Contig-U08276-1
Contig ID Contig-U08276-1
Contig update 2002. 9.13
Contig sequence
>Contig-U08276-1 (Contig-U08276-1Q) /CSM_Contig/Contig-U08276-1Q.Seq.d
ATATACATTTATATATTATTTTTCATAATGTCAAGAGTAAAAGTTTTAGT
TGATAATCAACTTGATTCAGAATTAGTTACAGCAGGTAAAAGATTAGTTG
TTGTAGATTTTACAGCAACATGGTGTGGACCATGTAAAATGATTAGTCCA
TATTTCGAACAATTATCATCAGAATATAAAGATGTTATTTTCTTAAAAGT
TGATGTTGATCAGTGTAAATCAACAACACAAAGTCAAGGTGTTAGAGCAA
TGCCAACATTTAAATTCTTTATTGAAAGAAAACAAGTTCATGAATTTAGT
GGTGCTGATAAAAATCAATTAAAAAGTTCAATTGAAAGATTACAACCACA
ACTTTCATTTGCATCACAAGGTAATGCATTGGGTGGTGGTGGGGGTTGGC
AGTGGAAATAGTCGTCAAGCTTATTTAGATAATTTAGAAAAAAACAACAA
GAACAACAAGCACAATATCATCATCATCATCAACAGCAACAAAGAGTAGA
CCACCAGCAAGAGCAACACAACCAGATCCAATTATGATGAAAGATTTAAT
AGATATGGGTTTTCCAGAGAATAGATGTAGAAAAGCATTGATTATGGTAA
ATAATTCAAGTTCTCAATCTGCAATGGATTGGATTTTTGAAAATATGGAT
TCTCCAACTATTGATGATCCATTAGAAGGTGATACTGGTGCTACTACCAC
TAAAAGTGAATCAACAACAACTACAACCCCATCTACTACAAATACTGATG
GTAGTACAACTACCACCACAACAACAACAACAACTACAAGTGAACAAAAA
GAATATCCAACAACTGTTCATAATGCATTATGTGATATGTGTCAAAATCA
AATCATAGGTTATAGATATAAATGTAAGGTTTGCCCAAATTATGATCTTT
GTCAAACTTGTAAAGATACAAATAAACATAATCCAGAACATGAATTTGTG
GCACATGAAAATGATATTGAAAACTATCAAATGACACCAGAGGAGAAAGC
AGAACAAAAGAAAAGATTAGAAGCAAGAATTCAAGAGATTAGAGTAAAGA
AAGCCGAAGAAGAGGCTAAAAAAGAGATTGAAAGAGAGATTAATCGTCGT
CAAGGTGGTAAATCAACTCAACAAGCTCTCACCAAAGGCAAGAG

Gap no gap
Contig length 1144
Chromosome number (1..6, M) 2
Chromosome length 8467578
Start point 6447809
End point 6446663
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 1
Link to clone list U08276
List of clone(s)

est1=CFJ314E,1,1145
Translated Amino Acid sequence
ihlyiifhnvksksfs**st*frisysr*kisccrfysnmvwtm*nd*sifrtiiiri*r
cyflks*c*sv*inntksrc*snani*ily*kktss*i*wc**ksikkfn*kittttfic
itr*cigwwwglaveivvkli*ii*KKTTRTTSTISSSSSTATKSRPPARATQPDPIMMK
DLIDMGFPENRCRKALIMVNNSSSQSAMDWIFENMDSPTIDDPLEGDTGATTTKSESTTT
TTPSTTNTDGSTTTTTTTTTTTSEQKEYPTTVHNALCDMCQNQIIGYRYKCKVCPNYDLC
QTCKDTNKHNPEHEFVAHENDIENYQMTPEEKAEQKKRLEARIQEIRVKKAEEEAKKEIE
REINRRQGGKSTQQALTKGK


Translated Amino Acid sequence (All Frames)
Frame A:
iyiyilffimsrvkvlvdnqldselvtagkrlvvvdftatwcgpckmispyfeqlsseyk
dviflkvdvdqcksttqsqgvramptfkffierkqvhefsgadknqlkssierlqpqlsf
asqgnalgggggwqwk*ssslfr*frkkqqeqqaqyhhhhqqqqrvdhqqeqhnqiql**
ki**iwvfqridvekh*lw*iiqvlnlqwigflkiwilqllmih*kvilvllplkvnqqq
lqphllqilmvvqlppqqqqqlqvnkkniqqlfimhyvicvkiks*vidinvrfaqimif
vklvkiqiniiqnmnlwhmkmilktik*hqrrkqnkrkd*kqefkrle*rkpkkrlkkrl
kerlivvkvvnqlnklspkar


Frame B:
ytfiyyfs*cqe*kf*liinliqn*lqqvkd*ll*ilqqhgvdhvk*lvhisnnyhqnik
mlfs*klmlisvnqqhkvkvleqcqhlnsllkenkfmnlvvlikin*kvqlkdynhnfhl
hhkvmhwvvvgvgsgnsrqayldnleknnknnkhniiiiinsnke*ttsksnttrsnyde
rfnrygfsre*m*ksidygk*fkfsicngldf*kygfsny**sirr*ywcyyh*k*innn
ynpiyyky*w*ynyhhnnnnnyk*tkrisnncs*cim*yvsksnhrl*i*m*glpkl*sl
snl*ryk*t*srt*icgt*k*y*klsndtrgesrtkekirsknsrd*skesrrrg*krd*
krd*sssrw*instsshqrqe


Frame C:
ihlyiifhnvksksfs**st*frisysr*kisccrfysnmvwtm*nd*sifrtiiiri*r
cyflks*c*sv*inntksrc*snani*ily*kktss*i*wc**ksikkfn*kittttfic
itr*cigwwwglaveivvkli*ii*KKTTRTTSTISSSSSTATKSRPPARATQPDPIMMK
DLIDMGFPENRCRKALIMVNNSSSQSAMDWIFENMDSPTIDDPLEGDTGATTTKSESTTT
TTPSTTNTDGSTTTTTTTTTTTSEQKEYPTTVHNALCDMCQNQIIGYRYKCKVCPNYDLC
QTCKDTNKHNPEHEFVAHENDIENYQMTPEEKAEQKKRLEARIQEIRVKKAEEEAKKEIE
REINRRQGGKSTQQALTKGK


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U08276-1 (Contig-U08276-1Q)
/CSM_Contig/Contig-U08276-1Q.Seq.d
(1144 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U08276-1 (Contig-U08276-1Q) /CSM_Contig/Conti... 1479 0.0
Contig-U01481-1 (Contig-U01481-1Q) /CSM_Contig/Conti... 48 2e-05
Contig-U14875-1 (Contig-U14875-1Q) /CSM_Contig/Conti... 46 8e-05
Contig-U11105-1 (Contig-U11105-1Q) /CSM_Contig/Conti... 46 8e-05
Contig-U11450-1 (Contig-U11450-1Q) /CSM_Contig/Conti... 44 3e-04
Contig-U09001-1 (Contig-U09001-1Q) /CSM_Contig/Conti... 44 3e-04
Contig-U12283-1 (Contig-U12283-1Q) /CSM_Contig/Conti... 42 0.001
Contig-U11857-1 (Contig-U11857-1Q) /CSM_Contig/Conti... 42 0.001
Contig-U11010-1 (Contig-U11010-1Q) /CSM_Contig/Conti... 42 0.001
Contig-U11728-1 (Contig-U11728-1Q) /CSM_Contig/Conti... 38 0.020

>Contig-U08276-1 (Contig-U08276-1Q) /CSM_Contig/Contig-U08276-1Q.Seq.d
Length = 1144

Score = 1479 bits (746), Expect = 0.0
Identities = 760/767 (99%)
Strand = Plus / Plus


Query: 1 atatacatttatatattatttttcataatgtcaagagtaaaagttttagttgataatcaa 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 atatacatttatatattatttttcataatgtcaagagtaaaagttttagttgataatcaa 60


Query: 61 cttgattcagaattagttacagcaggtaaaagattagttgttgtagattttacagcaaca 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 cttgattcagaattagttacagcaggtaaaagattagttgttgtagattttacagcaaca 120


Query: 121 tggtgtggaccatgtaaaatgattagtccatatttcgaacaattatcatcagaatataaa 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tggtgtggaccatgtaaaatgattagtccatatttcgaacaattatcatcagaatataaa 180


Query: 181 gatgttattttcttaaaagttgatgttgatcagtgtaaatcaacaacacaaagtcaaggt 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 gatgttattttcttaaaagttgatgttgatcagtgtaaatcaacaacacaaagtcaaggt 240


Query: 241 gttagagcaatgccaacatttaaattctttattgaaagaaaacaagttcatgaatttagt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gttagagcaatgccaacatttaaattctttattgaaagaaaacaagttcatgaatttagt 300


Query: 301 ggtgctgataaaaatcaattaaaaagttcaattgaaagattacaaccacaactttcattt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ggtgctgataaaaatcaattaaaaagttcaattgaaagattacaaccacaactttcattt 360


Query: 361 gcatcacaaggtaatgcattgggtggtggtgggggttggcagtggaaatagtcgtcaagc 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 gcatcacaaggtaatgcattgggtggtggtgggggttggcagtggaaatagtcgtcaagc 420


Query: 421 ttatttagataatttagnnnnnnncaacaagaacaacaagcacaatatcatcatcatcat 480
||||||||||||||||| ||||||||||||||||||||||||||||||||||||
Sbjct: 421 ttatttagataatttagaaaaaaacaacaagaacaacaagcacaatatcatcatcatcat 480


Query: 481 caacagcaacaaagagtagaccaccagcaagagcaacacaaccagatccaattatgatga 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 caacagcaacaaagagtagaccaccagcaagagcaacacaaccagatccaattatgatga 540


Query: 541 aagatttaatagatatgggttttccagagaatagatgtagaaaagcattgattatggtaa 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 aagatttaatagatatgggttttccagagaatagatgtagaaaagcattgattatggtaa 600


Query: 601 ataattcaagttctcaatctgcaatggattggatttttgaaaatatggattctccaacta 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 ataattcaagttctcaatctgcaatggattggatttttgaaaatatggattctccaacta 660


Query: 661 ttgatgatccattagaaggtgatactggtgctactaccactaaaagtgaatcaacaacaa 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 ttgatgatccattagaaggtgatactggtgctactaccactaaaagtgaatcaacaacaa 720


Query: 721 ctacaaccccatctactacaaatactgatggtagtacaactaccacc 767
|||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 721 ctacaaccccatctactacaaatactgatggtagtacaactaccacc 767


Score = 654 bits (330), Expect = 0.0
Identities = 330/330 (100%)
Strand = Plus / Plus


Query: 815 tgttcataatgcattatgtgatatgtgtcaaaatcaaatcataggttatagatataaatg 874
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 815 tgttcataatgcattatgtgatatgtgtcaaaatcaaatcataggttatagatataaatg 874


Query: 875 taaggtttgcccaaattatgatctttgtcaaacttgtaaagatacaaataaacataatcc 934
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 875 taaggtttgcccaaattatgatctttgtcaaacttgtaaagatacaaataaacataatcc 934


Query: 935 agaacatgaatttgtggcacatgaaaatgatattgaaaactatcaaatgacaccagagga 994
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 935 agaacatgaatttgtggcacatgaaaatgatattgaaaactatcaaatgacaccagagga 994


Query: 995 gaaagcagaacaaaagaaaagattagaagcaagaattcaagagattagagtaaagaaagc 1054
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 995 gaaagcagaacaaaagaaaagattagaagcaagaattcaagagattagagtaaagaaagc 1054


Query: 1055 cgaagaagaggctaaaaaagagattgaaagagagattaatcgtcgtcaaggtggtaaatc 1114
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1055 cgaagaagaggctaaaaaagagattgaaagagagattaatcgtcgtcaaggtggtaaatc 1114


Query: 1115 aactcaacaagctctcaccaaaggcaagag 1144
||||||||||||||||||||||||||||||
Sbjct: 1115 aactcaacaagctctcaccaaaggcaagag 1144


Score = 30.2 bits (15), Expect = 5.0
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 712 caacaacaactacaa 726
|||||||||||||||
Sbjct: 775 caacaacaactacaa 789


>Contig-U01481-1 (Contig-U01481-1Q) /CSM_Contig/Contig-U01481-1Q.Seq.d
Length = 1101

Score = 48.1 bits (24), Expect = 2e-05
Identities = 42/48 (87%)
Strand = Plus / Plus


Query: 445 caacaagaacaacaagcacaatatcatcatcatcatcaacagcaacaa 492
|||||| |||||||| |||| |||||||||||||||| || ||||||
Sbjct: 56 caacaacaacaacaacaacaacatcatcatcatcatcatcaccaacaa 103


Score = 30.2 bits (15), Expect = 5.0
Identities = 18/19 (94%)
Strand = Plus / Plus


Query: 709 aatcaacaacaactacaac 727
||||||||||||| |||||
Sbjct: 53 aatcaacaacaacaacaac 71


>Contig-U14875-1 (Contig-U14875-1Q) /CSM_Contig/Contig-U14875-1Q.Seq.d
Length = 772

Score = 46.1 bits (23), Expect = 8e-05
Identities = 23/23 (100%)
Strand = Plus / Plus


Query: 467 atcatcatcatcatcaacagcaa 489
|||||||||||||||||||||||
Sbjct: 242 atcatcatcatcatcaacagcaa 264


Score = 36.2 bits (18), Expect = 0.081
Identities = 27/30 (90%)
Strand = Plus / Plus


Query: 462 acaatatcatcatcatcatcaacagcaaca 491
|||| |||||||||||||||| || |||||
Sbjct: 231 acaacatcatcatcatcatcatcatcaaca 260


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 21,811
Number of Sequences: 6905
Number of extensions: 21811
Number of successful extensions: 4421
Number of sequences better than 10.0: 694
length of query: 1144
length of database: 5,674,871
effective HSP length: 16
effective length of query: 1128
effective length of database: 5,564,391
effective search space: 6276633048
effective search space used: 6276633048
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.11.12
Homology vs DNA
Query= Contig-U08276-1 (Contig-U08276-1Q) /CSM_Contig/Contig-U08276-1Q.Seq.d
(1144 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ361872) Dictyostelium discoideum cDNA clone:ddc19l03, 5' ... 866 0.0 2
(BJ329280) Dictyostelium discoideum cDNA clone:dda24m10, 5' ... 866 0.0 3
(BJ412217) Dictyostelium discoideum cDNA clone:ddv7l12, 5' e... 785 0.0 4
(BJ327502) Dictyostelium discoideum cDNA clone:dda20n14, 5' ... 785 0.0 4
(BJ361349) Dictyostelium discoideum cDNA clone:ddc16g23, 5' ... 779 0.0 4
(BJ361272) Dictyostelium discoideum cDNA clone:ddc16b18, 5' ... 739 0.0 5
(BJ359550) Dictyostelium discoideum cDNA clone:ddc15g10, 5' ... 733 0.0 5
(AC116979) Dictyostelium discoideum chromosome 2 map 6445720... 573 0.0 8
(BJ358727) Dictyostelium discoideum cDNA clone:ddc11i02, 5' ... 785 0.0 4
(BJ323643) Dictyostelium discoideum cDNA clone:dda11e16, 5' ... 785 0.0 4
(BJ323364) Dictyostelium discoideum cDNA clone:dda10b08, 5' ... 785 0.0 4
(BJ363936) Dictyostelium discoideum cDNA clone:ddc29n04, 5' ... 785 0.0 4
(BJ330170) Dictyostelium discoideum cDNA clone:dda27i17, 5' ... 785 0.0 4
(BJ361718) Dictyostelium discoideum cDNA clone:ddc18o11, 5' ... 837 0.0 3
(BJ375559) Dictyostelium discoideum cDNA clone:ddc19l03, 3' ... 579 0.0 3
(BJ376596) Dictyostelium discoideum cDNA clone:ddc29n04, 3' ... 573 0.0 3
(BJ400390) Dictyostelium discoideum cDNA clone:dds13d05, 3' ... 573 0.0 3
(BJ373836) Dictyostelium discoideum cDNA clone:ddc5a06, 3' e... 573 0.0 3
(BJ358390) Dictyostelium discoideum cDNA clone:ddc1h08, 5' e... 763 0.0 4
(BJ399407) Dictyostelium discoideum cDNA clone:dds5h22, 3' e... 573 0.0 3
(BJ347610) Dictyostelium discoideum cDNA clone:dda27i17, 3' ... 573 0.0 3
(BJ434721) Dictyostelium discoideum cDNA clone:ddv24c22, 3' ... 567 0.0 3
(BJ372059) Dictyostelium discoideum cDNA clone:ddc11i02, 3' ... 573 0.0 3
(BJ398442) Dictyostelium discoideum cDNA clone:dds12p08, 3' ... 573 0.0 3
(BJ387916) Dictyostelium discoideum cDNA clone:dds5h22, 5' e... 785 0.0 4
(BJ377737) Dictyostelium discoideum cDNA clone:ddc25m16, 3' ... 573 0.0 3
(BJ360214) Dictyostelium discoideum cDNA clone:ddc5a06, 5' e... 785 0.0 4
(BJ363232) Dictyostelium discoideum cDNA clone:ddc25m16, 5' ... 785 0.0 4
(BJ417504) Dictyostelium discoideum cDNA clone:ddv30g23, 5' ... 785 0.0 4
(BJ430780) Dictyostelium discoideum cDNA clone:ddv8p18, 3' e... 573 0.0 4
(BJ360956) Dictyostelium discoideum cDNA clone:ddc8b21, 5' e... 777 0.0 4
(BJ340079) Dictyostelium discoideum cDNA clone:dda11e16, 3' ... 573 0.0 4
(BJ371752) Dictyostelium discoideum cDNA clone:ddc1h08, 3' e... 573 0.0 4
(BJ436333) Dictyostelium discoideum cDNA clone:ddv30g23, 3' ... 573 0.0 3
(BJ416060) Dictyostelium discoideum cDNA clone:ddv24c22, 5' ... 785 0.0 4
(BJ391295) Dictyostelium discoideum cDNA clone:dds13d05, 5' ... 785 0.0 4
(BJ409889) Dictyostelium discoideum cDNA clone:ddv10m10, 5' ... 866 0.0 2
(BJ387325) Dictyostelium discoideum cDNA clone:dds1m17, 5' e... 718 0.0 5
(BJ360861) Dictyostelium discoideum cDNA clone:ddc8f07, 5' e... 785 0.0 3
(BJ416987) Dictyostelium discoideum cDNA clone:ddv29c05, 5' ... 785 0.0 3
(BJ325291) Dictyostelium discoideum cDNA clone:dda13m18, 5' ... 785 0.0 3
(BJ371944) Dictyostelium discoideum cDNA clone:ddc10p08, 3' ... 462 0.0 3
(BJ374843) Dictyostelium discoideum cDNA clone:ddc16b18, 3' ... 547 0.0 2
(BJ325600) Dictyostelium discoideum cDNA clone:dda1f18, 5' e... 785 0.0 2
(BJ386827) Dictyostelium discoideum cDNA clone:dds10j21, 5' ... 773 0.0 2
(BJ325715) Dictyostelium discoideum cDNA clone:dda1k02, 5' e... 716 0.0 3
(BJ398699) Dictyostelium discoideum cDNA clone:dds1m17, 3' e... 494 0.0 3
(BJ328106) Dictyostelium discoideum cDNA clone:dda23a01, 5' ... 371 0.0 6
(BJ344841) Dictyostelium discoideum cDNA clone:dda20n14, 3' ... 381 0.0 6
(BJ415601) Dictyostelium discoideum cDNA clone:ddv23h01, 5' ... 779 0.0 2
(BJ335777) Dictyostelium discoideum cDNA clone:dda51c17, 5' ... 769 0.0 1
(BJ358611) Dictyostelium discoideum cDNA clone:ddc10p08, 5' ... 416 0.0 2
(BJ324953) Dictyostelium discoideum cDNA clone:dda8i21, 5' e... 492 0.0 3
(BJ359422) Dictyostelium discoideum cDNA clone:ddc14a15, 5' ... 755 0.0 1
(BJ368430) Dictyostelium discoideum cDNA clone:ddc46n16, 5' ... 684 0.0 2
(BJ374558) Dictyostelium discoideum cDNA clone:ddc8b21, 3' e... 345 e-177 4
(BJ326217) Dictyostelium discoideum cDNA clone:dda15d23, 5' ... 609 e-169 1
(BJ342706) Dictyostelium discoideum cDNA clone:dda1b11, 3' e... 345 e-168 3
(BJ325608) Dictyostelium discoideum cDNA clone:dda1j15, 5' e... 355 e-154 2
(AU034154) Dictyostelium discoideum slug cDNA, clone SLC109. 289 6e-94 2
(BJ435935) Dictyostelium discoideum cDNA clone:ddv29c05, 3' ... 141 5e-59 3
(BJ372851) Dictyostelium discoideum cDNA clone:ddc14a15, 3' ... 125 2e-44 2
(BJ428004) Dictyostelium discoideum cDNA clone:ddv10m10, 3' ... 163 4e-43 2
(EC826133) SME00002210 esmbsro2 Sawyeria marylandensis cDNA,... 50 2e-13 3
(EC820263) SME00009343 esmbsro2 Sawyeria marylandensis cDNA,... 50 1e-10 3
(AM851306) Venerupis (Ruditapes) decussatus EST, 5' end sequ... 64 2e-08 2
(FE263946) CAZO3565.fwd CAZO Naegleria gruberi Flagellate St... 44 1e-07 3
(EA209007) Sequence 73322 from patent US 7214786. 46 2e-07 4
(FE242687) CAPG7287.fwd CAPG Naegleria gruberi amoeba stage ... 44 2e-07 3
(FE230917) CAPG10059.fwd CAPG Naegleria gruberi amoeba stage... 44 2e-07 3
(FE243734) CAPG7806.fwd CAPG Naegleria gruberi amoeba stage ... 44 3e-07 3
(FE241555) CAPG6742.fwd CAPG Naegleria gruberi amoeba stage ... 44 3e-07 3
(FE242133) CAPG7020.fwd CAPG Naegleria gruberi amoeba stage ... 44 3e-07 3
(CO334695) EK315124.5prime Exelixis FlyTag CK01 pCDNA-SK+ Dr... 46 2e-06 3
(EC216864) 722252 CK01 Drosophila melanogaster cDNA clone 33... 46 2e-06 3
(EH014083) USDA-FP_186818 Lysiphlebus testaceipes adult whol... 60 3e-06 2
(AW635271) bl31e11.w2 Blackshear/Soares normalized Xenopus e... 46 3e-06 2
(DC005168) Xenopus laevis NBRP cDNA clone:rxlk107l03ex, 3' end. 60 2e-04 1
(EB609079) AGENCOURT_54974239 D. mojavensis EST Drosophila m... 54 3e-04 2
(EB597475) AGENCOURT_55024908 D. mojavensis EST Drosophila m... 54 3e-04 2
(CV565857) taj78f06.x1 Hydra EST UCI 6 Hydra magnipapillata ... 42 5e-04 2
(CV563798) taj78f06.y1 Hydra EST UCI 6 Hydra magnipapillata ... 42 6e-04 2
(CF658691) tac56h07.y1 Hydra EST -IV Hydra magnipapillata cD... 42 6e-04 2
(DH471825) Monosiga ovata DNA, fosmid clone: MOF-018C20, gen... 54 7e-04 2
(DQ096978) Xenopus laevis comp85 mRNA, complete sequence. 58 8e-04 1
(BC072884) Xenopus laevis MGC80314 protein, mRNA (cDNA clone... 58 8e-04 1
(AK249225) Hordeum vulgare subsp. vulgare cDNA clone: FLbaf2... 58 8e-04 1
(EB733947) AGENCOURT_77746305 NICHD_XGC_skin_m Xenopus laevi... 58 8e-04 1
(EB727969) AGENCOURT_78608177 NICHD_XGC_skin_m Xenopus laevi... 58 8e-04 1
(DC127222) Xenopus laevis NBRP cDNA clone:xl313p10, 5' end. 58 8e-04 1
(DC113945) Xenopus laevis NBRP cDNA clone:xl267e23, 5' end. 58 8e-04 1
(DC111888) Xenopus laevis NBRP cDNA clone:xl260h09, 5' end. 58 8e-04 1
(DC110893) Xenopus laevis NBRP cDNA clone:xl257b08, 5' end. 58 8e-04 1
(DC102765) Xenopus laevis NBRP cDNA clone:xl230f04, 5' end. 58 8e-04 1
(DC064825) Xenopus laevis NBRP cDNA clone:xlk162e19ex, 5' end. 58 8e-04 1
(DC048512) Xenopus laevis NBRP cDNA clone:xlk140a21ex, 5' end. 58 8e-04 1
(DC038095) Xenopus laevis NBRP cDNA clone:xlk107l03ex, 5' end. 58 8e-04 1
(DC036435) Xenopus laevis NBRP cDNA clone:xlk102i14ex, 5' end. 58 8e-04 1
(DC031290) Xenopus laevis NBRP cDNA clone:rxlk162e19ex, 3' end. 58 8e-04 1
(DC003569) Xenopus laevis NBRP cDNA clone:rxlk102i14ex, 3' end. 58 8e-04 1

>(BJ361872) Dictyostelium discoideum cDNA clone:ddc19l03, 5' end,
single read.
Length = 651

Score = 866 bits (437), Expect(2) = 0.0
Identities = 437/437 (100%)
Strand = Plus / Plus


Query: 1 atatacatttatatattatttttcataatgtcaagagtaaaagttttagttgataatcaa 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 atatacatttatatattatttttcataatgtcaagagtaaaagttttagttgataatcaa 60


Query: 61 cttgattcagaattagttacagcaggtaaaagattagttgttgtagattttacagcaaca 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 cttgattcagaattagttacagcaggtaaaagattagttgttgtagattttacagcaaca 120


Query: 121 tggtgtggaccatgtaaaatgattagtccatatttcgaacaattatcatcagaatataaa 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tggtgtggaccatgtaaaatgattagtccatatttcgaacaattatcatcagaatataaa 180


Query: 181 gatgttattttcttaaaagttgatgttgatcagtgtaaatcaacaacacaaagtcaaggt 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 gatgttattttcttaaaagttgatgttgatcagtgtaaatcaacaacacaaagtcaaggt 240


Query: 241 gttagagcaatgccaacatttaaattctttattgaaagaaaacaagttcatgaatttagt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gttagagcaatgccaacatttaaattctttattgaaagaaaacaagttcatgaatttagt 300


Query: 301 ggtgctgataaaaatcaattaaaaagttcaattgaaagattacaaccacaactttcattt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ggtgctgataaaaatcaattaaaaagttcaattgaaagattacaaccacaactttcattt 360


Query: 361 gcatcacaaggtaatgcattgggtggtggtgggggttggcagtggaaatagtcgtcaagc 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 gcatcacaaggtaatgcattgggtggtggtgggggttggcagtggaaatagtcgtcaagc 420


Query: 421 ttatttagataatttag 437
|||||||||||||||||
Sbjct: 421 ttatttagataatttag 437

Score = 410 bits (207), Expect(2) = 0.0
Identities = 207/207 (100%)
Strand = Plus / Plus


Query: 445 caacaagaacaacaagcacaatatcatcatcatcatcaacagcaacaaagagtagaccac 504
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 445 caacaagaacaacaagcacaatatcatcatcatcatcaacagcaacaaagagtagaccac 504


Query: 505 cagcaagagcaacacaaccagatccaattatgatgaaagatttaatagatatgggttttc 564
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 505 cagcaagagcaacacaaccagatccaattatgatgaaagatttaatagatatgggttttc 564


Query: 565 cagagaatagatgtagaaaagcattgattatggtaaataattcaagttctcaatctgcaa 624
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 565 cagagaatagatgtagaaaagcattgattatggtaaataattcaagttctcaatctgcaa 624


Query: 625 tggattggatttttgaaaatatggatt 651
|||||||||||||||||||||||||||
Sbjct: 625 tggattggatttttgaaaatatggatt 651

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,227,720,974
Number of extensions: 80120260
Number of successful extensions: 8055461
Number of sequences better than 10.0: 1757
Length of query: 1144
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1120
Effective length of database: 97,308,875,965
Effective search space: 108985941080800
Effective search space used: 108985941080800
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 6.24
Homology vs Protein
Query= Contig-U08276-1 (Contig-U08276-1Q) /CSM_Contig/Contig-U08276-1Q.Seq.d
(1144 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

FJ384985_1(FJ384985|pid:none) Bombina orientalis thioredoxin mRN... 113 1e-23
(P82460) RecName: Full=Thioredoxin; Short=Trx; &AF3828... 110 1e-22
(P50413) RecName: Full=Thioredoxin; Short=Trx; &Z25864... 110 1e-22
(O97508) RecName: Full=Thioredoxin; Short=Trx; &AB0224... 109 2e-22
AY891764_1(AY891764|pid:none) Synthetic construct Homo sapiens c... 109 2e-22
(Q98TX1) RecName: Full=Thioredoxin; Short=Trx; &AF3217... 109 2e-22
DQ215312_1(DQ215312|pid:none) Taeniopygia guttata clone 0058P004... 108 4e-22
BT081170_1(BT081170|pid:none) Caligus clemensi clone ccle-evs-51... 108 5e-22
(Q5R9M3) RecName: Full=Thioredoxin; Short=Trx; &CR8593... 107 6e-22
AY242060_1(AY242060|pid:none) Melopsittacus undulatus thioredoxi... 107 8e-22
(P08628) RecName: Full=Thioredoxin; Short=Trx; 107 8e-22
NRL(3TRX) thioredoxin (reduced) - human &NRL(4TRX) 107 1e-21
AE014296_1058(AE014296|pid:none) Drosophila melanogaster chromos... 107 1e-21
AF143404_1(AF143404|pid:none) Drosophila melanogaster thioredoxi... 107 1e-21
BC084818_1(BC084818|pid:none) Xenopus laevis hypothetical LOC495... 106 1e-21
(P08629) RecName: Full=Thioredoxin; Short=Trx; &A30006... 106 2e-21
BC084527_1(BC084527|pid:none) Xenopus tropicalis hypothetical LO... 105 3e-21
BC166957_1(BC166957|pid:none) Xenopus tropicalis hypothetical pr... 105 3e-21
(P11232) RecName: Full=Thioredoxin; Short=Trx; &AF3110... 105 3e-21
AK007790_1(AK007790|pid:none) Mus musculus 10 day old male pancr... 104 5e-21
BT077794_1(BT077794|pid:none) Lepeophtheirus salmonis clone lsal... 104 5e-21
EF070462_1(EF070462|pid:none) Maconellicoccus hirsutus clone WHM... 103 9e-21
BT079175_1(BT079175|pid:none) Esox lucius clone eluc-evq-530-028... 102 3e-20
DQ443142_1(DQ443142|pid:none) Bombyx mori thioredoxin mRNA, comp... 102 3e-20
AB169251_1(AB169251|pid:none) Macaca fascicularis testis cDNA, c... 101 6e-20
AJ605810_1(AJ605810|pid:none) Mesobuthus cyprius partial trxt ge... 100 1e-19
BC072884_1(BC072884|pid:none) Xenopus laevis MGC80314 protein, m... 100 1e-19
AC024810_17(AC024810|pid:none) Caenorhabditis elegans cosmid Y54... 100 1e-19
AJ605859_1(AJ605859|pid:none) Mesobuthus gibbosus partial trxt g... 99 2e-19
AJ605817_1(AJ605817|pid:none) Mesobuthus gibbosus partial trxt g... 99 2e-19
AJ605847_1(AJ605847|pid:none) Mesobuthus gibbosus partial trxt g... 99 2e-19
AJ605827_1(AJ605827|pid:none) Mesobuthus gibbosus partial trxt g... 99 2e-19
BC129794_1(BC129794|pid:none) Xenopus laevis hypothetical protei... 99 3e-19
AJ605826_1(AJ605826|pid:none) Mesobuthus gibbosus partial trxt g... 99 3e-19
AJ605819_1(AJ605819|pid:none) Mesobuthus gibbosus partial trxt g... 99 3e-19
BC050132_1(BC050132|pid:none) Homo sapiens thioredoxin domain co... 98 5e-19
AF080095_1(AF080095|pid:none) Homo sapiens sperm-specific thiore... 98 5e-19
(Q86VQ3) RecName: Full=Thioredoxin domain-containing protein 2; ... 98 5e-19
BC049031_1(BC049031|pid:none) Danio rerio zgc:56493, mRNA (cDNA ... 98 6e-19
BT082484_1(BT082484|pid:none) Anoplopoma fimbria clone afim-evh-... 97 1e-18
EU499301_1(EU499301|pid:none) Litopenaeus vannamei thioredoxin 1... 97 1e-18
(Q9DGI3) RecName: Full=Thioredoxin; Short=Trx; &AF2936... 97 1e-18
U42760_1(U42760|pid:none) Naegleria fowleri thioredoxin homolog ... 96 2e-18
EF086787_1(EF086787|pid:none) Picea sitchensis clone WS02750_E16... 96 2e-18
BT049711_1(BT049711|pid:none) Salmo salar clone ssal-evf-541-161... 95 4e-18
EF083929_1(EF083929|pid:none) Picea sitchensis clone WS0272_C12 ... 95 4e-18
BT056690_1(BT056690|pid:none) Salmo salar clone ssal-eve-542-050... 95 4e-18
AC024827_2(AC024827|pid:none) Caenorhabditis elegans cosmid Y55F... 95 4e-18
BT073975_1(BT073975|pid:none) Oncorhynchus mykiss clone omyk-evo... 95 5e-18
DQ985602_1(DQ985602|pid:none) Bombyx mori clone 017_017005_2005-... 95 5e-18
BT073335_1(BT073335|pid:none) Oncorhynchus mykiss clone omyk-evn... 94 7e-18
BT075547_1(BT075547|pid:none) Osmerus mordax clone omor-eva-004-... 94 7e-18
BT049355_1(BT049355|pid:none) Salmo salar clone ssal-eve-504-203... 94 9e-18
AJ310990_1(AJ310990|pid:none) Pisum sativum mRNA for thioredoxin... 94 1e-17
CP000590_133(CP000590|pid:none) Ostreococcus lucimarinus CCE9901... 93 2e-17
BC083924_1(BC083924|pid:none) Rattus norvegicus thioredoxin doma... 93 2e-17
EF084076_1(EF084076|pid:none) Picea sitchensis clone WS0273_K20 ... 93 2e-17
BT073907_1(BT073907|pid:none) Oncorhynchus mykiss clone omyk-evo... 92 3e-17
EF144427_1(EF144427|pid:none) Populus trichocarpa clone PX0019_G... 92 3e-17
AM910994_488(AM910994|pid:none) Plasmodium knowlesi strain H chr... 92 3e-17
(Q6XHI1) RecName: Full=Thioredoxin-2; Short=Trx-2; &AY... 92 3e-17
(Q9V429) RecName: Full=Thioredoxin-2; Short=DmTrx-2; &... 92 3e-17
AE014134_1740(AE014134|pid:none) Drosophila melanogaster chromos... 92 3e-17
EF085642_1(EF085642|pid:none) Picea sitchensis clone WS02919_K03... 92 3e-17
DQ121443_1(DQ121443|pid:none) Medicago truncatula thioredoxin h2... 91 6e-17
AJ844023_1(AJ844023|pid:none) Plantago major mRNA for thioredoxi... 91 8e-17
BC126781_1(BC126781|pid:none) Bos taurus thioredoxin domain cont... 91 1e-16
BT057724_1(BT057724|pid:none) Salmo salar clone ssal-evf-539-015... 90 1e-16
BT056618_1(BT056618|pid:none) Salmo salar clone ssal-evf-553-337... 90 1e-16
CR954217_167(CR954217|pid:none) Ostreococcus tauri strain OTTH05... 90 2e-16
EU144128_1(EU144128|pid:none) Glycine max thioredoxin h2 mRNA, c... 89 2e-16
AC151524_17(AC151524|pid:none) Medicago truncatula chromosome 7 ... 89 2e-16
BC089153_1(BC089153|pid:none) Xenopus laevis hypothetical protei... 89 4e-16
DQ227992_1(DQ227992|pid:none) Eucalyptus grandis thioredoxin h m... 89 4e-16
AF202664_1(AF202664|pid:none) Plasmodium falciparum thioredoxin ... 88 5e-16
(Q07090) RecName: Full=Thioredoxin H-type 2; Short=Trx-... 88 5e-16
AY271308_1(AY271308|pid:none) Citrus x paradisi thioredoxin H mR... 88 6e-16
AJ937745_1(AJ937745|pid:none) Aspergillus fumigatus mRNA for thi... 88 6e-16
CR382131_1301(CR382131|pid:none) Yarrowia lipolytica strain CLIB... 88 6e-16
AF483265_1(AF483265|pid:none) Populus tremula x Populus tremuloi... 88 6e-16
BT043690_1(BT043690|pid:none) Salmo salar clone HM5_2058 thiored... 87 1e-15
CP000596_169(CP000596|pid:none) Ostreococcus lucimarinus CCE9901... 87 1e-15
AY170651_1(AY170651|pid:none) Pisum sativum clone 4 thioredoxin ... 87 1e-15
AJ937746_1(AJ937746|pid:none) Malassezia sympodialis partial mRN... 87 1e-15
BC077392_1(BC077392|pid:none) Xenopus laevis MGC81675 protein, m... 87 1e-15
(P80028) RecName: Full=Thioredoxin H-type; Short=Trx-H;... 87 1e-15
BT036432_1(BT036432|pid:none) Zea mays full-length cDNA clone ZM... 87 1e-15
AK241734_1(AK241734|pid:none) Oryza sativa Japonica Group cDNA, ... 86 2e-15
AC130601_4(AC130601|pid:none) Oryza sativa (japonica cultivar-gr... 86 2e-15
AB453990_1(AB453990|pid:none) Sebastes schlegelii mRNA for thior... 86 2e-15
EU958748_1(EU958748|pid:none) Zea mays clone 207751 thioredoxin ... 86 2e-15
EU957319_1(EU957319|pid:none) Zea mays clone 1588464 thioredoxin... 86 2e-15
AY376435_1(AY376435|pid:none) Paracoccidioides brasiliensis thio... 86 2e-15
BC076929_1(BC076929|pid:none) Xenopus tropicalis thioredoxin-lik... 86 2e-15
BX511310_2(BX511310|pid:none) Zebrafish DNA sequence from clone ... 86 3e-15
(Q5WNE3) RecName: Full=Peptide-N(4)-(N-acetyl-beta-glucosaminyl)... 86 3e-15
AY036906_1(AY036906|pid:none) Vitis labrusca Hsp70 interacting p... 86 3e-15
(Q43636) RecName: Full=Thioredoxin H-type; Short=Trx-H;... 85 4e-15
(Q9TW67) RecName: Full=Peptide-N(4)-(N-acetyl-beta-glucosaminyl)... 85 4e-15
AM270402_20(AM270402|pid:none) Aspergillus niger contig An18c010... 85 4e-15
AJ319808_1(AJ319808|pid:none) Pisum sativum mRNA for thioredoxin... 85 5e-15
AF286593_1(AF286593|pid:none) Triticum aestivum cultivar Soisson... 84 7e-15
EF145486_1(EF145486|pid:none) Populus trichocarpa clone WS01125_... 84 9e-15
BT078915_1(BT078915|pid:none) Esox lucius clone eluc-evq-531-163... 84 9e-15
(Q8CDN6) RecName: Full=Thioredoxin-like protein 1; AltName: Full... 84 1e-14
AF052660_1(AF052660|pid:none) Mus musculus thioredoxin-related p... 84 1e-14
AB209263_1(AB209263|pid:none) Homo sapiens mRNA for thioredoxin-... 84 1e-14
AK144211_1(AK144211|pid:none) Mus musculus RCB-0545 OHTA cDNA, R... 84 1e-14
AY891984_1(AY891984|pid:none) Synthetic construct Homo sapiens c... 84 1e-14
(O43396) RecName: Full=Thioredoxin-like protein 1; AltName: Full... 84 1e-14
BT056844_1(BT056844|pid:none) Salmo salar clone ssal-evd-508-225... 84 1e-14
AY815296_1(AY815296|pid:none) Schistosoma japonicum SJCHGC03599 ... 84 1e-14
AJ605808_1(AJ605808|pid:none) Mesobuthus eupeus partial trxt gen... 83 2e-14
AY673828_1(AY673828|pid:none) Schistosoma mansoni thioredoxin 2 ... 83 2e-14
C46264(C46264) thioredoxin 3 - slime mold (Dictyostelium discoid... 83 2e-14
CU928165_298(CU928165|pid:none) Kluyveromyces thermotolerans str... 83 2e-14
EU959440_1(EU959440|pid:none) Zea mays clone 218170 thioredoxin ... 83 2e-14
CR382135_217(CR382135|pid:none) Debaryomyces hansenii strain CBS... 83 2e-14
AY184798_1(AY184798|pid:none) Chlamydomonas reinhardtii thioredo... 83 2e-14
FM992695_901(FM992695|pid:none) Candida dubliniensis CD36 chromo... 82 3e-14
AF473536_1(AF473536|pid:none) Schistosoma mansoni thioredoxin mR... 82 3e-14
(P29447) RecName: Full=Thioredoxin-3; Short=Trx-3; 82 3e-14
A48516_1(A48516|pid:none) Sequence 4 from Patent WO9603505. &AF... 82 3e-14
AY245454_1(AY245454|pid:none) Hordeum vulgare subsp. vulgare thi... 82 3e-14
EU959205_1(EU959205|pid:none) Zea mays clone 212031 thioredoxin ... 82 4e-14
BT009704_1(BT009704|pid:none) Arabidopsis thaliana At3g17880 gen... 82 4e-14
AY245455_1(AY245455|pid:none) Hordeum vulgare subsp. vulgare thi... 82 4e-14
AY575954_1(AY575954|pid:none) Glycine max thioredoxin mRNA, comp... 82 4e-14
AK150983_1(AK150983|pid:none) Mus musculus bone marrow macrophag... 82 4e-14
AB019230_10(AB019230|pid:none) Arabidopsis thaliana genomic DNA,... 82 4e-14
CR382132_59(CR382132|pid:none) Yarrowia lipolytica strain CLIB12... 82 5e-14
AP007154_97(AP007154|pid:none) Aspergillus oryzae RIB40 genomic ... 82 5e-14
AK063980_1(AK063980|pid:none) Oryza sativa Japonica Group cDNA c... 81 6e-14
AY652616_1(AY652616|pid:none) Chlamys farreri thioredoxin mRNA, ... 81 6e-14
AF435818_1(AF435818|pid:none) Nicotiana tabacum thioredoxin h-li... 81 6e-14
AY072771_1(AY072771|pid:none) Triticum aestivum cultivar Soisson... 81 6e-14
(P29450) RecName: Full=Thioredoxin F-type, chloroplastic; ... 81 6e-14
FN392322_288(FN392322|pid:none) Pichia pastoris GS115 chromosome... 81 6e-14
(Q96419) RecName: Full=Thioredoxin H-type; Short=Trx-H;... 81 8e-14
EU972241_1(EU972241|pid:none) Zea mays clone 378310 thioredoxin ... 81 8e-14
AB061204_1(AB061204|pid:none) Cucurbita maxima mRNA for thioredo... 80 1e-13
EU953886_1(EU953886|pid:none) Zea mays clone 1448533 thioredoxin... 80 1e-13
AY088552_1(AY088552|pid:none) Arabidopsis thaliana clone 7791 mR... 80 1e-13
U35826_1(U35826|pid:none) Arabidopsis thaliana thioredoxin h (TR... 80 1e-13
EU970059_1(EU970059|pid:none) Zea mays clone 339213 thioredoxin ... 80 1e-13
AM269955_58(AM269955|pid:none) Aspergillus niger contig An01c008... 80 1e-13
(Q38879) RecName: Full=Thioredoxin H-type 2; Short=Trx-... 80 1e-13
CR380957_28(CR380957|pid:none) Candida glabrata strain CBS138 ch... 80 1e-13
AY084415_1(AY084415|pid:none) Arabidopsis thaliana clone 107806 ... 80 1e-13
(Q8IFW4) RecName: Full=Thioredoxin-T; Short=Thioredoxin... 80 1e-13
EU951839_1(EU951839|pid:none) Zea mays clone 1061422 unknown mRNA. 80 2e-13
U35829_1(U35829|pid:none) Arabidopsis thaliana thioredoxin h (TR... 80 2e-13
BT051300_1(BT051300|pid:none) Medicago truncatula clone MTYF1_F2... 80 2e-13
CR382125_708(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 80 2e-13
(Q39241) RecName: Full=Thioredoxin H-type 5; Short=Trx-... 80 2e-13
BT070665_1(BT070665|pid:none) Picea sitchensis clone WS02742_N09... 79 2e-13
BT070622_1(BT070622|pid:none) Picea sitchensis clone WS0273_J01 ... 79 2e-13
AE014298_746(AE014298|pid:none) Drosophila melanogaster chromoso... 79 2e-13
CR380951_15(CR380951|pid:none) Candida glabrata strain CBS138 ch... 79 2e-13
(Q39239) RecName: Full=Thioredoxin H-type 4; Short=Trx-... 79 2e-13
S58119(S58119) thioredoxin (clone GREN) - Arabidopsis thaliana ... 79 2e-13
U35828_1(U35828|pid:none) Arabidopsis thaliana thioredoxin h (TR... 79 2e-13
(Q9C9Y6) RecName: Full=Thioredoxin H-type 9; Short=Trx-... 79 2e-13
AY088698_1(AY088698|pid:none) Arabidopsis thaliana clone 9219 mR... 79 2e-13
(P29429) RecName: Full=Thioredoxin; Short=Trx; 79 3e-13
AY838902_1(AY838902|pid:none) Antrodia camphorata thioredoxin mR... 79 3e-13
S27053(S27053)thioredoxin - Emericella nidulans 79 3e-13
AC104321_8(AC104321|pid:none) Oryza sativa chromosome 3 BAC OSJN... 79 3e-13
AK101264_1(AK101264|pid:none) Oryza sativa Japonica Group cDNA c... 79 4e-13
AY344229_1(AY344229|pid:none) Ipomoea batatas thioredoxin H1 mRN... 78 5e-13
(P68176) RecName: Full=Thioredoxin H-type; Short=Trx-H;... 78 5e-13
AY525378_1(AY525378|pid:none) Paxillus involutus thioredoxin mRN... 78 5e-13
AP007151_915(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 78 5e-13
L35043_32(L35043|pid:none) Mycoplasma gallisepticum strain A5969... 78 5e-13
CP000583_70(CP000583|pid:none) Ostreococcus lucimarinus CCE9901 ... 78 5e-13
AF273844_1(AF273844|pid:none) Brassica oleracea var. alboglabra ... 78 5e-13
AJ605809_1(AJ605809|pid:none) Mesobuthus caucasicus partial trxt... 78 7e-13
AL158158_1(AL158158|pid:none) Human DNA sequence from clone RP11... 78 7e-13
AF483266_1(AF483266|pid:none) Populus tremula x Populus tremuloi... 77 9e-13
AE015450_633(AE015450|pid:none) Mycoplasma gallisepticum strain ... 77 9e-13
BA000016_739(BA000016|pid:none) Clostridium perfringens str. 13 ... 77 9e-13
AM460488_1(AM460488|pid:none) Vitis vinifera contig VV78X042595.... 77 9e-13
EF147512_1(EF147512|pid:none) Populus trichocarpa clone WS0123_A... 77 9e-13
L35043_18(L35043|pid:none) Mycoplasma gallisepticum strain A5969... 77 1e-12
CP001056_2460(CP001056|pid:none) Clostridium botulinum B str. Ek... 77 1e-12
FN357896_1(FN357896|pid:none) Schistosoma mansoni genome sequenc... 77 1e-12
EU239366_1(EU239366|pid:none) Brassica juncea thioredoxin mRNA, ... 77 1e-12
FN357896_2(FN357896|pid:none) Schistosoma mansoni genome sequenc... 77 1e-12
AC007915_21(AC007915|pid:none) Genomic sequence for Arabidopsis ... 77 1e-12
(O64432) RecName: Full=Thioredoxin H-type; Short=Trx-H;... 77 1e-12
S49352(S49352)protein S1 - Phalaris coerulescens 77 1e-12
BC049564_1(BC049564|pid:none) Mus musculus thioredoxin domain co... 77 1e-12
AK015240_1(AK015240|pid:none) Mus musculus adult male testis cDN... 77 1e-12
EU706448_1(EU706448|pid:none) Triticum aestivum cultivar Soisson... 77 1e-12
S49353(S49353;S49350)protein S2 - Phalaris coerulescens 77 1e-12
AF159388_1(AF159388|pid:none) Phalaris coerulescens thioredoxin-... 77 1e-12
CU928166_43(CU928166|pid:none) Kluyveromyces thermotolerans stra... 77 1e-12
AM270051_9(AM270051|pid:none) Aspergillus niger contig An03c0100... 77 1e-12
CU633899_120(CU633899|pid:none) Podospora anserina genomic DNA c... 77 1e-12
FN318998_1(FN318998|pid:none) Schistosoma japonicum isolate Anhu... 76 2e-12
AF435815_1(AF435815|pid:none) Hordeum vulgare thioredoxin h-like... 76 2e-12
AY204511_1(AY204511|pid:none) Leymus chinensis thioredoxin h gen... 76 2e-12
AM180088_1576(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 76 2e-12
AY816131_1(AY816131|pid:none) Schistosoma japonicum SJCHGC06363 ... 76 3e-12
DQ490238_1(DQ490238|pid:none) Tetrahymena thermophila dynein lig... 76 3e-12
EU959293_1(EU959293|pid:none) Zea mays clone 214479 thioredoxin ... 76 3e-12
EZ000056_1(EZ000056|pid:none) TSA: Schistosoma japonicum SJCHGC0... 76 3e-12
EU954106_1(EU954106|pid:none) Zea mays clone 1455829 thioredoxin... 76 3e-12
(Q9USR1) RecName: Full=Thioredoxin-like protein 1; AltName: Full... 76 3e-12
(Q69AB2) RecName: Full=Thioredoxin domain-containing protein 8; ... 76 3e-12
AY184797_1(AY184797|pid:none) Chlamydomonas reinhardtii cytosoli... 76 3e-12
EF585960_1(EF585960|pid:none) Sonneratia caseolaris isolate Sonn... 75 3e-12
FN315650_1(FN315650|pid:none) Schistosoma japonicum isolate Anhu... 75 3e-12
AF159385_1(AF159385|pid:none) Hordeum bulbosum thioredoxin-like ... 75 3e-12
CP000414_93(CP000414|pid:none) Leuconostoc mesenteroides subsp. ... 75 4e-12
BT057388_1(BT057388|pid:none) Salmo salar clone ssal-evd-551-253... 75 4e-12
AF435816_1(AF435816|pid:none) Zea mays thioredoxin h-like protei... 75 4e-12
EF087703_1(EF087703|pid:none) Picea sitchensis clone WS02736_F02... 75 4e-12
EU956315_1(EU956315|pid:none) Zea mays clone 1560680 thioredoxin... 75 4e-12
(Q8TFM8) RecName: Full=Thioredoxin-like protein; AltName: Allerg... 75 4e-12
BA000016_2355(BA000016|pid:none) Clostridium perfringens str. 13... 75 6e-12
AX461034_1(AX461034|pid:none) Sequence 24 from Patent WO0222823. 75 6e-12
AF159386_1(AF159386|pid:none) Secale cereale thioredoxin-like pr... 74 7e-12
AF106589_2(AF106589|pid:none) Caenorhabditis elegans cosmid Y44E... 74 7e-12
EF585961_1(EF585961|pid:none) Sonneratia ovata isolate Sonnbu_75... 74 7e-12
(O17486) RecName: Full=Thioredoxin; Short=Trx; &AF0346... 74 7e-12
AF438359_1(AF438359|pid:none) Triticum aestivum thioredoxin mRNA... 74 7e-12
EU967497_1(EU967497|pid:none) Zea mays clone 303728 thioredoxin ... 74 1e-11
AJ937744_1(AJ937744|pid:none) Aspergillus fumigatus mRNA for thi... 74 1e-11
FJ041113_1(FJ041113|pid:none) Hevea brasiliensis isolate HaiKen ... 74 1e-11
CP000251_2488(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 74 1e-11
AY389723_1(AY389723|pid:none) Hyacinthus orientalis thioredoxin ... 74 1e-11
CP000117_187(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 73 2e-11
EU280164_1(EU280164|pid:none) Vitis vinifera thioredoxin h (Trx)... 73 2e-11
EF585959_1(EF585959|pid:none) Sonneratia alba isolate Sonnbu_75_... 73 2e-11
EU955595_1(EU955595|pid:none) Zea mays clone 1538632 unknown mRNA. 73 2e-11
BT057086_1(BT057086|pid:none) Salmo salar clone ssal-evd-554-027... 73 2e-11
EU965957_1(EU965957|pid:none) Zea mays clone 290305 thioredoxin ... 73 2e-11
AP009049_2100(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 73 2e-11
AE017198_492(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 73 2e-11
EF148248_1(EF148248|pid:none) Populus trichocarpa x Populus delt... 73 2e-11
EF172446_1(EF172446|pid:none) Brassica juncea thioredoxin mRNA, ... 72 3e-11
CP000673_2331(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 72 3e-11
FN357365_52(FN357365|pid:none) Schistosoma mansoni genome sequen... 72 3e-11
CP000896_783(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 72 3e-11
BT035938_1(BT035938|pid:none) Zea mays full-length cDNA clone ZM... 72 3e-11
BC166975_1(BC166975|pid:none) Xenopus tropicalis hypothetical pr... 72 4e-11
EU810283_1(EU810283|pid:none) Gymnochlora stellata chloroplast t... 72 4e-11
AH2101(AH2101) thioredoxin [imported] - Nostoc sp. (strain PCC 7... 72 4e-11
AF159387_1(AF159387|pid:none) Lolium perenne thioredoxin-like pr... 72 4e-11
AP010656_350(AP010656|pid:none) Candidatus Azobacteroides pseudo... 72 4e-11
BT056501_1(BT056501|pid:none) Salmo salar clone ssal-evd-523-034... 72 4e-11
CP001087_1222(CP001087|pid:none) Desulfobacterium autotrophicum ... 72 5e-11
AP007165_8(AP007165|pid:none) Aspergillus oryzae RIB40 genomic D... 72 5e-11
CP001620_1971(CP001620|pid:none) Corynebacterium kroppenstedtii ... 71 6e-11
CP000246_713(CP000246|pid:none) Clostridium perfringens ATCC 131... 71 6e-11
AC144737_18(AC144737|pid:none) Oryza sativa (japonica cultivar-g... 71 6e-11
AF186240_1(AF186240|pid:none) Secale cereale thioredoxin-like pr... 71 6e-11
(P29446) RecName: Full=Thioredoxin-2; Short=Trx-2; Flag... 70 1e-10
(P37395) RecName: Full=Thioredoxin; Short=Trx; &AF0221... 70 1e-10
AE015928_1456(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 70 1e-10
CP000713_2211(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 70 1e-10
AJ507830_1(AJ507830|pid:none) Trichomonas vaginalis mRNA for thi... 70 1e-10
CP000436_1352(CP000436|pid:none) Haemophilus somnus 129PT, compl... 70 1e-10
CP001230_1222(CP001230|pid:none) Persephonella marina EX-H1, com... 70 1e-10
BT052063_1(BT052063|pid:none) Medicago truncatula clone MTYF9_FA... 70 1e-10
AM920433_354(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 70 1e-10
(O51088) RecName: Full=Thioredoxin; Short=Trx; &AE0007... 70 1e-10
AP003628_18(AP003628|pid:none) Oryza sativa Japonica Group genom... 70 1e-10
CP000033_405(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 70 1e-10
AY673996_162(AY673996|pid:none) Gracilaria tenuistipitata var. l... 70 2e-10
CP000139_1831(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 70 2e-10
AE014133_1693(AE014133|pid:none) Streptococcus mutans UA159, com... 70 2e-10
CP001279_1469(CP001279|pid:none) Nautilia profundicola AmH, comp... 69 2e-10
CP001056_2729(CP001056|pid:none) Clostridium botulinum B str. Ek... 69 2e-10
EF082902_1(EF082902|pid:none) Picea sitchensis clone WS02728_H05... 69 2e-10
EF083995_1(EF083995|pid:none) Picea sitchensis clone WS02713_G05... 69 2e-10
(O94504) RecName: Full=Thioredoxin-2, mitochondrial; Sh... 69 2e-10
CR940353_188(CR940353|pid:none) Theileria annulata strain Ankara... 69 2e-10
DQ986213_1(DQ986213|pid:none) Borrelia garinii strain 387 thiore... 69 3e-10
DQ986209_1(DQ986209|pid:none) Borrelia garinii strain G25 thiore... 69 3e-10
AY084496_1(AY084496|pid:none) Arabidopsis thaliana clone 10950 m... 69 4e-10
AY085376_1(AY085376|pid:none) Arabidopsis thaliana clone 148597 ... 69 4e-10
CP000668_3413(CP000668|pid:none) Yersinia pestis Pestoides F, co... 69 4e-10
CP001213_565(CP001213|pid:none) Bifidobacterium animalis subsp. ... 69 4e-10
AC004238_23(AC004238|pid:none) Arabidopsis thaliana chromosome 2... 69 4e-10
CP001205_58(CP001205|pid:none) Borrelia burgdorferi ZS7, complet... 68 5e-10
CP000139_2297(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 68 5e-10
CP000937_1762(CP000937|pid:none) Francisella philomiragia subsp.... 68 5e-10
AC144502_16(AC144502|pid:none) Medicago truncatula clone mth2-5p... 68 5e-10
AC007258_5(AC007258|pid:none) Arabidopsis thaliana chromosome I ... 68 5e-10
DQ986206_1(DQ986206|pid:none) Borrelia garinii strain FAR01 thio... 68 7e-10
DQ986205_1(DQ986205|pid:none) Borrelia garinii strain 935T thior... 68 7e-10
(Q9PJK3) RecName: Full=Thioredoxin; Short=Trx; &AE0021... 68 7e-10
CP000937_1274(CP000937|pid:none) Francisella philomiragia subsp.... 68 7e-10
CP000387_341(CP000387|pid:none) Streptococcus sanguinis SK36, co... 67 9e-10
AE004092_1412(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ... 67 9e-10
AE000782_1267(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 67 9e-10
AM286415_161(AM286415|pid:none) Yersinia enterocolitica subsp. e... 67 9e-10
BA000034_281(BA000034|pid:none) Streptococcus pyogenes SSI-1 DNA... 67 9e-10
DQ986202_1(DQ986202|pid:none) Borrelia valaisiana VS116 thioredo... 67 9e-10
AE009949_1567(AE009949|pid:none) Streptococcus pyogenes MGAS8232... 67 9e-10
CP000498_688(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 67 9e-10
FN392322_754(FN392322|pid:none) Pichia pastoris GS115 chromosome... 67 9e-10
CP000003_1571(CP000003|pid:none) Streptococcus pyogenes MGAS1039... 67 9e-10
CP001079_60(CP001079|pid:none) Anaplasma marginale str. Florida,... 67 1e-09
AM406671_772(AM406671|pid:none) Lactococcus lactis subsp. cremor... 67 1e-09
(O84544) RecName: Full=Thioredoxin; Short=Trx; &AE0012... 67 1e-09
AP009247_420(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 67 1e-09
CR378674_138(CR378674|pid:none) Photobacterium profundum SS9; se... 67 1e-09
CR954201_67(CR954201|pid:none) Ostreococcus tauri strain OTTH059... 67 1e-09
CP000030_61(CP000030|pid:none) Anaplasma marginale str. St. Mari... 67 1e-09
AE005176_1644(AE005176|pid:none) Lactococcus lactis subsp. lacti... 67 1e-09
DQ986217_1(DQ986217|pid:none) Borrelia garinii strain NT29 thior... 67 1e-09
CP000746_1814(CP000746|pid:none) Actinobacillus succinogenes 130... 67 1e-09
AF144388_1(AF144388|pid:none) Arabidopsis thaliana thioredoxin-l... 67 2e-09
AM502248_138(AM502248|pid:none) Leishmania infantum chromosome 30. 67 2e-09
DQ986218_1(DQ986218|pid:none) Borrelia afzelii strain A26S thior... 67 2e-09
CP001132_1607(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 67 2e-09
DQ986220_1(DQ986220|pid:none) Borrelia afzelii ACA-1 strain ACA1... 67 2e-09
CP000048_57(CP000048|pid:none) Borrelia hermsii DAH, complete ge... 67 2e-09
CR954205_95(CR954205|pid:none) Ostreococcus tauri strain OTTH059... 67 2e-09
CP000251_2193(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 67 2e-09
CP000267_194(CP000267|pid:none) Rhodoferax ferrireducens T118, c... 67 2e-09
CP000142_3276(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 67 2e-09
EF146784_1(EF146784|pid:none) Populus trichocarpa clone WS01213_... 67 2e-09
CP000425_1663(CP000425|pid:none) Lactococcus lactis subsp. cremo... 67 2e-09
(O74790) RecName: Full=Monothiol glutaredoxin-5; &AL031743_6(AL... 67 2e-09
CP001100_1898(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 66 2e-09
FM872308_551(FM872308|pid:none) Chlamydia trachomatis JALI20 ser... 66 2e-09
(P66928) RecName: Full=Thioredoxin; Short=Trx; &(P6692... 66 2e-09
CP000517_361(CP000517|pid:none) Lactobacillus helveticus DPC 457... 66 2e-09
CP001365_238(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 66 2e-09
CP000113_2585(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 66 2e-09
AC010675_9(AC010675|pid:none) Arabidopsis thaliana chromosome 1 ... 66 2e-09
CP000140_1864(CP000140|pid:none) Parabacteroides distasonis ATCC... 66 2e-09
CP000653_3969(CP000653|pid:none) Enterobacter sp. 638, complete ... 66 2e-09
AF095750_1(AF095750|pid:none) Arabidopsis thaliana thioredoxin m... 66 2e-09
CP000440_1968(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 66 2e-09
AM233362_611(AM233362|pid:none) Francisella tularensis subsp. ho... 66 2e-09
CP000108_1133(CP000108|pid:none) Chlorobium chlorochromatii CaD3... 66 3e-09
CP000915_779(CP000915|pid:none) Francisella tularensis subsp. me... 66 3e-09
CP000439_833(CP000439|pid:none) Francisella tularensis subsp. no... 66 3e-09
CP001072_518(CP001072|pid:none) Helicobacter pylori Shi470, comp... 66 3e-09
CP001287_544(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 66 3e-09
CP000542_1513(CP000542|pid:none) Verminephrobacter eiseniae EF01... 66 3e-09
BX640446_284(BX640446|pid:none) Bordetella bronchiseptica strain... 66 3e-09
AY184800_1(AY184800|pid:none) Chlamydomonas reinhardtii thioredo... 66 3e-09
BX293980_71(BX293980|pid:none) Mycoplasma mycoides subsp. mycoid... 66 3e-09
CP000127_566(CP000127|pid:none) Nitrosococcus oceani ATCC 19707,... 66 3e-09
(P50338) RecName: Full=Thioredoxin; Short=Trx; &S46522... 66 3e-09
CP000993_59(CP000993|pid:none) Borrelia recurrentis A1, complete... 66 3e-09
CP000393_2507(CP000393|pid:none) Trichodesmium erythraeum IMS101... 65 3e-09
DQ986207_1(DQ986207|pid:none) Borrelia garinii strain HP3 thiore... 65 3e-09
EF484711_1(EF484711|pid:none) Melampsora medusae f. sp. deltoidi... 65 3e-09
AM946015_1520(AM946015|pid:none) Streptococcus uberis 0140J comp... 65 3e-09
AM902716_1980(AM902716|pid:none) Bordetella petrii strain DSM 12... 65 3e-09
CP000377_2846(CP000377|pid:none) Silicibacter sp. TM1040, comple... 65 3e-09
AP008207_3754(AP008207|pid:none) Oryza sativa (japonica cultivar... 65 3e-09
CP000828_5313(CP000828|pid:none) Acaryochloris marina MBIC11017,... 65 3e-09
CP001099_852(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 65 3e-09
CP000356_2644(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 65 3e-09
EF484709_1(EF484709|pid:none) Melampsora medusae f. sp. deltoidi... 65 3e-09
AP003263_29(AP003263|pid:none) Oryza sativa Japonica Group genom... 65 3e-09
EF484712_1(EF484712|pid:none) Melampsora medusae f. sp. deltoidi... 65 3e-09
AY596296_121(AY596296|pid:none) Haloarcula marismortui ATCC 4304... 65 3e-09
AE005174_4741(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 65 3e-09
CP000412_1278(CP000412|pid:none) Lactobacillus delbrueckii subsp... 65 3e-09
CP000386_2244(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 65 4e-09
S77780(S77780;S46921) thioredoxin - Mycoplasma capricolum (fragm... 65 4e-09
CP000088_170(CP000088|pid:none) Thermobifida fusca YX, complete ... 65 4e-09
CP001016_2137(CP001016|pid:none) Beijerinckia indica subsp. indi... 65 4e-09
CP000155_1204(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 65 4e-09
CP000262_1618(CP000262|pid:none) Streptococcus pyogenes MGAS1075... 65 4e-09
CP000439_1373(CP000439|pid:none) Francisella tularensis subsp. n... 65 4e-09
CP000647_4230(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 65 4e-09
AP006725_130(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 65 4e-09
CP000976_61(CP000976|pid:none) Borrelia duttonii Ly, complete ge... 65 4e-09
CP000783_3659(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 65 4e-09
CP000009_604(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 65 4e-09
AM270325_14(AM270325|pid:none) Aspergillus niger contig An14c018... 65 4e-09
AJ749949_1445(AJ749949|pid:none) Francisella tularensis subsp. t... 65 4e-09
CP000348_1607(CP000348|pid:none) Leptospira borgpetersenii serov... 65 4e-09
CP000393_808(CP000393|pid:none) Trichodesmium erythraeum IMS101,... 65 4e-09
CP000075_300(CP000075|pid:none) Pseudomonas syringae pv. syringa... 65 4e-09
CP000608_355(CP000608|pid:none) Francisella tularensis subsp. tu... 65 4e-09
AM260525_26(AM260525|pid:none) Bartonella tribocorum CIP 105476 ... 65 6e-09
AE015928_2229(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 65 6e-09
BX640414_260(BX640414|pid:none) Bordetella pertussis strain Toha... 65 6e-09
CP001280_1391(CP001280|pid:none) Methylocella silvestris BL2, co... 65 6e-09
BT053469_1(BT053469|pid:none) Medicago truncatula clone MTYFP_FQ... 65 6e-09
AB032759_1(AB032759|pid:none) Actinobacillus actinomycetemcomita... 65 6e-09
AP011115_3471(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 65 6e-09
CP000109_1386(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 65 6e-09
AM235208_1(AM235208|pid:none) Pisum sativum mitochondrial mRNA f... 65 6e-09
AM285319_31(AM285319|pid:none) Spiroplasma citri GII3-3X chromos... 65 6e-09
CP001131_1661(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 65 6e-09
CP001618_366(CP001618|pid:none) Beutenbergia cavernae DSM 12333,... 65 6e-09
FM954972_2873(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 65 6e-09
BT061998_1(BT061998|pid:none) Zea mays full-length cDNA clone ZM... 65 6e-09
CP000077_1699(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 65 6e-09
AE016823_1917(AE016823|pid:none) Leptospira interrogans serovar ... 65 6e-09
CP001097_785(CP001097|pid:none) Chlorobium limicola DSM 245, com... 65 6e-09
AP009256_1349(AP009256|pid:none) Bifidobacterium adolescentis AT... 64 8e-09
CS008397_1(CS008397|pid:none) Sequence 23 from Patent WO20050071... 64 8e-09
AE016820_142(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 64 8e-09
(P0AA25) RecName: Full=Thioredoxin-1; Short=Trx-1; &(P... 64 8e-09
CP000822_118(CP000822|pid:none) Citrobacter koseri ATCC BAA-895,... 64 8e-09
U16857_2(U16857|pid:none) Fusion cloning vector pTRXFUS, complet... 64 8e-09
CP001110_1435(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 64 8e-09
AX971629_1(AX971629|pid:none) Sequence 2432 from Patent EP1104808. 64 8e-09
GM711552_1(GM711552|pid:none) Sequence 47 from Patent WO20080949... 64 8e-09
AP007281_525(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 64 8e-09
CP000489_2760(CP000489|pid:none) Paracoccus denitrificans PD1222... 64 8e-09
CP001129_326(CP001129|pid:none) Streptococcus equi subsp. zooepi... 64 8e-09
CP001340_3651(CP001340|pid:none) Caulobacter crescentus NA1000, ... 64 8e-09
CS008405_1(CS008405|pid:none) Sequence 31 from Patent WO20050071... 64 8e-09
AP009153_1250(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 64 8e-09
(Q6A555) RecName: Full=Thioredoxin domain-containing protein 8; ... 64 8e-09
AE017340_1982(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 64 8e-09
AF305830_1(AF305830|pid:none) Homo sapiens thioredoxin 6 (TRX6) ... 64 8e-09
CT573072_936(CT573072|pid:none) Kuenenia stuttgartiensis genome ... 64 8e-09
CP000612_748(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 64 1e-08
A96499(A96499) hypothetical protein T10P12.4 [imported] - Arabid... 64 1e-08
(Q9CM49) RecName: Full=Thioredoxin; Short=Trx; &AE0044... 64 1e-08
CP000395_59(CP000395|pid:none) Borrelia afzelii PKo, complete ge... 64 1e-08
AM778949_73(AM778949|pid:none) Microcystis aeruginosa PCC 7806 g... 64 1e-08
AY128276_1(AY128276|pid:none) Arabidopsis thaliana At1g43560/T10... 64 1e-08
AL954747_1035(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 64 1e-08
AP009552_4600(AP009552|pid:none) Microcystis aeruginosa NIES-843... 64 1e-08
CP000448_438(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 64 1e-08
(P47370) RecName: Full=Thioredoxin; Short=Trx; &CP0009... 64 1e-08
AE017340_2350(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 64 1e-08
AM260522_659(AM260522|pid:none) Helicobacter acinonychis str. Sh... 64 1e-08
AM270041_9(AM270041|pid:none) Aspergillus niger contig An02c0480... 64 1e-08
AL606687_5(AL606687|pid:none) Oryza sativa genomic DNA, chromoso... 64 1e-08
(P52231) RecName: Full=Thioredoxin; Short=Trx; &BA0000... 64 1e-08
AP008210_1557(AP008210|pid:none) Oryza sativa (japonica cultivar... 64 1e-08
AE017285_1831(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 64 1e-08
M54881_1(M54881|pid:none) Escherichia coli thioredoxin (trxA) ge... 64 1e-08
AE005673_109(AE005673|pid:none) Caulobacter crescentus CB15, com... 64 1e-08
CP000453_364(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 64 1e-08
CR767821_778(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 64 1e-08
AM485099_1(AM485099|pid:none) Vitis vinifera contig VV78X160692.... 64 1e-08
EU136387_1(EU136387|pid:none) Panax ginseng thioredoxin h-like p... 64 1e-08
(P52232) RecName: Full=Thioredoxin-like protein slr0233; &BA000... 64 1e-08
AM412317_3440(AM412317|pid:none) Clostridium botulinum A str. AT... 63 2e-08
CP000153_1859(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 63 2e-08
CP001055_484(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 63 2e-08
AB182631_1(AB182631|pid:none) Glycine max Gm pdis-2 mRNA for pro... 63 2e-08
CP000828_4723(CP000828|pid:none) Acaryochloris marina MBIC11017,... 63 2e-08
BT051337_1(BT051337|pid:none) Medicago truncatula clone MTYF1_F2... 63 2e-08
CP001106_56(CP001106|pid:none) Eubacterium eligens ATCC 27750 pl... 63 2e-08
AY619685_18(AY619685|pid:none) Uncultured gamma proteobacterium ... 63 2e-08
CP000270_2070(CP000270|pid:none) Burkholderia xenovorans LB400 c... 63 2e-08
CU459003_2720(CU459003|pid:none) Magnetospirillum gryphiswaldens... 63 2e-08
CP000141_2143(CP000141|pid:none) Carboxydothermus hydrogenoforma... 63 2e-08
AE001437_3036(AE001437|pid:none) Clostridium acetobutylicum ATCC... 63 2e-08
CR522870_810(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 63 2e-08
DQ869238_1(DQ869238|pid:none) Acetobacter aceti thioredoxin (trx... 63 2e-08
CP001341_2732(CP001341|pid:none) Arthrobacter chlorophenolicus A... 63 2e-08
CP001083_3575(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 63 2e-08
CP000644_2120(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 63 2e-08
CP001601_2523(CP001601|pid:none) Corynebacterium aurimucosum ATC... 63 2e-08
CP000607_997(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 63 2e-08
CP000590_336(CP000590|pid:none) Ostreococcus lucimarinus CCE9901... 63 2e-08
AM989985_13(AM989985|pid:none) Zygosaccharomyces rouxii strain C... 63 2e-08
AY552545_38(AY552545|pid:none) Uncultured marine gamma proteobac... 63 2e-08
AY621086_1(AY621086|pid:none) Trichomonas vaginalis thioredoxin ... 63 2e-08
(Q5UR29) RecName: Full=Thioredoxin-like protein R548; &AY653733... 63 2e-08
CP001154_588(CP001154|pid:none) Laribacter hongkongensis HLHK9, ... 63 2e-08
AL513467_25(AL513467|pid:none) Neurospora crassa DNA linkage gro... 63 2e-08
(P0A0K4) RecName: Full=Thioredoxin; Short=Trx; &(P0A0K... 63 2e-08
(P12243) RecName: Full=Thioredoxin-1; Short=Trx-1; AltN... 63 2e-08
AM167904_2376(AM167904|pid:none) Bordetella avium 197N complete ... 63 2e-08
AE017180_3261(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 63 2e-08
AY086416_1(AY086416|pid:none) Arabidopsis thaliana clone 25014 m... 63 2e-08
AP009044_3043(AP009044|pid:none) Corynebacterium glutamicum R DN... 63 2e-08
CP000148_3193(CP000148|pid:none) Geobacter metallireducens GS-15... 63 2e-08
CP000383_3501(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 63 2e-08
(P10472) RecName: Full=Thioredoxin; Short=Trx; 63 2e-08
AE017220_3821(AE017220|pid:none) Salmonella enterica subsp. ente... 63 2e-08
AX763726_1(AX763726|pid:none) Sequence 33 from Patent WO03040180... 63 2e-08
EF147316_1(EF147316|pid:none) Populus trichocarpa clone WS0122_J... 63 2e-08
CP000863_3181(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 63 2e-08
CP001182_3322(CP001182|pid:none) Acinetobacter baumannii AB0057,... 63 2e-08
CP000511_5969(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 63 2e-08
CP001322_2389(CP001322|pid:none) Desulfatibacillum alkenivorans ... 63 2e-08
BX908798_379(BX908798|pid:none) Parachlamydia-related symbiont U... 63 2e-08
CP000777_2179(CP000777|pid:none) Leptospira biflexa serovar Pato... 63 2e-08
(Q8LCT3) RecName: Full=Thioredoxin-like 6, chloroplastic; Flags:... 63 2e-08
EF585880_1(EF585880|pid:none) Sonneratia alba isolate Sonn465_1 ... 63 2e-08
AF386933_1(AF386933|pid:none) Arabidopsis thaliana Thioredoxin-l... 63 2e-08
CP000232_903(CP000232|pid:none) Moorella thermoacetica ATCC 3907... 63 2e-08
AM420293_7186(AM420293|pid:none) Saccharopolyspora erythraea NRR... 63 2e-08
NRL(2TIR) Thioredoxin mutant with lys 36 replaced by glu (k36e) - 63 2e-08
CU468135_195(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 62 3e-08
CP000821_4101(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 62 3e-08
CP000248_1986(CP000248|pid:none) Novosphingobium aromaticivorans... 62 3e-08
BX571874_205(BX571874|pid:none) Photorhabdus luminescens subsp. ... 62 3e-08

>FJ384985_1(FJ384985|pid:none) Bombina orientalis thioredoxin mRNA,
complete cds.
Length = 105

Score = 113 bits (282), Expect = 1e-23
Identities = 50/91 (54%), Positives = 68/91 (74%)
Frame = +1

Query: 73 LVTAGKRLVVVDFTATWCGPCKMISPYFEQLSSEYKDVIFLKVDVDQCKSTTQSQGVRAM 252
LV AG +LVVVDFTATWCGPCKMI+P+F+ LS +Y DV+FLKVDVD + S ++ M
Sbjct: 15 LVDAGDKLVVVDFTATWCGPCKMIAPFFKSLSEKYPDVVFLKVDVDDAQDVAASCDIKCM 74

Query: 253 PTFKFFIERKQVHEFSGADKNQLKSSIERLQ 345
PTF F+ ++VH+FSGA++N L+ + L+
Sbjct: 75 PTFHFYKNGEKVHDFSGANQNTLEQKVVELK 105

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,325,292,535
Number of extensions: 21556185
Number of successful extensions: 68122
Number of sequences better than 10.0: 2702
Number of HSP's gapped: 67042
Number of HSP's successfully gapped: 3028
Length of query: 381
Length of database: 1,040,966,779
Length adjustment: 130
Effective length of query: 251
Effective length of database: 624,409,729
Effective search space: 156726841979
Effective search space used: 156726841979
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.85 gvh: 0.48 alm: 0.54 top: 0.40 tms: 0.00 mit: 0.65 mip: 0.05
nuc: 0.03 erl: 0.00 erm: 0.40 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

68.0 %: mitochondrial
12.0 %: cytoplasmic
12.0 %: nuclear
4.0 %: cytoskeletal
4.0 %: vacuolar

>> prediction for Contig-U08276-1 is mit

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 1
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0