| Homology vs DNA |
 Query= Contig-U08784-1 (Contig-U08784-1Q) /CSM_Contig/Contig-U08784-1Q.Seq.d
(1369 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ432330) Dictyostelium discoideum cDNA clone:ddv18j12, 3' ... 1134 0.0 1
(BJ344986) Dictyostelium discoideum cDNA clone:dda21p06, 3' ... 965 0.0 3
(BJ323394) Dictyostelium discoideum cDNA clone:dda10k07, 5' ... 712 0.0 3
(AU034544) Dictyostelium discoideum slug cDNA, clone SLC424. 870 0.0 2
(AU037501) Dictyostelium discoideum slug cDNA, clone SSD715. 775 0.0 3
(BJ346331) Dictyostelium discoideum cDNA clone:dda30h17, 3' ... 874 0.0 1
(BJ339787) Dictyostelium discoideum cDNA clone:dda10k07, 3' ... 803 0.0 2
(BJ347491) Dictyostelium discoideum cDNA clone:dda27c09, 3' ... 797 0.0 1
(BJ346309) Dictyostelium discoideum cDNA clone:dda30d18, 3' ... 793 0.0 1
(BJ343574) Dictyostelium discoideum cDNA clone:dda16b14, 3' ... 763 0.0 3
(BJ345645) Dictyostelium discoideum cDNA clone:dda28h09, 3' ... 712 0.0 2
(AU072217) Dictyostelium discoideum slug cDNA, clone SSD715. 470 e-128 1
(AU261968) Dictyostelium discoideum vegetative cDNA clone:VS... 113 2e-45 2
(BJ328479) Dictyostelium discoideum cDNA clone:dda28h09, 5' ... 135 5e-27 1
(FC567244) CAWF7022.fwd CAWF Lottia gigantea from mantle (H)... 58 6e-27 7
(FC677384) CAXX11890.fwd CAXX Lottia gigantea from male gona... 58 7e-27 7
(FC700622) CAXX8426.fwd CAXX Lottia gigantea from male gonad... 52 3e-25 7
(CZ285350) cp40g02.r Candida parapsilosis Random Genomic Lib... 76 8e-25 5
(EC755408) PPE00003022 Agencourt Biosciences Agen-0020 Non-n... 54 3e-20 4
(EC753855) PPE00007234 Agencourt Biosciences Agen-0020 Non-n... 54 3e-18 3
(CV831140) ID0ACC17CA04RM1 ID0ACC Acyrthosiphon pisum cDNA c... 54 5e-18 4
(ES623702) NGPPE35TR NGPP Nasonia giraulti cDNA, mRNA sequence. 44 5e-17 6
(DB753343) Apis mellifera head cDNA, RIKEN full-length enric... 68 5e-16 2
(DB751801) Apis mellifera head cDNA, RIKEN full-length enric... 68 5e-16 2
(DB746776) Apis mellifera head cDNA, RIKEN full-length enric... 68 5e-16 2
(CV838255) ID0ACC7BH06RM1 ID0ACC Acyrthosiphon pisum cDNA cl... 48 1e-14 4
(EE139440) SiJWH10CAE Lausanne fire ant library Solenopsis i... 52 1e-14 4
(BJ326439) Dictyostelium discoideum cDNA clone:dda16b14, 5' ... 94 2e-14 1
(AL409320) T7 end of clone AV0AA014C04 of library AV0AA from... 48 2e-14 4
(EE146864) SiJWH10CAER7A03 Lausanne fire ant library Solenop... 52 4e-14 4
(FF318596) 280396484 Pea aphid whole body normalized full le... 48 1e-13 4
(EC389082) G12_G12gm3p23_pDNRf_491586 Myzus persicae, line G... 44 4e-13 4
(DW092734) CLPY4024.b1_P21.ab1 CLP(XYZ) lettuce perennis Lac... 54 1e-12 3
(DN314902) PL06019B1D04 cDNA from juvenile hermaphodites Sch... 84 3e-12 2
(DQ449030) Lycopersicon esculentum GDP-mannose pyrophosphory... 60 3e-12 4
(AY605668) Lycopersicon esculentum GDP-mannose pyrophosphory... 60 3e-12 4
(EA376452) Sequence 25275 from patent US 7314974. 58 2e-11 4
(DJ205265) Method for identification of useful proteins deri... 58 2e-11 4
(AX830524) Sequence 1244 from Patent WO03072602. 58 2e-11 4
(AX819494) Sequence 1244 from Patent EP1338608. 58 2e-11 4
(AX595396) Sequence 1050 from Patent EP1258494. 58 2e-11 4
(U19608) Saccharomyces cerevisiae putative NDP-hexose pyroph... 58 2e-11 5
(DW090405) CLPY1662.b1_L07.ab1 CLP(XYZ) lettuce perennis Lac... 44 5e-11 3
(BP890171) Solanum lycopersicum cDNA, clone: FB02DA11, 5' en... 60 6e-11 3
(BP888511) Solanum lycopersicum cDNA, clone: FA54AC08, 5' en... 60 6e-11 3
(BQ993764) QGF5G14.yg.ab1 QG_EFGHJ lettuce serriola Lactuca ... 46 7e-11 3
(BI207241) EST525281 cTOS Solanum lycopersicum cDNA clone cT... 60 9e-11 3
(DT735093) EST1168943 Aquilegia cDNA library Aquilegia formo... 44 9e-11 4
(DV601879) EST1204874 Glossina morsitans morsitans Fat body ... 42 9e-11 4
(AW443783) EST308713 tomato mixed elicitor, BTI Solanum lyco... 60 1e-10 3
(DR945132) EST1136671 Aquilegia cDNA library Aquilegia formo... 44 1e-10 4
(DR937837) EST1129376 Aquilegia cDNA library Aquilegia formo... 44 1e-10 4
(BT012749) Lycopersicon esculentum clone 113688F, mRNA seque... 52 1e-10 3
(DY581973) B011-H10 Acropora millepora prawn chip library B ... 40 2e-10 4
(U24437) Saccharomyces cerevisiae mannose-1-phosphate guanyl... 58 2e-10 4
(ES401979) MUT07-F05.x1d-t SHGC-MUT Mytilus californianus cD... 48 3e-10 3
(Z74103) S.cerevisiae chromosome IV reading frame ORF YDL055c. 58 8e-10 4
(DB641275) Saccharomyces cerevisiae mRNA, clone: S03052-17_N... 50 1e-09 4
(FC552132) AIAI-aad96e03.b1 Anclostoma_caninum_EST_L3_Activa... 50 2e-09 3
(CD116950) ME1-0043T-M173-F03-U.G ME1-0043 Schistosoma manso... 36 3e-09 5
(BE459933) EST415225 tomato developing/immature green fruit ... 54 3e-09 3
(FC252043) CAGH7222.fwd CAGH Nematostella vectensis Nemve La... 60 7e-09 2
(CZ285349) cp40g02.f Candida parapsilosis Random Genomic Lib... 50 8e-09 3
(FC261757) CAGN13636.fwd CAGN Nematostella vectensis Nemve m... 60 9e-09 2
(FC222849) CAGF7163.fwd CAGF Nematostella vectensis Nemve Ea... 60 9e-09 2
(FC287908) CAGN4171.fwd CAGN Nematostella vectensis Nemve mi... 60 9e-09 2
(FC257512) CAGN11025.fwd CAGN Nematostella vectensis Nemve m... 60 9e-09 2
(EL448552) CHTM27229.b1_J16.ab1 CHT(LMS) Jerusalem artichoke... 38 1e-08 5
(BQ872057) QGI13I20.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 1e-08 3
(BQ861621) QGC19C04.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 1e-08 3
(BQ874895) QGI6J07.yg.ab1 QG_ABCDI lettuce salinas Lactuca s... 46 1e-08 3
(BQ852273) QGB17J10.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 1e-08 3
(BQ864388) QGC26I18.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 1e-08 3
(BQ849920) QGB11C21.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 1e-08 3
(BQ860090) QGC14N03.yg.ab1 QG_ABCDI lettuce salinas Lactuca ... 46 2e-08 3
(AJ551274) Kluyveromyces lactis psa1 gene for putative nucle... 50 4e-08 4
(DY966538) CLSM17701.b1_I09.ab1 CLS(LMS) lettuce sativa Lact... 46 4e-08 3
(CA277175) SCRLSD2013H09.g SD2 Saccharum officinarum cDNA cl... 42 6e-08 5
(BP126843) Bombyx mori cDNA, clone:psV30687, 5' end sequence. 56 1e-07 3
(BP126892) Bombyx mori cDNA, clone:psV30738, 5' end sequence. 56 1e-07 3
(EF085484) Picea sitchensis clone WS02714_K19 unknown mRNA. 40 1e-07 5
(BP126782) Bombyx mori cDNA, clone:psV30618, 5' end sequence. 56 1e-07 3
(AJ831915) Lycopersicon esculentum var. cerasiforme EST, clo... 60 3e-07 2
(ES893244) LET059_2006-11-02_1/LET059_F07_027_1 Solanum lyco... 60 3e-07 2
(BP892429) Solanum lycopersicum cDNA, clone: FB10AF10, 5' en... 60 3e-07 2
(EY467772) AIAG-aaa28c10.g1 Anclostoma_caninum_EST_L3_Normal... 44 4e-07 3
(FF510061) G709P525RE4.T0 Acorn worm normalized neurula pExp... 52 4e-07 3
(EH431910) NPE00000517 Neocallimastix patriciarum ZAP II cDN... 42 5e-07 4
(AL437124) T7 end of clone BC0AA007D03 of library BC0AA from... 54 6e-07 2
(DJ025872) Genome-wide DNA marker of Saccharomyces cerevisiae. 58 9e-07 2
(DB754721) Apis mellifera head cDNA, RIKEN full-length enric... 68 1e-06 1
(DB750410) Apis mellifera head cDNA, RIKEN full-length enric... 68 1e-06 1
(DB738661) Apis mellifera head cDNA, RIKEN full-length enric... 68 1e-06 1
(DB728368) Apis mellifera head cDNA, RIKEN full-length enric... 68 1e-06 1
(CN762832) ID0AAA5BC10RM1 ApMS Acyrthosiphon pisum cDNA clon... 48 1e-06 2
(EX629365) 255458226 Pea aphid whole body normalized full le... 48 1e-06 2
(EX616978) 255397032 Pea aphid whole body normalized full le... 48 1e-06 2
(AB066279) Nicotiana tabacum GMPase mRNA for GDP-D-mannose p... 40 1e-06 3
(FG638133) TT-39_L14 Samsun trichome library Nicotiana tabac... 40 1e-06 3
(DY959453) CLSL1439.b1_M24.ab1 CLS(LMS) lettuce sativa Lactu... 42 2e-06 3
>(BJ432330) Dictyostelium discoideum cDNA clone:ddv18j12, 3' end,
single read.
Length = 578
Score = 1134 bits (572), Expect = 0.0
Identities = 572/572 (100%)
Strand = Plus / Minus
Query: 649 aaagttgaagaaccttccaaaatatggtgtcgttgtttataaagaagaaaatggtcaaat 708
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 572 aaagttgaagaaccttccaaaatatggtgtcgttgtttataaagaagaaaatggtcaaat 513
Query: 709 cttaaaattcgttgaaaaacctcaagtctacgttggtaataaaattaatgctggtgttta 768
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 512 cttaaaattcgttgaaaaacctcaagtctacgttggtaataaaattaatgctggtgttta 453
Query: 769 tatttttaatccaacaattttagatagaattcaaccaaaaccaacatcaattgaaaaaga 828
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 452 tatttttaatccaacaattttagatagaattcaaccaaaaccaacatcaattgaaaaaga 393
Query: 829 gattttcccagcaatggcagcagatagtcaattatattgtatgcaattggaaggattttg 888
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 392 gattttcccagcaatggcagcagatagtcaattatattgtatgcaattggaaggattttg 333
Query: 889 gatggatgttggtcaaccaaaagactttttatcaggtatgggattatatttaaattcatt 948
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 332 gatggatgttggtcaaccaaaagactttttatcaggtatgggattatatttaaattcatt 273
Query: 949 aaagtcaaaacaaccagaactcttagctactggcaatggtattattggaccagttttaat 1008
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 272 aaagtcaaaacaaccagaactcttagctactggcaatggtattattggaccagttttaat 213
Query: 1009 tgatccatcatctgtcattgaaccaggttgtttaattggcccaaacgtaacaattggtcc 1068
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 212 tgatccatcatctgtcattgaaccaggttgtttaattggcccaaacgtaacaattggtcc 153
Query: 1069 aaattgtgttattcaagaaggtactcgtttagttaatacaacagttttagagggtactac 1128
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 152 aaattgtgttattcaagaaggtactcgtttagttaatacaacagttttagagggtactac 93
Query: 1129 aattggtaaaaactcttggatcaaatctactatcattggttggaactcttcaattggtaa 1188
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 92 aattggtaaaaactcttggatcaaatctactatcattggttggaactcttcaattggtaa 33
Query: 1189 atgggttagaatggaaaatacctctgttctcg 1220
||||||||||||||||||||||||||||||||
Sbjct: 32 atgggttagaatggaaaatacctctgttctcg 1
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,402,649,022
Number of extensions: 84620245
Number of successful extensions: 6821417
Number of sequences better than 10.0: 579
Length of query: 1369
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1345
Effective length of database: 97,308,875,965
Effective search space: 130880438172925
Effective search space used: 130880438172925
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U08784-1 (Contig-U08784-1Q) /CSM_Contig/Contig-U08784-1Q.Seq.d
(1369 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q68EY9) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 277 e-114
(Q68EQ1) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 275 e-113
(Q6DBU5) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 268 e-112
FJ489652_1(FJ489652|pid:none) Carica papaya GDP-mannose pyrophos... 265 e-111
AK061976_1(AK061976|pid:none) Oryza sativa Japonica Group cDNA c... 255 e-111
(A2VD83) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 267 e-111
AC135209_2(AC135209|pid:none) Oryza sativa (japonica cultivar-gr... 254 e-111
FJ643600_1(FJ643600|pid:none) Actinidia latifolia GDP-D-mannose ... 259 e-111
AY639647_1(AY639647|pid:none) Medicago sativa GMPase (GMP) mRNA,... 258 e-110
BT070323_1(BT070323|pid:none) Picea sitchensis clone WS0271_H15 ... 253 e-110
EF619965_1(EF619965|pid:none) Pinus taeda GDP-mannose pyrophosph... 260 e-109
AC003000_8(AC003000|pid:none) Arabidopsis thaliana chromosome 2 ... 257 e-109
DQ851859_1(DQ851859|pid:none) Viola baoshanensis GDP-D-mannose p... 255 e-109
AY605668_1(AY605668|pid:none) Lycopersicon esculentum GDP-mannos... 252 e-109
BT042900_1(BT042900|pid:none) Zea mays full-length cDNA clone ZM... 250 e-109
A97607_1(A97607|pid:none) Sequence 1 from Patent WO9915674. &AF... 252 e-109
EF619966_1(EF619966|pid:none) Pinus taeda GDP-mannose pyrophosph... 247 e-108
DQ449030_1(DQ449030|pid:none) Lycopersicon esculentum GDP-mannos... 251 e-108
(Q9Y5P6) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 258 e-106
(Q8BTZ7) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 258 e-106
AF135421_1(AF135421|pid:none) Homo sapiens GDP-mannose pyrophosp... 258 e-106
D89128_1(D89128|pid:none) Schizosaccharomyces pombe mRNA, partia... 244 e-106
(P0C5I2) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 256 e-106
DQ440409_1(DQ440409|pid:none) Aedes aegypti clone AET-5417 GDP-m... 253 e-106
EF677964_1(EF677964|pid:none) Picea sitchensis clone WS02811_N03... 250 e-106
(Q7RVR8) RecName: Full=Mannose-1-phosphate guanyltransferase; ... 244 e-105
(Q2YDJ9) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 255 e-105
U24437_1(U24437|pid:none) Saccharomyces cerevisiae mannose-1-pho... 241 e-103
AK024319_1(AK024319|pid:none) Homo sapiens cDNA FLJ14257 fis, cl... 243 e-102
(Q6FRY2) RecName: Full=Mannose-1-phosphate guanyltransferase 2; ... 235 e-101
(Q752H4) RecName: Full=Mannose-1-phosphate guanyltransferase; ... 236 e-101
FJ752241_1(FJ752241|pid:none) Malus x domestica GDP-D-mannose py... 253 e-101
CR380950_39(CR380950|pid:none) Candida glabrata strain CBS138 ch... 233 e-100
CU928168_583(CU928168|pid:none) Kluyveromyces thermotolerans str... 231 e-100
(Q2UJU5) RecName: Full=Mannose-1-phosphate guanyltransferase; ... 238 e-100
(Q5B1J4) RecName: Full=Mannose-1-phosphate guanyltransferase; ... 234 4e-99
(O93827) RecName: Full=Mannose-1-phosphate guanyltransferase; ... 234 9e-99
AL161577_20(AL161577|pid:none) Arabidopsis thaliana DNA chromoso... 235 9e-99
(Q61S97) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 233 1e-98
FN392321_892(FN392321|pid:none) Pichia pastoris GS115 chromosome... 233 1e-98
(Q9Y725) RecName: Full=Mannose-1-phosphate guanyltransferase 1; ... 231 1e-98
AF030300_1(AF030300|pid:none) Candida albicans strain 1161 clone... 232 5e-98
AY142530_1(AY142530|pid:none) Arabidopsis thaliana putative GDP-... 235 2e-97
AY426181_1(AY426181|pid:none) Cryptococcus neoformans var. neofo... 231 5e-97
DQ116945_1(DQ116945|pid:none) Cryptococcus neoformans var. neofo... 231 5e-97
(Q6BN12) RecName: Full=Mannose-1-phosphate guanyltransferase; ... 230 5e-96
AM502241_12(AM502241|pid:none) Leishmania infantum chromosome 23. 215 1e-93
BT084417_1(BT084417|pid:none) Zea mays full-length cDNA clone ZM... 258 2e-92
FJ546463_1(FJ546463|pid:none) Ribes nigrum GDP-D-mannose pyropho... 253 6e-78
(Q295Y7) RecName: Full=Mannose-1-phosphate guanyltransferase bet... 266 1e-69
AK243016_1(AK243016|pid:none) Oryza sativa Japonica Group cDNA, ... 259 2e-67
AM920437_604(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 238 4e-61
AF043695_7(AF043695|pid:none) Caenorhabditis elegans cosmid C42C... 231 4e-59
FN318322_1(FN318322|pid:none) Schistosoma japonicum isolate Anhu... 225 3e-57
AK129456_1(AK129456|pid:none) Mus musculus premature mRNA for mK... 219 2e-55
AE014187_200(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 124 4e-55
FJ618566_1(FJ618566|pid:none) Oncidium Gower Ramsey GDP-D-mannos... 191 7e-54
AC091701_34(AC091701|pid:none) Trypanosoma brucei chromosome 8 c... 213 1e-53
AY548900_5(AY548900|pid:none) Antonospora locustae hypothetical ... 125 6e-50
AY426182_1(AY426182|pid:none) Cryptococcus neoformans var. neofo... 132 1e-47
AM910995_283(AM910995|pid:none) Plasmodium knowlesi strain H chr... 114 6e-46
BT068572_1(BT068572|pid:none) Zea mays full-length cDNA clone ZM... 130 9e-44
BT039434_1(BT039434|pid:none) Zea mays full-length cDNA clone ZM... 129 1e-42
EU962265_1(EU962265|pid:none) Zea mays clone 241392 mannose-1-ph... 128 2e-42
BT083361_1(BT083361|pid:none) Anoplopoma fimbria clone afim-evh-... 124 5e-42
AC008263_12(AC008263|pid:none) Arabidopsis thaliana chromosome 1... 124 8e-42
AK070806_1(AK070806|pid:none) Oryza sativa Japonica Group cDNA c... 125 1e-41
AY062521_1(AY062521|pid:none) Arabidopsis thaliana putative GDP-... 122 2e-41
(Q922H4) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 119 2e-41
AK150473_1(AK150473|pid:none) Mus musculus bone marrow macrophag... 119 2e-41
(Q5XIC1) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 119 4e-41
(Q0VFM6) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 120 5e-41
(Q96IJ6) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 118 5e-41
AK000999_1(AK000999|pid:none) Homo sapiens cDNA FLJ10137 fis, cl... 118 5e-41
(B0CM52) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 118 5e-41
(Q7SXP8) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 124 7e-41
(Q6GMK8) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 123 2e-40
AK290671_1(AK290671|pid:none) Homo sapiens cDNA FLJ78735 complet... 118 2e-40
AB170195_1(AB170195|pid:none) Macaca fascicularis brain cDNA clo... 118 3e-40
AF135422_1(AF135422|pid:none) Homo sapiens GDP-mannose pyrophosp... 115 3e-40
(Q66KG5) RecName: Full=Mannose-1-phosphate guanyltransferase alp... 115 4e-40
AC141109_24(AC141109|pid:none) Medicago truncatula clone mth2-16... 117 1e-38
AC006955_31(AC006955|pid:none) Arabidopsis thaliana chromosome 2... 112 2e-38
BT034783_1(BT034783|pid:none) Zea mays full-length cDNA clone ZM... 130 1e-37
CP000924_521(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 96 3e-36
CP000923_988(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 96 3e-36
CR382131_619(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 115 6e-36
CR940348_320(CR940348|pid:none) Theileria annulata strain Ankara... 154 7e-36
AE008691_1874(AE008691|pid:none) Thermoanaerobacter tengcongensi... 98 8e-35
BT080642_1(BT080642|pid:none) Caligus clemensi clone ccle-evs-51... 94 1e-34
AP007155_165(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 102 3e-34
AY814415_1(AY814415|pid:none) Schistosoma japonicum SJCHGC05413 ... 148 5e-34
CP000568_3066(CP000568|pid:none) Clostridium thermocellum ATCC 2... 91 7e-34
AC006780_6(AC006780|pid:none) Caenorhabditis elegans cosmid Y47D... 104 9e-34
AP009493_6141(AP009493|pid:none) Streptomyces griseus subsp. gri... 85 1e-33
AM238663_1346(AM238663|pid:none) Streptomyces ambofaciens ATCC 2... 83 1e-32
AL939108_245(AL939108|pid:none) Streptomyces coelicolor A3(2) co... 83 3e-32
AE010299_3059(AE010299|pid:none) Methanosarcina acetivorans str.... 99 2e-31
CP000852_550(CP000852|pid:none) Caldivirga maquilingensis IC-167... 101 4e-31
AJ248284_180(AJ248284|pid:none) Pyrococcus abyssi complete genom... 86 4e-31
CP000088_1392(CP000088|pid:none) Thermobifida fusca YX, complete... 86 1e-30
AE009950_1728(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 82 1e-30
AE008691_55(AE008691|pid:none) Thermoanaerobacter tengcongensis ... 82 6e-30
AE008384_378(AE008384|pid:none) Methanosarcina mazei strain Goe1... 93 9e-30
CP000855_663(CP000855|pid:none) Thermococcus onnurineus NA1, com... 95 2e-29
AP006840_1120(AP006840|pid:none) Symbiobacterium thermophilum IA... 94 2e-29
CP001229_987(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 84 3e-29
CP001080_968(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 82 3e-29
CP000386_1604(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 91 4e-29
FN392320_94(FN392320|pid:none) Pichia pastoris GS115 chromosome ... 100 5e-29
CP000386_1417(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 84 6e-29
CP001146_1254(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 92 6e-29
A71095(A71095) probable sugar-phosphate nucleotydyl transferase ... 95 1e-28
CP000909_2901(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 79 1e-28
GM016639_242(GM016639|pid:none) Sequence 1469 from Patent EP1923... 96 2e-28
CP000232_1884(CP000232|pid:none) Moorella thermoacetica ATCC 390... 79 3e-28
A70978(A70978) probable rmlA2 protein - Mycobacterium tuberculos... 88 3e-28
AE000666_1716(AE000666|pid:none) Methanothermobacter thermautotr... 86 5e-28
CP000804_3194(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 77 1e-27
(O60064) RecName: Full=Probable mannose-1-phosphate guanyltransf... 92 2e-27
CP000142_3145(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 81 3e-27
CP000820_4897(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 75 4e-27
AP008955_3785(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 83 4e-27
AM114193_2418(AM114193|pid:none) Uncultured methanogenic archaeo... 79 4e-27
BA000023_2453(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 95 4e-27
CP000504_920(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 104 5e-27
AP011115_6371(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 91 5e-27
BA000045_3341(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 75 7e-27
AP009552_4023(AP009552|pid:none) Microcystis aeruginosa NIES-843... 73 1e-26
CP000384_1311(CP000384|pid:none) Mycobacterium sp. MCS, complete... 87 2e-26
AM778921_1(AM778921|pid:none) Microcystis aeruginosa PCC 7806 ge... 72 2e-26
AJ621349_1(AJ621349|pid:none) Thermoproteus tenax snt5 gene for ... 110 2e-26
CP001338_2070(CP001338|pid:none) Candidatus Methanosphaerula pal... 76 3e-26
CP000804_722(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 80 4e-26
CP001348_1900(CP001348|pid:none) Clostridium cellulolyticum H10,... 79 7e-26
CP000660_1557(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 100 1e-25
CP000951_935(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 72 1e-25
BA000030_5044(BA000030|pid:none) Streptomyces avermitilis MA-468... 80 3e-25
CP000698_843(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 76 4e-25
CP000300_2174(CP000300|pid:none) Methanococcoides burtonii DSM 6... 79 5e-25
CP001098_1584(CP001098|pid:none) Halothermothrix orenii H 168, c... 74 6e-25
CP001601_657(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 86 6e-25
CP000479_4067(CP000479|pid:none) Mycobacterium avium 104, comple... 84 6e-25
CP000511_1701(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 87 8e-25
CP000860_983(CP000860|pid:none) Candidatus Desulforudis audaxvia... 70 1e-24
AB2101(AB2101) mannose-1-phosphate guanyltransferase [imported] ... 71 1e-24
CP000612_2292(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 74 2e-24
CP000325_2161(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 84 2e-24
CP000820_5753(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 80 2e-24
CP000117_182(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 70 3e-24
AE001437_2935(AE001437|pid:none) Clostridium acetobutylicum ATCC... 69 3e-24
CP001014_869(CP001014|pid:none) Thermoproteus neutrophilus V24St... 97 3e-24
CP001186_4292(CP001186|pid:none) Bacillus cereus G9842, complete... 74 4e-24
CP000559_1299(CP000559|pid:none) Methanocorpusculum labreanum Z,... 77 5e-24
CP000481_449(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 83 5e-24
EF464674_1(EF464674|pid:none) Gossypium hirsutum GDP-mannose pyr... 76 5e-24
CP000575_200(CP000575|pid:none) Staphylothermus marinus F1, comp... 70 6e-24
CP000568_1937(CP000568|pid:none) Clostridium thermocellum ATCC 2... 70 6e-24
AE009441_2506(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 92 7e-24
CP000679_123(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 86 8e-24
AP008957_2149(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 81 8e-24
CP000678_655(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 76 1e-23
CP001291_514(CP001291|pid:none) Cyanothece sp. PCC 7424, complet... 67 2e-23
BA000011_80(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA, ... 74 2e-23
CP000780_1890(CP000780|pid:none) Candidatus Methanoregula boonei... 75 3e-23
CP000431_5379(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 82 3e-23
CP001037_5638(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 67 4e-23
CP000102_1258(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 79 9e-23
CP000300_2171(CP000300|pid:none) Methanococcoides burtonii DSM 6... 84 1e-22
CP000867_1569(CP000867|pid:none) Methanococcus maripaludis C6, c... 83 2e-22
BA000036_742(BA000036|pid:none) Corynebacterium glutamicum ATCC ... 81 2e-22
AP009044_862(AP009044|pid:none) Corynebacterium glutamicum R DNA... 81 3e-22
CP000922_880(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 67 3e-22
BA000035_756(BA000035|pid:none) Corynebacterium efficiens YS-314... 79 3e-22
AE004437_6(AE004437|pid:none) Halobacterium sp. NRC-1, complete ... 74 4e-22
A69079(A69079) glucose-1-phosphate thymidylyltransferase homolog... 75 1e-21
CP000909_2634(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 73 1e-21
CP000673_950(CP000673|pid:none) Clostridium kluyveri DSM 555, co... 65 1e-21
AE010299_2941(AE010299|pid:none) Methanosarcina acetivorans str.... 72 1e-21
CP001365_1069(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 70 2e-21
CP000254_2535(CP000254|pid:none) Methanospirillum hungatei JF-1,... 64 2e-21
BA000045_3703(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 65 3e-21
(A6VG23) RecName: Full=Bifunctional protein glmU; Includes: Re... 81 4e-21
AM114193_1519(AM114193|pid:none) Uncultured methanogenic archaeo... 84 5e-21
AJ965256_941(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 75 6e-21
BA000045_3084(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 66 6e-21
CP000688_1006(CP000688|pid:none) Dehalococcoides sp. BAV1, compl... 74 8e-21
AL445067_251(AL445067|pid:none) Thermoplasma acidophilum complet... 64 1e-20
AP009049_1651(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 63 2e-20
CP000673_1733(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 63 2e-20
CP001344_1278(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 66 3e-20
AJ965256_414(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 67 5e-20
AJ248288_159(AJ248288|pid:none) Pyrococcus abyssi complete genom... 80 7e-20
CP000688_498(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 67 7e-20
AJ006265_1(AJ006265|pid:none) Trypanosoma cruzi putative gene en... 101 7e-20
CP000931_3953(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 72 1e-19
CP000686_3978(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 78 1e-19
(Q6LYB5) RecName: Full=Bifunctional protein glmU; Includes: Re... 78 2e-19
CP001101_243(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 70 3e-19
CR931997_1645(CR931997|pid:none) Corynebacterium jeikeium K411 c... 78 4e-19
CT573213_1216(CT573213|pid:none) Frankia alni str. ACN14A chromo... 73 5e-19
EF089401_19(EF089401|pid:none) Uncultured marine bacterium HF10_... 66 7e-19
AM114193_1522(AM114193|pid:none) Uncultured methanogenic archaeo... 67 9e-19
BA000045_2200(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 62 9e-19
CP001337_905(CP001337|pid:none) Chloroflexus aggregans DSM 9485,... 64 2e-18
BA000045_471(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 61 3e-18
CP000300_1464(CP000300|pid:none) Methanococcoides burtonii DSM 6... 69 3e-18
AY596297_2848(AY596297|pid:none) Haloarcula marismortui ATCC 430... 62 4e-18
CP001110_2554(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 68 6e-18
AP009389_2514(AP009389|pid:none) Pelotomaculum thermopropionicum... 60 1e-17
CP000866_124(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 69 1e-17
CP000472_2070(CP000472|pid:none) Shewanella piezotolerans WP3, c... 67 2e-17
BA000022_2250(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 67 2e-17
CP000875_4800(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 64 2e-17
CP000575_1038(CP000575|pid:none) Staphylothermus marinus F1, com... 68 2e-17
BT087364_1(BT087364|pid:none) Zea mays full-length cDNA clone ZM... 93 3e-17
BX842650_199(BX842650|pid:none) Bdellovibrio bacteriovorus compl... 75 4e-17
CP001140_1134(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 64 4e-17
CP000239_638(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, comp... 56 6e-17
CP000099_1960(CP000099|pid:none) Methanosarcina barkeri str. Fus... 91 7e-17
BX569695_75(BX569695|pid:none) Synechococcus sp. WH8102 complete... 68 8e-17
CP000909_1758(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 63 8e-17
CP000240_2066(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 59 8e-17
CP000507_2328(CP000507|pid:none) Shewanella amazonensis SB2B, co... 69 1e-16
AP006841_1438(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 69 1e-16
CP001359_3796(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 61 1e-16
CP000930_2270(CP000930|pid:none) Heliobacterium modesticaldum Ic... 57 1e-16
BA000004_1416(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 67 2e-16
CP001131_3718(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 61 2e-16
CU466930_622(CU466930|pid:none) Candidatus Cloacamonas acidamino... 74 2e-16
AM114193_2373(AM114193|pid:none) Uncultured methanogenic archaeo... 63 2e-16
CP000660_1283(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 60 2e-16
FM992688_1206(FM992688|pid:none) Candida dubliniensis CD36 chrom... 89 3e-16
AJ578458_12(AJ578458|pid:none) Streptomyces griseus subsp. grise... 64 5e-16
AE010299_2944(AE010299|pid:none) Methanosarcina acetivorans str.... 88 6e-16
CP000728_2637(CP000728|pid:none) Clostridium botulinum F str. La... 65 6e-16
CP000612_1361(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 70 8e-16
CP000851_51(CP000851|pid:none) Shewanella pealeana ATCC 700345, ... 69 8e-16
FM178379_167(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 71 1e-15
CP001191_405(CP001191|pid:none) Rhizobium leguminosarum bv. trif... 72 1e-15
CP000155_4607(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 68 1e-15
CP001101_1570(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 55 1e-15
CP001074_818(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 71 1e-15
CP000269_645(CP000269|pid:none) Janthinobacterium sp. Marseille,... 65 2e-15
CU468230_64(CU468230|pid:none) Acinetobacter baumannii str. SDF,... 67 2e-15
BX569690_96(BX569690|pid:none) Synechococcus sp. WH8102 complete... 65 2e-15
AE010300_1610(AE010300|pid:none) Leptospira interrogans serovar ... 64 2e-15
CP000682_1811(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 78 2e-15
EU147298_49(EU147298|pid:none) Streptomyces rishiriensis strain ... 62 2e-15
CP000607_1630(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 55 3e-15
CP001097_2271(CP001097|pid:none) Chlorobium limicola DSM 245, co... 62 3e-15
AE009441_2082(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 61 3e-15
CP001185_1090(CP001185|pid:none) Thermosipho africanus TCF52B, c... 59 4e-15
CP000251_3680(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 58 4e-15
AF223364_4(AF223364|pid:none) Myxococcus xanthus tRNA/rRNA methy... 54 4e-15
CP000077_1174(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 64 4e-15
CP000939_2705(CP000939|pid:none) Clostridium botulinum B1 str. O... 69 5e-15
CP000020_142(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 69 5e-15
AF498403_10(AF498403|pid:none) Pseudomonas aeruginosa serotype 0... 67 5e-15
BA000023_1046(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 59 5e-15
CP000852_976(CP000852|pid:none) Caldivirga maquilingensis IC-167... 61 7e-15
CP000789_617(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 67 9e-15
CP000817_1129(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 65 9e-15
CP000686_3794(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 53 9e-15
CP000505_818(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 62 1e-14
CP000125_1953(CP000125|pid:none) Burkholderia pseudomallei 1710b... 60 1e-14
CP000153_596(CP000153|pid:none) Sulfurimonas denitrificans DSM 1... 67 1e-14
CP000085_1976(CP000085|pid:none) Burkholderia thailandensis E264... 60 2e-14
AE017180_1956(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 73 2e-14
CP000771_1420(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 57 3e-14
FJ483966_25(FJ483966|pid:none) Streptomyces diastatochromogenes ... 56 3e-14
CP000769_3777(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 53 3e-14
CP000481_411(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 55 3e-14
BA000037_314(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr... 66 3e-14
CP000025_1474(CP000025|pid:none) Campylobacter jejuni RM1221, co... 66 3e-14
EU448321_6(EU448321|pid:none) Campylobacter jejuni strain 129108... 66 3e-14
CP000916_1713(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 62 4e-14
CP001338_300(CP001338|pid:none) Candidatus Methanosphaerula palu... 65 6e-14
CP000716_728(CP000716|pid:none) Thermosipho melanesiensis BI429,... 57 6e-14
AB088224_52(AB088224|pid:none) Streptomyces rochei plasmid pSLA2... 58 6e-14
FJ670504_24(FJ670504|pid:none) Micromonospora sp. Tu 6368 hypoth... 55 6e-14
CP000252_398(CP000252|pid:none) Syntrophus aciditrophicus SB, co... 64 7e-14
CP001366_116(CP001366|pid:none) Halorubrum lacusprofundi ATCC 49... 64 2e-13
CP000089_1252(CP000089|pid:none) Dechloromonas aromatica RCB, co... 50 2e-13
CP001291_1455(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 62 2e-13
CP000471_556(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 69 2e-13
CP000159_592(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 70 2e-13
AL111168_1261(AL111168|pid:none) Campylobacter jejuni subsp. jej... 64 2e-13
CP000774_3334(CP000774|pid:none) Parvibaculum lavamentivorans DS... 54 2e-13
CP001099_1893(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 55 3e-13
CP001390_990(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 79 3e-13
FJ392634_1(FJ392634|pid:none) Danio rerio GDP-mannose pyrophosph... 79 3e-13
CP000909_1925(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 58 3e-13
CP000115_2380(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 64 3e-13
CP001108_225(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 58 3e-13
BA000012_5316(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 61 4e-13
CP000768_313(CP000768|pid:none) Campylobacter jejuni subsp. doyl... 63 4e-13
AM114193_2690(AM114193|pid:none) Uncultured methanogenic archaeo... 54 4e-13
CP000943_3806(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 57 5e-13
BA000030_1018(BA000030|pid:none) Streptomyces avermitilis MA-468... 59 5e-13
BA000001_1987(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 79 5e-13
CU207211_677(CU207211|pid:none) Herminiimonas arsenicoxydans chr... 57 6e-13
CP001337_2434(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 53 6e-13
AE000782_319(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,... 53 6e-13
AC2367(AC2367) glucose-1-phosphate thymidylyltransferase [import... 63 8e-13
AJ011500_10(AJ011500|pid:none) Streptomyces violaceoruber Tu22 g... 50 8e-13
L37334_3(L37334|pid:none) Streptomyces violaceoruber Tu22 dTDP-g... 50 8e-13
AM778933_45(AM778933|pid:none) Microcystis aeruginosa PCC 7806 g... 78 8e-13
(Q58501) RecName: Full=Bifunctional protein glmU; Includes: Re... 78 8e-13
CP000903_4013(CP000903|pid:none) Bacillus weihenstephanensis KBA... 77 1e-12
CP000698_4013(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 67 1e-12
AM238664_601(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 60 1e-12
CP000806_335(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 77 1e-12
CP000117_3337(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 62 2e-12
CP000576_172(CP000576|pid:none) Prochlorococcus marinus str. MIT... 77 2e-12
(A3DK82) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 77 2e-12
AE016795_763(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 64 2e-12
CP000932_1184(CP000932|pid:none) Campylobacter lari RM2100, comp... 58 2e-12
CP000554_116(CP000554|pid:none) Prochlorococcus marinus str. MIT... 60 2e-12
AE008384_302(AE008384|pid:none) Methanosarcina mazei strain Goe1... 76 2e-12
CP000576_1406(CP000576|pid:none) Prochlorococcus marinus str. MI... 65 3e-12
AE010300_1630(AE010300|pid:none) Leptospira interrogans serovar ... 50 3e-12
EU016627_83(EU016627|pid:none) Uncultured Group I marine crenarc... 63 3e-12
AE016877_4069(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 76 3e-12
CP000916_446(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 60 4e-12
CP000804_3225(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 50 4e-12
AE017194_4312(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 75 4e-12
CP001177_4205(CP001177|pid:none) Bacillus cereus AH187, complete... 75 4e-12
CP000951_1367(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 75 4e-12
FJ867070_1(FJ867070|pid:none) Brachypodium distachyon isolate AB... 75 4e-12
AM778925_53(AM778925|pid:none) Microcystis aeruginosa PCC 7806 g... 57 5e-12
CP000850_474(CP000850|pid:none) Salinispora arenicola CNS-205, c... 50 5e-12
CP000096_1957(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 57 6e-12
CP000026_728(CP000026|pid:none) Salmonella enterica subsp. enter... 49 6e-12
(P26396) RecName: Full=Glucose-1-phosphate cytidylyltransferase;... 49 6e-12
AE014613_737(AE014613|pid:none) Salmonella enterica subsp. enter... 49 6e-12
BX548174_159(BX548174|pid:none) Prochlorococcus marinus MED4 com... 75 7e-12
CP001283_4197(CP001283|pid:none) Bacillus cereus AH820, complete... 75 7e-12
CP000551_170(CP000551|pid:none) Prochlorococcus marinus str. AS9... 75 7e-12
CP001215_4365(CP001215|pid:none) Bacillus anthracis str. CDC 684... 75 7e-12
CP001287_895(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 75 7e-12
CP000825_170(CP000825|pid:none) Prochlorococcus marinus str. MIT... 75 7e-12
AB086653_2(AB086653|pid:none) Streptomyces halstedii vicenistati... 53 8e-12
BA000043_3121(BA000043|pid:none) Geobacillus kaustophilus HTA426... 57 8e-12
CP001360_18(CP001360|pid:none) Brachyspira hyodysenteriae WA1 pl... 54 8e-12
CP000878_1294(CP000878|pid:none) Prochlorococcus marinus str. MI... 49 8e-12
CP001124_3682(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 58 8e-12
AP006840_1371(AP006840|pid:none) Symbiobacterium thermophilum IA... 74 9e-12
CP001176_4217(CP001176|pid:none) Bacillus cereus B4264, complete... 74 1e-11
CP000097_287(CP000097|pid:none) Synechococcus sp. CC9902, comple... 74 1e-11
CU459003_3529(CU459003|pid:none) Magnetospirillum gryphiswaldens... 58 1e-11
AE017340_550(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 55 1e-11
CP000753_2940(CP000753|pid:none) Shewanella baltica OS185, compl... 60 1e-11
CP001400_868(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 74 2e-11
AE017180_3235(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 74 2e-11
CP001114_2121(CP001114|pid:none) Deinococcus deserti VCD115, com... 74 2e-11
CP000686_4029(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 54 2e-11
AJ605742_1(AJ605742|pid:none) Thermus caldophilus rmlA gene for ... 52 2e-11
AE008384_299(AE008384|pid:none) Methanosarcina mazei strain Goe1... 73 3e-11
(Q9WY82) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 60 3e-11
AP009389_1078(AP009389|pid:none) Pelotomaculum thermopropionicum... 55 3e-11
CP000554_138(CP000554|pid:none) Prochlorococcus marinus str. MIT... 52 3e-11
CU633750_2079(CU633750|pid:none) Cupriavidus taiwanensis str. LM... 50 3e-11
AM238664_908(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 57 3e-11
AY102621_9(AY102621|pid:none) Campylobacter coli Cj1314c-like pr... 61 3e-11
CP001401_920(CP001401|pid:none) Sulfolobus islandicus M.16.27, c... 72 4e-11
CP000969_699(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 60 4e-11
(P08075) RecName: Full=Glucose-1-phosphate thymidylyltransferase... 54 4e-11
A26984(A26984;A43701)strD protein - Streptomyces griseus 54 4e-11
CP000360_2833(CP000360|pid:none) Acidobacteria bacterium Ellin34... 50 4e-11
AF126354_3(AF126354|pid:none) Streptomyces bluensis BlmS (blmS),... 50 5e-11
CP000661_2921(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 47 5e-11
AM746676_4789(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 60 5e-11
BA000023_501(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 72 6e-11
AE017285_72(AE017285|pid:none) Desulfovibrio vulgaris subsp. vul... 46 7e-11
CP001029_752(CP001029|pid:none) Methylobacterium populi BJ001, c... 47 7e-11
CP000109_1689(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 47 7e-11
BA000030_359(BA000030|pid:none) Streptomyces avermitilis MA-4680... 54 7e-11
CP000435_2566(CP000435|pid:none) Synechococcus sp. CC9311, compl... 71 1e-10
CP001099_1417(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 47 1e-10
CP000267_1222(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 49 1e-10
CP000908_822(CP000908|pid:none) Methylobacterium extorquens PA1,... 49 1e-10
CP001298_754(CP001298|pid:none) Methylobacterium chloromethanicu... 49 1e-10
DQ381270_1(DQ381270|pid:none) Ictalurus punctatus clone SGC10RB ... 50 1e-10
CP000285_907(CP000285|pid:none) Chromohalobacter salexigens DSM ... 70 1e-10
CP001399_928(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 70 1e-10
(A2RMB7) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 70 1e-10
CP001404_2207(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 70 1e-10
CP000855_1849(CP000855|pid:none) Thermococcus onnurineus NA1, co... 70 2e-10
CP000148_3141(CP000148|pid:none) Geobacter metallireducens GS-15... 70 2e-10
AB088119_3(AB088119|pid:none) Streptomyces sp. TP-A0274 staurosp... 49 2e-10
CP001056_1480(CP001056|pid:none) Clostridium botulinum B str. Ek... 63 2e-10
AY596297_2079(AY596297|pid:none) Haloarcula marismortui ATCC 430... 61 2e-10
CP001291_1478(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 70 2e-10
BT070022_1(BT070022|pid:none) Zea mays full-length cDNA clone ZM... 69 3e-10
CP000382_1635(CP000382|pid:none) Clostridium novyi NT, complete ... 69 3e-10
BA000011_919(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 58 3e-10
AP006878_1189(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 69 4e-10
AE017126_175(AE017126|pid:none) Prochlorococcus marinus subsp. m... 69 4e-10
A99420(A99420) sugar phosphate nucleotydyl transferase [imported... 69 5e-10
CP000099_1963(CP000099|pid:none) Methanosarcina barkeri str. Fus... 69 5e-10
CP001337_2685(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 46 5e-10
CP000828_2444(CP000828|pid:none) Acaryochloris marina MBIC11017,... 68 7e-10
CP001581_2126(CP001581|pid:none) Clostridium botulinum A2 str. K... 68 7e-10
CP000828_3076(CP000828|pid:none) Acaryochloris marina MBIC11017,... 68 7e-10
CP000240_1510(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 68 7e-10
CP001344_3656(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 68 7e-10
AL591985_1255(AL591985|pid:none) Sinorhizobium meliloti 1021 pla... 49 7e-10
(A5IKI1) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 55 9e-10
CP000382_887(CP000382|pid:none) Clostridium novyi NT, complete g... 68 9e-10
AM181176_5455(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 68 9e-10
CP000866_537(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 68 9e-10
CP001275_336(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 47 9e-10
CP000962_2113(CP000962|pid:none) Clostridium botulinum A3 str. L... 68 9e-10
(Q9CHN1) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 68 9e-10
CP000878_169(CP000878|pid:none) Prochlorococcus marinus str. MIT... 68 9e-10
CP001344_1924(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 46 9e-10
CP000102_1458(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 48 1e-09
CP000110_2354(CP000110|pid:none) Synechococcus sp. CC9605, compl... 67 1e-09
AJ786382_14(AJ786382|pid:none) Streptomyces chartreusis HKI-249 ... 67 1e-09
CP000859_1953(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 45 1e-09
AE006641_898(AE006641|pid:none) Sulfolobus solfataricus P2, comp... 49 1e-09
CP000109_1455(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 47 1e-09
A99223(A99223) sugar phosphate nucleotydyl transferase [imported... 67 1e-09
CP001400_1096(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 44 2e-09
CP001399_1176(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 44 2e-09
BA000023_888(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 50 2e-09
CP000249_1544(CP000249|pid:none) Frankia sp. CcI3, complete geno... 45 2e-09
CP000866_839(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 67 2e-09
(Q8DT53) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 67 2e-09
AE014133_1395(AE014133|pid:none) Streptococcus mutans UA159, com... 67 2e-09
(Q97QS7) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 60 2e-09
(Q04KG7) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 59 2e-09
CP001033_1158(CP001033|pid:none) Streptococcus pneumoniae CGSP14... 59 2e-09
CP000249_702(CP000249|pid:none) Frankia sp. CcI3, complete genome. 45 2e-09
BA000045_3237(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 53 2e-09
CP001069_942(CP001069|pid:none) Ralstonia pickettii 12J chromoso... 45 3e-09
CP000239_1172(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 66 3e-09
CP001337_3680(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 66 3e-09
AP008231_2123(AP008231|pid:none) Synechococcus elongatus PCC 630... 66 3e-09
AF237894_4(AF237894|pid:none) Streptomyces antibioticus Tu99 ole... 49 3e-09
AP009153_2485(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 51 3e-09
CP000116_1881(CP000116|pid:none) Thiobacillus denitrificans ATCC... 45 3e-09
AM180088_2587(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 52 3e-09
CP001098_686(CP001098|pid:none) Halothermothrix orenii H 168, co... 66 3e-09
CP000554_2647(CP000554|pid:none) Prochlorococcus marinus str. MI... 66 3e-09
BX548175_2587(BX548175|pid:none) Prochlorococcus marinus MIT9313... 66 3e-09
(A8F3W8) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 50 4e-09
CP001230_1591(CP001230|pid:none) Persephonella marina EX-H1, com... 57 4e-09
CP000875_4145(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 50 4e-09
AE004437_815(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 50 4e-09
CP001403_1365(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 65 4e-09
AE017261_307(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 65 4e-09
AM180088_2055(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 65 4e-09
CP001404_1343(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 65 4e-09
CP001399_1346(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 65 4e-09
CP001400_1258(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 65 4e-09
(Q38V29) RecName: Full=Bifunctional protein glmU; Includes: Re... 50 5e-09
CP001015_1029(CP001015|pid:none) Streptococcus pneumoniae G54, c... 59 5e-09
CP000300_1485(CP000300|pid:none) Methanococcoides burtonii DSM 6... 47 5e-09
(A0Q3I7) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 65 6e-09
CP000820_5776(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 43 7e-09
CP001150_2932(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 43 7e-09
CP000927_2701(CP000927|pid:none) Caulobacter sp. K31, complete g... 48 9e-09
BX572606_37(BX572606|pid:none) Rhodopseudomonas palustris CGA009... 42 9e-09
CP000284_2143(CP000284|pid:none) Methylobacillus flagellatus KT,... 64 1e-08
(Q8RF63) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 64 1e-08
CP000561_1022(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 64 1e-08
CP001357_2188(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 43 1e-08
AE017340_2215(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 55 1e-08
CP000680_3980(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 64 1e-08
AI2230(AI2230) mannose-1-phosphate guanyltransferase [imported] ... 64 1e-08
CP000117_3403(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 64 1e-08
CP000527_2576(CP000527|pid:none) Desulfovibrio vulgaris subsp. v... 50 2e-08
CP000909_1718(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 43 2e-08
CP000447_3049(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 64 2e-08
AM398681_2383(AM398681|pid:none) Flavobacterium psychrophilum JI... 49 2e-08
CP001071_1885(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 50 2e-08
CP000686_2319(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 45 2e-08
CP000117_1104(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 43 2e-08
CP000477_939(CP000477|pid:none) Methanosaeta thermophila PT, com... 63 2e-08
BA000030_3971(BA000030|pid:none) Streptomyces avermitilis MA-468... 52 3e-08
CP001078_3068(CP001078|pid:none) Clostridium botulinum E3 str. A... 63 3e-08
BA000001_434(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, c... 63 3e-08
CP000254_2764(CP000254|pid:none) Methanospirillum hungatei JF-1,... 63 3e-08
CP000102_510(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 47 3e-08
CP001014_481(CP001014|pid:none) Thermoproteus neutrophilus V24St... 62 4e-08
BA000023_2125(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 62 4e-08
AE000513_1785(AE000513|pid:none) Deinococcus radiodurans R1 chro... 62 4e-08
DQ399653_6(DQ399653|pid:none) Nonomuraea longicatena K-252a bios... 52 4e-08
AY899214_16(AY899214|pid:none) Streptomyces aizunensis strain NR... 49 4e-08
CP000820_6428(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 41 4e-08
AP006840_777(AP006840|pid:none) Symbiobacterium thermophilum IAM... 62 5e-08
CP000463_4217(CP000463|pid:none) Rhodopseudomonas palustris BisA... 42 6e-08
AP008230_4439(AP008230|pid:none) Desulfitobacterium hafniense Y5... 62 6e-08
BX936398_999(BX936398|pid:none) Yersinia pseudotuberculosis IP32... 62 6e-08
CP001114_1924(CP001114|pid:none) Deinococcus deserti VCD115, com... 62 6e-08
(A8AYH2) RecName: Full=Glucose-1-phosphate adenylyltransferase; ... 56 7e-08
CU207211_1067(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 41 7e-08
L27130_1(L27130|pid:none) Yersinia pseudotuberculosis alpha-D-gl... 61 8e-08
>(Q68EY9) RecName: Full=Mannose-1-phosphate guanyltransferase beta-A;
EC=2.7.7.13; AltName:
Full=GTP-mannose-1-phosphate guanylyltransferase beta-A;
AltName: Full=GDP-mannose pyrophosphorylase B-A;
&BC080059_1(BC080059|pid:none)
Length = 360
Score = 277 bits (709), Expect(2) = e-114
Identities = 125/208 (60%), Positives = 168/208 (80%)
Frame = +2
Query: 650 KLKNLPKYGVVVYKEENGQILKFVEKPQVYVGNKINAGVYIFNPTILDRIQPKPTSIEKE 829
K++ KYGVVVY+ E+GQI +FVEKPQV+V NKIN+G+YIF+P +LDRIQ +PTSIEKE
Sbjct: 137 KVEEPSKYGVVVYETESGQIQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKE 196
Query: 830 IFPAMAADSQLYCMQLEGFWMDVGQPKDFLSGMGLYLNSLKSKQPELLATGNGIIGPVLI 1009
IFPAMA + QLY M+L+GFWMD+GQPKDFL+GM +YL S++ K PE L G G IG VL+
Sbjct: 197 IFPAMAQEGQLYAMELQGFWMDIGQPKDFLTGMCMYLQSVRQKHPEWLHAGPGFIGNVLV 256
Query: 1010 DPSSVIEPGCLIGPNVTIGPNCVIQEGTRLVNTTVLEGTTIGKNSWIKSTIIGWNSSIGK 1189
DP++ I C IGPNVTIGP +++G R+ TV++G+ + +SW++S+I+GW+SS+G+
Sbjct: 257 DPTAKIGQNCSIGPNVTIGPGVTVEDGVRIKRCTVMKGSRLHSHSWLESSIVGWSSSVGQ 316
Query: 1190 WVRMENTSVLGEDVHVSDELYINGGKIV 1273
WVRMEN +VLGEDV V+DELY+NG ++
Sbjct: 317 WVRMENVTVLGEDVIVNDELYLNGANVL 344
Score = 159 bits (402), Expect(2) = e-114
Identities = 76/120 (63%), Positives = 96/120 (80%), Gaps = 1/120 (0%)
Frame = +3
Query: 294 TLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLMSQYLEPYEKKLGIKISY 473
TLS PKP+V+F NK ++LHQ+EAL K GV V+LAV+Y ++ + ++ EK+LGI+IS
Sbjct: 18 TLSVPKPLVDFCNKPILLHQVEALVKAGVTHVILAVSYMSDMLEKEMKEQEKRLGIRISM 77
Query: 474 SHETVPLGTAGPLALARDLLND-GEPFFVLNSDIICDFPFADLLAFHKSHGGEGTIMVTK 650
SHE PLGTAGPLALAR+LL + EPFFVLNSD+ICDFPF D++ FHK HG EGTI+VTK
Sbjct: 78 SHEKEPLGTAGPLALARELLTENSEPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTK 137
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,902,402,807
Number of extensions: 39891782
Number of successful extensions: 127920
Number of sequences better than 10.0: 1725
Number of HSP's gapped: 125694
Number of HSP's successfully gapped: 2328
Length of query: 456
Length of database: 1,040,966,779
Length adjustment: 132
Effective length of query: 324
Effective length of database: 618,001,159
Effective search space: 200232375516
Effective search space used: 200232375516
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|