) Prochlorococcus marinus MED4 co... 40 4e-07
CP000850_1240(CP000850|pid:none) Salinispora arenicola CNS-205, ... 52 4e-07
CP001291_1766(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 50 5e-07
AP009552_2487(AP009552|pid:none) Microcystis aeruginosa NIES-843... 49 5e-07
DQ297453_17(DQ297453|pid:none) Actinomadura melliaura strain SCC... 52 5e-07
AB376096_1(AB376096|pid:none) Hevea brasiliensis gamma-tmt mRNA ... 48 6e-07
AY396042_1(AY396042|pid:none) Streptomyces griseochromogenes C5-... 47 6e-07
CP000384_5083(CP000384|pid:none) Mycobacterium sp. MCS, complete... 46 6e-07
AE017126_1658(AE017126|pid:none) Prochlorococcus marinus subsp. ... 39 8e-07
AY293576_1(AY293576|pid:none) Chlamydomonas reinhardtii MPBQ/MSB... 47 1e-06
BX571869_139(BX571869|pid:none) Photorhabdus luminescens subsp. ... 50 1e-06
CP000553_1939(CP000553|pid:none) Prochlorococcus marinus str. NA... 42 2e-06
BA000022_2594(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 47 2e-06
EU057617_1(EU057617|pid:none) Elaeis oleifera clone EoEST-805 ga... 45 3e-06
AM778935_29(AM778935|pid:none) Microcystis aeruginosa PCC 7806 g... 42 3e-06
CP001339_1161(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 46 3e-06
AY960126_1(AY960126|pid:none) Glycine max gamma-tocopherol methy... 46 4e-06
CP000554_2345(CP000554|pid:none) Prochlorococcus marinus str. MI... 41 4e-06
CP000667_599(CP000667|pid:none) Salinispora tropica CNB-440, com... 44 4e-06
DQ456876_1(DQ456876|pid:none) Lycopersicon esculentum gamma-toco... 44 5e-06
AX089422_1(AX089422|pid:none) Sequence 7 from Patent WO0116303. ... 46 5e-06
DQ456877_1(DQ456877|pid:none) Solanum tuberosum gamma-tocopherol... 44 8e-06
BX548175_2317(BX548175|pid:none) Prochlorococcus marinus MIT9313... 40 8e-06
AF323753_8(AF323753|pid:none) Streptomyces nogalater nogalamycin... 39 8e-06
AB032524_3(AB032524|pid:none) Streptomyces avermitilis avermecti... 49 1e-05
AF040570_56(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 44 1e-05
AJ884948_1(AJ884948|pid:none) Chlamydomonas reinhardtii partial ... 37 2e-05
CR954202_569(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 43 2e-05
FJ897744_1(FJ897744|pid:none) Linum usitatissimum gamma-tocopher... 43 2e-05
CP000595_19(CP000595|pid:none) Ostreococcus lucimarinus CCE9901 ... 44 3e-05
AM114193_1654(AM114193|pid:none) Uncultured methanogenic archaeo... 41 3e-05
CP001327_40(CP001327|pid:none) Micromonas sp. RCC299 chromosome ... 42 4e-05
CP001037_5510(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 43 4e-05
AE000516_543(AE000516|pid:none) Mycobacterium tuberculosis CDC15... 52 4e-05
AE009950_137(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 47 7e-05
CR936257_588(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 52 7e-05
CP000554_1690(CP000554|pid:none) Prochlorococcus marinus str. MI... 52 7e-05
AL646053_174(AL646053|pid:none) Ralstonia solanacearum GMI1000 m... 52 7e-05
CP000961_3184(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 44 8e-05
CP001100_2166(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 51 9e-05
CP000656_1086(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 42 1e-04
CP000511_5631(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 42 1e-04
CU914166_191(CU914166|pid:none) Ralstonia solanacearum strain IP... 50 2e-04
AM475232_2(AM475232|pid:none) Vitis vinifera contig VV78X018214.... 37 2e-04
CP001337_1307(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 50 2e-04
AF216283_1(AF216283|pid:none) Actinopolyspora halophila glycine-... 50 2e-04
CP001099_1995(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 50 2e-04
BT065583_1(BT065583|pid:none) Zea mays full-length cDNA clone ZM... 41 2e-04
CP001338_2332(CP001338|pid:none) Candidatus Methanosphaerula pal... 47 2e-04
CP000127_947(CP000127|pid:none) Nitrosococcus oceani ATCC 19707,... 44 3e-04
AC079676_1(AC079676|pid:none) Arabidopsis thaliana chromosome 1 ... 36 4e-04
AY093093_1(AY093093|pid:none) Arabidopsis thaliana unknown prote... 36 4e-04
(Q9FR44) RecName: Full=Phosphoethanolamine N-methyltransferase 1... 36 4e-04
CR954207_458(CR954207|pid:none) Ostreococcus tauri strain OTTH05... 40 4e-04
EU966652_1(EU966652|pid:none) Zea mays clone 295934 unknown mRNA. 40 4e-04
EU961383_1(EU961383|pid:none) Zea mays clone 234989 phosphoethan... 36 5e-04
CP000479_2642(CP000479|pid:none) Mycobacterium avium 104, comple... 39 5e-04
AE016958_1665(AE016958|pid:none) Mycobacterium avium subsp. para... 39 5e-04
AB090883_1(AB090883|pid:none) Aster tripolium mRNA for phosphoet... 35 6e-04
AM408590_1578(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 43 7e-04
CP000804_4308(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 42 7e-04
AP006878_2242(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 45 7e-04
CP000828_4568(CP000828|pid:none) Acaryochloris marina MBIC11017,... 42 9e-04
CP001110_740(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 48 0.001
CP000804_28(CP000804|pid:none) Roseiflexus castenholzii DSM 1394... 43 0.001
(Q944H0) RecName: Full=Putative phosphoethanolamine N-methyltran... 35 0.001
AC020889_23(AC020889|pid:none) Genomic sequence for Arabidopsis ... 35 0.001
CP001329_298(CP001329|pid:none) Micromonas sp. RCC299 chromosome... 36 0.001
CU633900_172(CU633900|pid:none) Podospora anserina genomic DNA c... 40 0.001
CP000951_1761(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 37 0.001
AP008937_1076(AP008937|pid:none) Lactobacillus fermentum IFO 395... 47 0.002
CP000076_2949(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 38 0.002
AP009384_3027(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 41 0.002
AP008230_1286(AP008230|pid:none) Desulfitobacterium hafniense Y5... 47 0.002
CP001344_4460(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 37 0.002
(Q6G1I2) RecName: Full=Ubiquinone/menaquinone biosynthesis methy... 46 0.003
BA000030_654(BA000030|pid:none) Streptomyces avermitilis MA-4680... 46 0.004
CP001099_1456(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 46 0.004
CP000587_455(CP000587|pid:none) Ostreococcus lucimarinus CCE9901... 36 0.004
CP000133_2514(CP000133|pid:none) Rhizobium etli CFN 42, complete... 33 0.004
BA000030_5863(BA000030|pid:none) Streptomyces avermitilis MA-468... 39 0.004
AL939112_62(AL939112|pid:none) Streptomyces coelicolor A3(2) com... 39 0.004
(A9ILA7) RecName: Full=Ubiquinone/menaquinone biosynthesis methy... 45 0.005
AY442931_3(AY442931|pid:none) Agrobacterium tumefaciens plasmid ... 39 0.005
AM920427_1441(AM920427|pid:none) Penicillium chrysogenum Wiscons... 39 0.005
CP000588_88(CP000588|pid:none) Ostreococcus lucimarinus CCE9901 ... 45 0.006
CP000300_152(CP000300|pid:none) Methanococcoides burtonii DSM 62... 45 0.006
EF688569_1(EF688569|pid:none) Gossypium hirsutum phosphoethanola... 34 0.006
CP000431_4162(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 41 0.007
AY744396_20(AY744396|pid:none) Uncultured proteobacterium RedeBA... 41 0.007
CP000091_32(CP000091|pid:none) Ralstonia eutropha JMP134 chromos... 45 0.008
CP000232_1253(CP000232|pid:none) Moorella thermoacetica ATCC 390... 45 0.008
CP000431_5043(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 45 0.008
CP000143_729(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 ch... 44 0.011
CP000744_6263(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 44 0.011
AE006470_382(AE006470|pid:none) Chlorobium tepidum TLS, complete... 44 0.011
CP000855_843(CP000855|pid:none) Thermococcus onnurineus NA1, com... 44 0.011
(Q6GGU0) RecName: Full=Menaquinone biosynthesis methyltransferas... 39 0.011
CP000232_1413(CP000232|pid:none) Moorella thermoacetica ATCC 390... 37 0.012
CP000721_2914(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 44 0.014
CP000875_4310(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 44 0.014
AE006470_1724(AE006470|pid:none) Chlorobium tepidum TLS, complet... 44 0.014
CP000454_3789(CP000454|pid:none) Arthrobacter sp. FB24, complete... 38 0.014
CP001287_3333(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 40 0.015
AP007171_127(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 41 0.015
AE017226_256(AE017226|pid:none) Treponema denticola ATCC 35405, ... 40 0.015
CP000749_2830(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 35 0.015
AE014295_1590(AE014295|pid:none) Bifidobacterium longum NCC2705,... 35 0.023
CP000739_105(CP000739|pid:none) Sinorhizobium medicae WSM419 pla... 32 0.024
AE004091_5542(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 43 0.024
FM209186_5942(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 43 0.024
CP000304_155(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 43 0.024
(Q49XS5) RecName: Full=Menaquinone biosynthesis methyltransferas... 43 0.024
(Q73AY2) RecName: Full=Menaquinone biosynthesis methyltransferas... 43 0.024
(Q63DL9) RecName: Full=Menaquinone biosynthesis methyltransferas... 43 0.024
AE016877_4839(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 40 0.024
AM270316_8(AM270316|pid:none) Aspergillus niger contig An14c0090... 37 0.024
CP000885_3160(CP000885|pid:none) Clostridium phytofermentans ISD... 33 0.024
CP000511_2903(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 39 0.025
AE000516_3971(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 38 0.030
AL591985_434(AL591985|pid:none) Sinorhizobium meliloti 1021 plas... 32 0.031
CP000492_2044(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 43 0.031
CP000555_932(CP000555|pid:none) Methylibium petroleiphilum PM1, ... 43 0.031
(A7GN50) RecName: Full=Menaquinone biosynthesis methyltransferas... 39 0.032
CP000698_2960(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 38 0.040
CP000509_1877(CP000509|pid:none) Nocardioides sp. JS614, complet... 42 0.041
BA000011_1059(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 42 0.041
AB110138_1(AB110138|pid:none) Microcystis aeruginosa mcyJ gene f... 42 0.041
AB032549_7(AB032549|pid:none) Microcystis aeruginosa mcyD, mcyE,... 42 0.041
CP001110_1707(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 42 0.041
BT059732_1(BT059732|pid:none) Salmo salar clone ssal-rgf-506-112... 37 0.050
AE016958_671(AE016958|pid:none) Mycobacterium avium subsp. parat... 35 0.051
CP000099_2260(CP000099|pid:none) Methanosarcina barkeri str. Fus... 37 0.053
AP009493_5188(AP009493|pid:none) Streptomyces griseus subsp. gri... 39 0.053
(A5F1U0) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 35 0.053
CU459003_1576(CU459003|pid:none) Magnetospirillum gryphiswaldens... 42 0.053
CP000774_3449(CP000774|pid:none) Parvibaculum lavamentivorans DS... 42 0.053
CP000509_3260(CP000509|pid:none) Nocardioides sp. JS614, complet... 42 0.053
CP001327_558(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 42 0.053
AB110144_1(AB110144|pid:none) Microcystis aeruginosa mcyJ gene f... 42 0.053
AF328858_1(AF328858|pid:none) Lycopersicon esculentum phosphoeth... 32 0.065
CP001095_516(CP001095|pid:none) Bifidobacterium longum subsp. in... 34 0.065
CP000539_1442(CP000539|pid:none) Acidovorax sp. JS42, complete g... 31 0.065
AJ421825_18(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 37 0.068
BX640447_225(BX640447|pid:none) Bordetella bronchiseptica strain... 36 0.068
CP001618_2625(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 34 0.068
(Q7VZG7) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 37 0.068
(Q7WGT9) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 36 0.068
CP000480_1314(CP000480|pid:none) Mycobacterium smegmatis str. MC... 42 0.070
CP000362_2141(CP000362|pid:none) Roseobacter denitrificans OCh 1... 42 0.070
CP001037_377(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 42 0.070
AB110136_1(AB110136|pid:none) Microcystis aeruginosa mcyJ gene f... 42 0.070
AB254436_3(AB254436|pid:none) Microcystis viridis dnaN, trp2, mc... 42 0.070
U24241_10(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydro... 42 0.070
AB110143_1(AB110143|pid:none) Microcystis aeruginosa MCS3 mcyJ g... 42 0.070
CP000903_1415(CP000903|pid:none) Bacillus weihenstephanensis KBA... 42 0.070
AM180088_2818(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 42 0.070
CP000473_5133(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 42 0.070
CP000155_1075(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 40 0.088
CU468135_1225(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 31 0.088
AM420293_2590(AM420293|pid:none) Saccharopolyspora erythraea NRR... 37 0.088
CP000728_611(CP000728|pid:none) Clostridium botulinum F str. Lan... 41 0.091
AF417292_1(AF417292|pid:none) Castanea sativa putative sterol-C-... 41 0.091
CP000726_595(CP000726|pid:none) Clostridium botulinum A str. ATC... 41 0.091
AM412317_615(AM412317|pid:none) Clostridium botulinum A str. ATC... 41 0.091
EU016627_86(EU016627|pid:none) Uncultured Group I marine crenarc... 41 0.091
EU271803_1(EU271803|pid:none) Planktothrix agardhii No252 microc... 41 0.091
AJ441056_9(AJ441056|pid:none) Planktothrix agardhii microcystin ... 41 0.091
CP001101_1009(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 41 0.091
CP001389_1920(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 41 0.091
AY316746_62(AY316746|pid:none) Rhizobium sp. NGR234 megaplasmid ... 33 0.11
CR954207_438(CR954207|pid:none) Ostreococcus tauri strain OTTH05... 39 0.11
AE016823_2888(AE016823|pid:none) Leptospira interrogans serovar ... 35 0.11
CT573073_787(CT573073|pid:none) Kuenenia stuttgartiensis genome ... 34 0.11
AP008955_952(AP008955|pid:none) Brevibacillus brevis NBRC 100599... 35 0.11
(B5XNZ3) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 31 0.11
(B7H2Y9) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 32 0.11
BA000036_1358(BA000036|pid:none) Corynebacterium glutamicum ATCC... 39 0.11
CP000230_724(CP000230|pid:none) Rhodospirillum rubrum ATCC 11170... 41 0.12
AM420293_1947(AM420293|pid:none) Saccharopolyspora erythraea NRR... 41 0.12
CP000962_631(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 41 0.12
CP000850_943(CP000850|pid:none) Salinispora arenicola CNS-205, c... 41 0.12
AP008957_2365(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 41 0.12
AE015924_1255(AE015924|pid:none) Porphyromonas gingivalis W83, c... 41 0.12
CP000359_48(CP000359|pid:none) Deinococcus geothermalis DSM 1130... 30 0.14
CP001344_1993(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 34 0.14
CR382139_830(CR382139|pid:none) Debaryomyces hansenii strain CBS... 35 0.15
CT573071_994(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 30 0.15
CP001083_628(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 40 0.16
AE017282_2102(AE017282|pid:none) Methylococcus capsulatus str. B... 40 0.16
CP000667_1063(CP000667|pid:none) Salinispora tropica CNB-440, co... 40 0.16
CP000076_6094(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 40 0.16
CP000685_1755(CP000685|pid:none) Flavobacterium johnsoniae UW101... 40 0.16
CP001616_1804(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 40 0.16
CP000508_189(CP000508|pid:none) Nocardioides sp. JS614, complete... 40 0.16
(Q67LE6) RecName: Full=Menaquinone biosynthesis methyltransferas... 37 0.19
(B5YX17) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 30 0.19
BX572601_113(BX572601|pid:none) Rhodopseudomonas palustris CGA00... 40 0.20
CP001099_1217(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 40 0.20
AP009351_201(AP009351|pid:none) Staphylococcus aureus subsp. aur... 40 0.20
BA000033_243(BA000033|pid:none) Staphylococcus aureus subsp. aur... 40 0.20
BX571856_263(BX571856|pid:none) Staphylococcus aureus subsp. aur... 40 0.20
AJ938182_207(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 40 0.20
CP000479_3252(CP000479|pid:none) Mycobacterium avium 104, comple... 36 0.24
(A6TBT7) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 30 0.24
CU928162_2639(CU928162|pid:none) Escherichia coli ED1a chromosom... 30 0.24
(B6I7I7) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 30 0.24
(A8A296) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 30 0.24
(B7MFZ8) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 30 0.24
FM180568_2376(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 30 0.24
DQ087227_1(DQ087227|pid:none) Escherichia coli strain BL21 (DE3)... 30 0.24
(Q8FFP0) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 30 0.24
CP000970_2311(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 30 0.24
CP000058_4927(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 40 0.26
DQ489736_1668(DQ489736|pid:none) Leuconostoc citreum KM20, compl... 40 0.27
CP000860_1907(CP000860|pid:none) Candidatus Desulforudis audaxvi... 40 0.27
CP000413_49(CP000413|pid:none) Lactobacillus gasseri ATCC 33323,... 40 0.27
CR936257_476(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 40 0.27
CP000473_2445(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 40 0.27
AM746676_7977(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 40 0.27
CU633750_360(CU633750|pid:none) Cupriavidus taiwanensis str. LMG... 40 0.27
CU458896_3354(CU458896|pid:none) Mycobacterium abscessus chromos... 40 0.27
CP001344_3599(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 40 0.27
AE010299_1282(AE010299|pid:none) Methanosarcina acetivorans str.... 40 0.27
CP000026_4008(CP000026|pid:none) Salmonella enterica subsp. ente... 30 0.30
FM992695_452(FM992695|pid:none) Candida dubliniensis CD36 chromo... 34 0.31
AE010300_603(AE010300|pid:none) Leptospira interrogans serovar l... 34 0.31
AP008232_109(AP008232|pid:none) Sodalis glossinidius str. 'morsi... 32 0.31
CP000141_1757(CP000141|pid:none) Carboxydothermus hydrogenoforma... 37 0.32
CP000521_36(CP000521|pid:none) Acinetobacter baumannii ATCC 1797... 32 0.32
CP000431_7033(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 39 0.35
CP000854_3130(CP000854|pid:none) Mycobacterium marinum M, comple... 39 0.35
CP000480_6448(CP000480|pid:none) Mycobacterium smegmatis str. MC... 39 0.35
CP001504_716(CP001504|pid:none) Burkholderia glumae BGR1 chromos... 39 0.35
CP000916_350(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 39 0.35
CP001147_476(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 39 0.35
CR378668_247(CR378668|pid:none) Photobacterium profundum SS9; se... 35 0.39
CP000249_1098(CP000249|pid:none) Frankia sp. CcI3, complete geno... 35 0.40
(P64841) RecName: Full=Uncharacterized protein Rv1405c/MT1449; F... 35 0.40
CP000698_622(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 30 0.40
AE008384_1949(AE008384|pid:none) Methanosarcina mazei strain Goe... 31 0.40
CP000783_3047(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 31 0.40
(A6VDI6) RecName: Full=Ubiquinone/menaquinone biosynthesis methy... 37 0.40
(Q02EV4) RecName: Full=Ubiquinone/menaquinone biosynthesis methy... 37 0.40
BX640432_212(BX640432|pid:none) Bordetella parapertussis strain ... 33 0.40
(Q2K3S8) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 29 0.41
CP000471_2102(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 30 0.41
(Q87ND5) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 32 0.41
CP000114_1641(CP000114|pid:none) Streptococcus agalactiae A909, ... 39 0.45
FM992695_517(FM992695|pid:none) Candida dubliniensis CD36 chromo... 39 0.45
EF191541_15(EF191541|pid:none) Bacillus subtilis strain SB19 pre... 39 0.45
(P67055) RecName: Full=Menaquinone biosynthesis methyltransferas... 39 0.45
CP000922_1086(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 39 0.45
AE009950_1175(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 39 0.45
CP000360_16(CP000360|pid:none) Acidobacteria bacterium Ellin345,... 39 0.45
CP000728_1644(CP000728|pid:none) Clostridium botulinum F str. La... 39 0.45
CP000943_2625(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 39 0.45
EF191537_15(EF191537|pid:none) Bacillus subtilis strain 23 preph... 39 0.45
CP000477_1401(CP000477|pid:none) Methanosaeta thermophila PT, co... 39 0.45
CP000685_1461(CP000685|pid:none) Flavobacterium johnsoniae UW101... 39 0.45
(P59911) RecName: Full=Ubiquinone/menaquinone biosynthesis methy... 39 0.45
EU438895_1(EU438895|pid:none) Planktothrix agardhii NIVA-CYA 126... 39 0.45
AE017220_4356(AE017220|pid:none) Salmonella enterica subsp. ente... 30 0.49
AB1066(AB1066) conserved hypothetical protein STY4856 [imported]... 30 0.49
AM420293_304(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 32 0.52
BX572598_45(BX572598|pid:none) Rhodopseudomonas palustris CGA009... 29 0.52
CP000860_1030(CP000860|pid:none) Candidatus Desulforudis audaxvi... 32 0.52
CP001029_879(CP001029|pid:none) Methylobacterium populi BJ001, c... 29 0.52
CP001336_3020(CP001336|pid:none) Desulfitobacterium hafniense DC... 37 0.53
(A1S6C9) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 29 0.53
CP000891_2695(CP000891|pid:none) Shewanella baltica OS195, compl... 36 0.54
CP000753_2596(CP000753|pid:none) Shewanella baltica OS185, compl... 36 0.54
CP000563_2551(CP000563|pid:none) Shewanella baltica OS155, compl... 36 0.54
CP000699_575(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 39 0.59
CP000830_2304(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 39 0.59
CP000449_268(CP000449|pid:none) Maricaulis maris MCS10, complete... 39 0.59
AB2477(AB2477) hypothetical protein alr5370 [imported] - Nostoc ... 39 0.59
AM942444_1547(AM942444|pid:none) Corynebacterium urealyticum DSM... 39 0.59
(Q5KXU0) RecName: Full=Menaquinone biosynthesis methyltransferas... 39 0.59
(A5ISZ9) RecName: Full=Menaquinone biosynthesis methyltransferas... 39 0.59
AY210783_10(AY210783|pid:none) Nodularia spumigena strain NSOR10... 39 0.59
CU458896_4447(CU458896|pid:none) Mycobacterium abscessus chromos... 39 0.59
CT971583_360(CT971583|pid:none) Synechococcus WH7803 complete ge... 39 0.59
AF487998_2(AF487998|pid:none) Saccharopolyspora erythraea NRRL 2... 39 0.59
(B7NN47) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 29 0.68
CP000284_1573(CP000284|pid:none) Methylobacillus flagellatus KT,... 33 0.68
CP000478_3469(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 33 0.68
CP000233_936(CP000233|pid:none) Lactobacillus salivarius UCC118,... 38 0.77
AE000516_677(AE000516|pid:none) Mycobacterium tuberculosis CDC15... 38 0.77
CP000453_313(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 38 0.77
AL766853_53(AL766853|pid:none) Streptococcus agalactiae NEM316 c... 38 0.77
U66108_2(U66108|pid:none) Mycobacterium tuberculosis methoxy myc... 38 0.77
CP000717_657(CP000717|pid:none) Mycobacterium tuberculosis F11, ... 38 0.77
AE016825_3226(AE016825|pid:none) Chromobacterium violaceum ATCC ... 38 0.77
CP000248_1751(CP000248|pid:none) Novosphingobium aromaticivorans... 38 0.77
AM884176_682(AM884176|pid:none) Chlamydia trachomatis strain L2/... 38 0.77
CP000507_2027(CP000507|pid:none) Shewanella amazonensis SB2B, co... 38 0.77
CP000544_965(CP000544|pid:none) Halorhodospira halophila SL1, co... 38 0.77
AM398681_410(AM398681|pid:none) Flavobacterium psychrophilum JIP... 38 0.77
AP007151_722(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 38 0.77
CP001175_614(CP001175|pid:none) Listeria monocytogenes HCC23, co... 38 0.77
CP000254_244(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 38 0.77
(O84435) RecName: Full=Menaquinone biosynthesis methyltransferas... 38 0.77
(P49016) RecName: Full=Menaquinone biosynthesis methyltransferas... 38 0.77
B48653(B48653)hypothetical protein 2 (pip 3' region) - Lactococc... 38 0.77
AE010299_2095(AE010299|pid:none) Methanosarcina acetivorans str.... 38 0.77
CU633457_3(CU633457|pid:none) Podospora anserina genomic DNA chr... 38 0.77
AM406671_748(AM406671|pid:none) Lactococcus lactis subsp. cremor... 38 0.77
CP000252_2904(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 33 0.79
CP000569_1948(CP000569|pid:none) Actinobacillus pleuropneumoniae... 35 0.87
CP000780_1656(CP000780|pid:none) Candidatus Methanoregula boonei... 35 0.87
AM942759_1716(AM942759|pid:none) Proteus mirabilis strain HI4320... 29 0.87
(A4WCN5) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 29 0.87
(Q5E5J8) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 31 0.88
CP001620_1799(CP001620|pid:none) Corynebacterium kroppenstedtii ... 35 0.88
CP000360_1112(CP000360|pid:none) Acidobacteria bacterium Ellin34... 33 0.88
AE006470_961(AE006470|pid:none) Chlorobium tepidum TLS, complete... 38 1.0
A70614(A70614) probable mmaA2 protein - Mycobacterium tuberculos... 38 1.0
CP001108_1318(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 38 1.0
CP000697_1595(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 38 1.0
CP000927_4597(CP000927|pid:none) Caulobacter sp. K31, complete g... 38 1.0
CP001337_1295(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 38 1.0
AM408590_695(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 38 1.0
CP001101_1129(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 38 1.0
CP000482_38(CP000482|pid:none) Pelobacter propionicus DSM 2379, ... 38 1.0
AY142866_1(AY142866|pid:none) Heliobacillus mobilis 2-heptapreny... 38 1.0
CP001141_156(CP001141|pid:none) Phaeodactylum tricornutum CCAP 1... 38 1.0
AP009049_3382(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 38 1.0
(Q8CWG0) RecName: Full=Menaquinone biosynthesis methyltransferas... 38 1.0
CP001339_245(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 38 1.0
DQ531594_1(DQ531594|pid:none) Karenia brevis plastid gamma-tocop... 30 1.1
(Q98G87) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 30 1.1
CP000653_3113(CP000653|pid:none) Enterobacter sp. 638, complete ... 33 1.1
(Q6D7X5) RecName: Full=3-demethylubiquinone-9 3-methyltransferas... 29 1.1
CP001072_1009(CP001072|pid:none) Helicobacter pylori Shi470, com... 37 1.3
CP000613_2105(CP000613|pid:none) Rhodospirillum centenum SW, com... 37 1.3
AP008957_383(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 37 1.3
AE000511_412(AE000511|pid:none) Helicobacter pylori 26695, compl... 37 1.3
CU928158_1317(CU928158|pid:none) Escherichia fergusonii ATCC 354... 37 1.3
AL591688_279(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 37 1.3
CP000820_2338(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 37 1.3
CP000241_979(CP000241|pid:none) Helicobacter pylori HPAG1, compl... 37 1.3
CP001101_1064(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 37 1.3
CP000150_177(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 37 1.3
AM260480_565(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 37 1.3
CP000560_552(CP000560|pid:none) Bacillus amyloliquefaciens FZB42... 37 1.3
CP000686_1186(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 37 1.3
CP000384_1846(CP000384|pid:none) Mycobacterium sp. MCS, complete... 37 1.3
CP000148_2156(CP000148|pid:none) Geobacter metallireducens GS-15... 37 1.3
BA000045_3652(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 37 1.3
CP001358_1902(CP001358|pid:none) Desulfovibrio desulfuricans sub... 37 1.3
(P31113) RecName: Full=Menaquinone biosynthesis methyltransferas... 37 1.3
CP001472_467(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 29 1.4
CP000323_130(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 28 1.4
AL939128_31(AL939128|pid:none) Streptomyces coelicolor A3(2) com... 30 1.4
BA000043_592(BA000043|pid:none) Geobacillus kaustophilus HTA426 ... 32 1.4
CP000596_211(CP000596|pid:none) Ostreococcus lucimarinus CCE9901... 30 1.7
CP000626_655(CP000626|pid:none) Vibrio cholerae O395 chromosome ... 37 1.7
CP000240_141(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 37 1.7
CP000480_3418(CP000480|pid:none) Mycobacterium smegmatis str. MC... 37 1.7
AL583925_68(AL583925|pid:none) Mycobacterium leprae strain TN co... 37 1.7
AE015927_1689(AE015927|pid:none) Clostridium tetani E88, complet... 37 1.7
CP000511_790(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1,... 37 1.7
CP000325_3098(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 37 1.7
CP001013_463(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 37 1.7
CP000387_308(CP000387|pid:none) Streptococcus sanguinis SK36, co... 37 1.7
CP001365_1925(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 37 1.7
CP000962_1745(CP000962|pid:none) Clostridium botulinum A3 str. L... 37 1.7
>BT040089_1(BT040089|pid:none) Zea mays full-length cDNA clone
ZM_BFc0064H03 mRNA, complete cds.
&EU951866_1(EU951866|pid:none) &T04138(T04138)
&U79669_1(U79669|pid:none)
Length = 344
Score = 158 bits (400), Expect(3) = 8e-85
Identities = 71/129 (55%), Positives = 90/129 (69%)
Frame = +1
Query: 667 SGANVVGFNNNEYQIQRGKRLNESAGLSHLCSFIKADFMHVPVEDNTYDCAYQIEATCHA 846
S +V G NNNEYQI RGK LN AG+S C F+KADFM +P +DNT+D Y IEATCHA
Sbjct: 122 SSTSVTGLNNNEYQITRGKELNRLAGISGTCDFVKADFMKMPFDDNTFDAVYAIEATCHA 181
Query: 847 PDLVGLYKEVFRIVKPGGLFGGYEWIMTNKFNPEDPVEVNIKKQIELGNGLPDLVKPAEI 1026
PD VG YKE++R++KPG F YEW +T+ ++P + IK +IELGNGLPD+ +
Sbjct: 182 PDPVGCYKEIYRVLKPGQCFAVYEWCITDHYDPNNATHKRIKDEIELGNGLPDIRSTRQC 241
Query: 1027 INAAKAAGF 1053
+ A K AGF
Sbjct: 242 LQAVKDAGF 250
Score = 123 bits (308), Expect(3) = 8e-85
Identities = 56/86 (65%), Positives = 68/86 (79%)
Frame = +3
Query: 399 QARKNNYTHMVNTFYVLATDFYEFGWGQSFHFATRHKYESFEASIARHEMYMAHQLGLFP 578
+ARK+NYT MVN +Y LAT FYE+GWG+SFHFA R ES SI RHE ++A QLGL P
Sbjct: 41 EARKSNYTDMVNKYYDLATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLGLKP 100
Query: 579 GMKVIDIGCGVGGPMRTIARFSGANV 656
GMKV+D+GCG+GGP+R IARFS +V
Sbjct: 101 GMKVLDVGCGIGGPLREIARFSSTSV 126
Score = 79.0 bits (193), Expect(3) = 8e-85
Identities = 42/88 (47%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
Frame = +2
Query: 1055 EVITAFDVAETSELPWYLPLS-SGVSITGFLHTGVGRYLTGKFTQLLEIVKLAPAGSYNT 1231
EV+ D+AE S LPWYLPL S S++ F T VGR +T + LE V LAP GS
Sbjct: 251 EVVWDKDLAEDSPLPWYLPLDPSRFSLSSFRLTSVGRMITRTMVKALEYVGLAPQGSERV 310
Query: 1232 NVWLQNAATFLVQGGEKQIFSPMFFLIM 1315
+ +L+ AA LV+GG+K+IF+PM+F ++
Sbjct: 311 SNFLEKAAEGLVEGGKKEIFTPMYFFLV 338
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 2,191,201,836
Number of extensions: 43944283
Number of successful extensions: 129283
Number of sequences better than 10.0: 739
Number of HSP's gapped: 129084
Number of HSP's successfully gapped: 1180
Length of query: 468
Length of database: 1,040,966,779
Length adjustment: 132
Effective length of query: 336
Effective length of database: 618,001,159
Effective search space: 207648389424
Effective search space used: 207648389424
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|