NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U08321-1
Contig ID Contig-U08321-1
Contig update 2002. 9.13
Contig sequence 
>Contig-U08321-1 (Contig-U08321-1Q) /CSM_Contig/Contig-U08321-1Q.Seq.d
ACCAATACTAGTTGGTGTAATGAGATTAATAGTTGAAGTATTTAGGAAAA
GTGATCCTGCTTTTGTTAAACTGAGTTCACTACTTGTATAAATACCAAAC
TCTTGGTGCTGCTGGAACACCTGAATTTGGAATTGCGAAAACTGATTGCC
CAAGAAGACTTGGATTTTTAGCCCATTGTAAAAGACCAAAGTAAAGTGGA
TTATTAGTACCTCGGCCGCGAC
Gap no gap
Contig length 222
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 5235388
End point 5235178
Strand (PLUS/MINUS) MINUS
Number of clones 30
Number of EST 18
Link to clone list U08321
List of clone(s) 

est1=FC-IC1653Z,1,209
est2=FC-IC0219E,2,209
est3=FC-IC0253E,2,209
est4=FC-IC0402E,2,223
est5=FC-IC0506Z,2,209
est6=FC-IC0508E,2,209
est7=FC-IC0534E,2,209
est8=FC-IC0896E,2,209
est9=FC-IC1027E,2,209
est10=FC-IC1334E,2,209
est11=FC-IC1368E,2,209
est12=FC-IC1505F,2,181
est13=FC-IC1505Z,2,209
est14=FC-IC1584E,2,210
est15=FC-IC1652F,2,209
est16=FC-IC1652Z,2,209
est17=FC-IC1653F,2,209
est18=FC-IC1717E,2,209
Translated Amino Acid sequence 
qy*lv**d**lkylgkvilllln*VHYLYKYQTLGAAGTPEFGIAKTDCPRRLGFLAHCK
RPK*sgllvprpr
Translated Amino Acid sequence (All Frames) 
Frame A:
tntswcneins*si*ek*scfc*tefttcintkllvllehlnlelrkliaqedldf*piv
kdqskvdy*ylgrd


Frame B:
pilvgvmrlivevfrksdpafvklssllv*ipnswccwnt*iwncen*lpkktwifspl*
ktkvkwiistsaa


Frame C:
qy*lv**d**lkylgkvilllln*VHYLYKYQTLGAAGTPEFGIAKTDCPRRLGFLAHCK
RPK*sgllvprpr
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U08321-1 (Contig-U08321-1Q)
/CSM_Contig/Contig-U08321-1Q.Seq.d
         (222 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U08321-1 (Contig-U08321-1Q) /CSM_Contig/Conti...   440  e-124
Contig-U08344-1 (Contig-U08344-1Q) /CSM_Contig/Conti...    38  0.004
Contig-U10067-1 (Contig-U10067-1Q) /CSM_Contig/Conti...    32  0.23
Contig-U14747-1 (Contig-U14747-1Q) /CSM_Contig/Conti...    30  0.92
Contig-U13845-1 (Contig-U13845-1Q) /CSM_Contig/Conti...    30  0.92
Contig-U13001-1 (Contig-U13001-1Q) /CSM_Contig/Conti...    30  0.92
Contig-U11539-1 (Contig-U11539-1Q) /CSM_Contig/Conti...    30  0.92
Contig-U11212-1 (Contig-U11212-1Q) /CSM_Contig/Conti...    30  0.92
Contig-U09073-1 (Contig-U09073-1Q) /CSM_Contig/Conti...    30  0.92
Contig-U05396-1 (Contig-U05396-1Q) /CSM_Contig/Conti...    30  0.92

>Contig-U08321-1 (Contig-U08321-1Q) /CSM_Contig/Contig-U08321-1Q.Seq.d
          Length = 222

 Score =  440 bits (222), Expect = e-124
 Identities = 222/222 (100%)
 Strand = Plus / Plus

                                                                       
Query: 1   accaatactagttggtgtaatgagattaatagttgaagtatttaggaaaagtgatcctgc 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   accaatactagttggtgtaatgagattaatagttgaagtatttaggaaaagtgatcctgc 60

                                                                       
Query: 61  ttttgttaaactgagttcactacttgtataaataccaaactcttggtgctgctggaacac 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  ttttgttaaactgagttcactacttgtataaataccaaactcttggtgctgctggaacac 120

                                                                       
Query: 121 ctgaatttggaattgcgaaaactgattgcccaagaagacttggatttttagcccattgta 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ctgaatttggaattgcgaaaactgattgcccaagaagacttggatttttagcccattgta 180

                                                     
Query: 181 aaagaccaaagtaaagtggattattagtacctcggccgcgac 222
           ||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aaagaccaaagtaaagtggattattagtacctcggccgcgac 222


>Contig-U08344-1 (Contig-U08344-1Q) /CSM_Contig/Contig-U08344-1Q.Seq.d
          Length = 558

 Score = 38.2 bits (19), Expect = 0.004
 Identities = 19/19 (100%)
 Strand = Plus / Plus

                              
Query: 204 ttagtacctcggccgcgac 222
           |||||||||||||||||||
Sbjct: 539 ttagtacctcggccgcgac 557


>Contig-U10067-1 (Contig-U10067-1Q) /CSM_Contig/Contig-U10067-1Q.Seq.d
          Length = 789

 Score = 32.2 bits (16), Expect = 0.23
 Identities = 16/16 (100%)
 Strand = Plus / Minus

                           
Query: 207 gtacctcggccgcgac 222
           ||||||||||||||||
Sbjct: 21  gtacctcggccgcgac 6


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 1369
Number of Sequences: 6905
Number of extensions: 1369
Number of successful extensions: 384
Number of sequences better than 10.0: 32
length of query: 222
length of database: 5,674,871
effective HSP length: 15
effective length of query: 207
effective length of database: 5,571,296
effective search space: 1153258272
effective search space used: 1153258272
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11.12
Homology vs DNA 
Query= Contig-U08321-1 (Contig-U08321-1Q) /CSM_Contig/Contig-U08321-1Q.Seq.d
         (222 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU271578) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   236   e-108  2
(AU275164) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   398   e-107  1
(AU271678) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   398   e-107  1
(AF238324) Dictyostelium discoideum lysosomal integral membr...   212   e-106  2
(AU271654) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   210   e-105  2
(AU275166) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU275213) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU275212) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU275165) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU275163) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU275017) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU272445) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU272067) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-105  2
(AU271944) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-105  2
(AU271943) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-105  2
(AU271679) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-105  2
(AU271655) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-105  2
(AU271652) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-105  2
(AU271449) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-105  2
(AU271422) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-105  2
(AU275103) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-103  2
(AU272418) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   204   e-103  2
(AU271577) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   e-101  2
(AU272068) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   208   e-101  2
(AU275102) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   373   2e-99  1
(AU272419) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   190   1e-95  2
(AU271423) Dictyostelium discoideum gamete cDNA clone:FC-IC0...   208   3e-93  2
(AU272446) Dictyostelium discoideum gamete cDNA clone:FC-IC1...   184   3e-87  2
(AU275016) Dictyostelium discoideum gamete cDNA clone:FC-IC1...    80   6e-23  3
(FF579477) Fernando_27_B09 Drosophila gastrula substracted c...    42   0.004  2
(CE268955) tigr-gss-dog-17000359928821 Dog Library Canis lup...    48   0.13   1
(FD778539) NADG-aaa03c04.g1 Rhodnius_prolixus_EST_NADG_Bacte...    34   0.31   3
(CQ507428) Sequence 39295 from Patent WO0160860.                   46   0.50   1
(CQ477249) Sequence 9116 from Patent WO0160860.                    46   0.50   1
(DT723877) SMMusaS4_h11 Banana fruit ripening subtractive li...    46   0.50   1
(AL725478) Danio rerio embryonic inner ear subtracted cDNA l...    46   0.50   1
(AL725286) Danio rerio embryonic inner ear subtracted cDNA l...    46   0.50   1
(CF063642) QCU24e11.yg QCU Zea mays cDNA clone QCU24e11, mRN...    46   0.50   1
(AI267423) aq64h04.x1 Stanley Frontal SN pool 2 Homo sapiens...    46   0.50   1
(CK739058) EA0494 Danio rerio four-day regenerating caudal f...    34   0.55   2
(CK829647) Fr_Fwd_06A05_T3 Forward subtracted cDNA library f...    40   1.1    2
(CK829522) Fr_Fwd_07F04_T3 Forward subtracted cDNA library f...    40   1.2    2
(CK829347) Fr_Fwd_10C12_T3 Forward subtracted cDNA library f...    40   1.2    2
(CK829959) Fr_Fwd_01G02_T3 Forward subtracted cDNA library f...    40   1.2    2
(CQ408737) Sequence 15808 from Patent WO0170979.                   44   2.0    1
(CQ408588) Sequence 15659 from Patent WO0170979.                   44   2.0    1
(AC209347) Gallus gallus chromosome UNKNOWN clone CH261-68A2...    44   2.0    1
(ES463131) piTB023xL02.b1.ab1 PiTB - Interaction library bet...    44   2.0    1
(ES456862) piTE013xM13.b2.ab1 PiTE - Interaction library bet...    44   2.0    1
(ES454806) piTE007xI05.b1.ab1 PiTE - Interaction library bet...    44   2.0    1
(EG562612) CRS1002G11 Catharanthus roseus Subtraction librar...    44   2.0    1
(DW392696) LRAGE038159 Liver regeneration after partial hepa...    44   2.0    1
(DW391440) LRAGE035626 Liver regeneration after partial hepa...    44   2.0    1
(DW376151) LRAGE020949 Liver regeneration after partial hepa...    44   2.0    1
(DT639368) 00195 leafy spurge subtractive cDNA libraries Eup...    44   2.0    1
(AM394369) Brassica oleracea var. italica EST, clone AAFC_WH...    44   2.0    1
(CF046595) QCK27g01.yg QCK Zea mays cDNA clone QCK27g01, mRN...    44   2.0    1
(CD026509) EST00447 Oryza minuta 101144 subtracted cDNA libr...    44   2.0    1
(CD026412) EST00349 Oryza minuta 101144 subtracted cDNA libr...    44   2.0    1
(CD026358) EST00295 Oryza minuta 101144 subtracted cDNA libr...    44   2.0    1
(CD026354) EST00291 Oryza minuta 101144 subtracted cDNA libr...    44   2.0    1
(CB884421) EST00254 Oryza minuta 101144 subtracted cDNA libr...    44   2.0    1
(BU572419) BpHi w119 Differentially expressed cDNA libraries...    44   2.0    1
(FE901164) JZ_429 Polygonum sibiricum stem Knorringia sibiri...    44   2.0    1
(FE896501) Y5-I12 Juvenile adult early flowering trifoliate ...    44   2.0    1
(FD778831) NADG-aaa03e08.b1 Rhodnius_prolixus_EST_NADG_Bacte...    44   2.0    1
(FD778592) NADG-aaa03e08.g1 Rhodnius_prolixus_EST_NADG_Bacte...    44   2.0    1
(EW975383) MC_L01191 MC_L (non-mycorrhizal (+Gln or NH4+) - ...    44   2.0    1
(EW975146) MC_L00233 MC_L (non-mycorrhizal (+Gln or NH4+) - ...    44   2.0    1
(CP000885) Clostridium phytofermentans ISDg, complete genome.      44   2.0    1
(CX124750) 1325046 NCCCWA 05RT Oncorhynchus mykiss cDNA clon...    32   2.5    2
(CF935288) TrEST-B22D04.g TrEST-B Hypocrea jecorina cDNA clo...    40   2.6    2
(AL714508) Danio rerio embryonic inner ear subtracted cDNA l...    34   2.6    2
(AG919636) Drosophila auraria DNA, clone: DAB1-029F24.R.fa, ...    36   3.3    2
(AL727942) Danio rerio embryonic inner ear subtracted cDNA l...    36   3.5    2
(AG909983) Drosophila auraria DNA, clone: DAB1-002N24.F.fa, ...    36   3.7    2
(AL729040) Danio rerio embryonic inner ear subtracted cDNA l...    36   4.4    2
(AL719732) Danio rerio embryonic inner ear subtracted cDNA l...    36   4.5    2
(DN479303) altr014xm10 A. brassicicola mycelial culture infe...    34   5.0    2
(EH098428) ia161e12.x1 mouse taste receptor cell, subtracted...    34   5.2    2
(EH094119) ia04a01.x1 mouse taste receptor cell, subtracted,...    34   5.2    2
(EH103875) ia242d03.x1 mouse taste receptor cell, subtracted...    34   5.2    2
(EH103992) ia244f04.x1 mouse taste receptor cell, subtracted...    34   5.3    2
(AL720917) Danio rerio embryonic inner ear subtracted cDNA l...    34   6.0    2
(AL720900) Danio rerio embryonic inner ear subtracted cDNA l...    34   6.0    2
(ES323059) mfcorjr1b4 SSH Library of cold-responsive cDNA Me...    32   6.4    2
(AL722643) Danio rerio embryonic inner ear subtracted cDNA l...    34   6.9    2
(CA739898) wpi2s.pk010.n24 wpi2s Triticum aestivum cDNA clon...    36   7.6    2
(CQ403947) Sequence 11018 from Patent WO0170979.                   36   7.6    2
(CQ397649) Sequence 4720 from Patent WO0170979.                    36   7.6    2
(CA736864) wpi1s.pk009.c24 wpi1s Triticum aestivum cDNA clon...    34   7.7    2
(CQ402295) Sequence 9366 from Patent WO0170979.                    34   7.7    2
(CQ395967) Sequence 3038 from Patent WO0170979.                    34   7.7    2
(CA735288) wpi1s.pk004.p11 wpi1s Triticum aestivum cDNA clon...    36   7.7    2
(CT028201) Poplar cDNA sequences.                                  42   7.7    1
(CQ648874) Sequence 5831 from Patent WO0234771.                    42   7.7    1
(CQ506189) Sequence 38056 from Patent WO0160860.                   42   7.7    1
(CQ476245) Sequence 8112 from Patent WO0160860.                    42   7.7    1
(ES789784) DEV-OYS-5S2_D11 Crassostrea gigas early developme...    42   7.7    1
(ES461930) piTB021xJ01.b1.ab1 PiTB - Interaction library bet...    42   7.7    1

>(AU271578) Dictyostelium discoideum gamete cDNA clone:FC-IC0402, 3'
           end single read.
          Length = 219

 Score =  236 bits (119), Expect(2) = e-108
 Identities = 119/119 (100%)
 Strand = Plus / Minus


Query: 104 tggtgctgctggaacacctgaatttggaattgcgaaaactgattgcccaagaagacttgg 163
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tggtgctgctggaacacctgaatttggaattgcgaaaactgattgcccaagaagacttgg 62


Query: 164 atttttagcccattgtaaaagaccaaagtaaagtggattattagtacctcggccgcgac 222
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  atttttagcccattgtaaaagaccaaagtaaagtggattattagtacctcggccgcgac 3

 Score =  188 bits (95), Expect(2) = e-108
 Identities = 98/99 (98%)
 Strand = Plus / Minus


Query: 5   atactagttggtgtaatgagattaatagttgaagtatttaggaaaagtgatcctgctttt 64
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 219 atactagttggtgtaatgagattaatagttgaagtatttaggaaaagtgatcctgctttt 160


Query: 65  gttaaactgagttcactacttgtataaataccaaactct 103
           ||||||||||||||| |||||||||||||||||||||||
Sbjct: 159 gttaaactgagttcattacttgtataaataccaaactct 121

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 228,939,958
Number of extensions: 12872301
Number of successful extensions: 3557520
Number of sequences better than 10.0: 207
Length of query: 222
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 199
Effective length of database: 93,106,754,628
Effective search space: 18528244170972
Effective search space used: 18528244170972
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 6.24
Homology vs Protein 
Query= Contig-U08321-1 (Contig-U08321-1Q) /CSM_Contig/Contig-U08321-1Q.Seq.d
         (222 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q9BKJ9) RecName: Full=Lysosome membrane protein 2-B; AltName: F...    77   3e-26

>(Q9BKJ9) RecName: Full=Lysosome membrane protein 2-B; AltName:
           Full=Lysosome membrane protein II-2; AltName: Full=LIMP
           II-2;  &AF238324_1(AF238324|pid:none)
          Length = 755

 Score = 76.6 bits (187), Expect(2) = 3e-26
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = -3

Query: 208 TNNPLYFGLLQWAKNPSLLGQSVFAIPNSGVPAAP 104
           TNNPLYFGLLQWAKNPSLLGQSVFAIPNSGVPAAP
Sbjct: 324 TNNPLYFGLLQWAKNPSLLGQSVFAIPNSGVPAAP 358

 Score = 63.9 bits (154), Expect(2) = 3e-26
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = -1

Query: 96  GIYTSSELSLTKAGSLFLNTSTINLITPTSIG 1
           GIYTSSELSLTKAGSLFLNTSTINLITPTSIG
Sbjct: 361 GIYTSSELSLTKAGSLFLNTSTINLITPTSIG 392

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 341,483,773
Number of extensions: 6345911
Number of successful extensions: 9598
Number of sequences better than 10.0: 1
Number of HSP's gapped: 9598
Number of HSP's successfully gapped: 2
Length of query: 74
Length of database: 1,040,966,779
Length adjustment: 45
Effective length of query: 29
Effective length of database: 896,773,954
Effective search space: 26006444666
Effective search space used: 26006444666
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 27 (15.0 bits)
PSORT 

 psg: 0.86  gvh: 0.38  alm: 0.57  top: 0.43  tms: 0.00  mit: 0.26  mip: 0.00
 nuc: 0.03  erl: 0.00  erm: 0.20  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 48.0 %: nuclear
	 24.0 %: cytoplasmic
	 20.0 %: cytoskeletal
	  4.0 %: mitochondrial
	  4.0 %: peroxisomal

>> prediction for Contig-U08321-1 is nuc
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 15
FC-IC (SUB) 15