| Homology vs DNA |
 Query= Contig-U08273-1 (Contig-U08273-1Q) /CSM_Contig/Contig-U08273-1Q.Seq.d
(1082 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ361961) Dictyostelium discoideum cDNA clone:ddc19b16, 5' ... 1245 0.0 1
(BJ375658) Dictyostelium discoideum cDNA clone:ddc19b16, 3' ... 835 0.0 3
(BJ375653) Dictyostelium discoideum cDNA clone:ddc19a16, 3' ... 379 e-133 3
(FC769493) CBBN5087.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 48 9e-07 2
(CA135692) SCJLRT1020E11.b RT1 Saccharum officinarum cDNA cl... 54 2e-05 2
(CN131275) RHOH1_47_A01.b1_A002 Acid- and alkaline-treated r... 54 8e-04 2
(CN132933) OX1_9_C10.b1_A002 Oxidatively-stressed leaves and... 54 9e-04 2
(CA073664) SCEQAM1036B10.g AM1 Saccharum officinarum cDNA cl... 46 0.002 2
(CA074124) SCEQAM1043B08.g AM1 Saccharum officinarum cDNA cl... 46 0.003 2
(CA188183) SCCCAM1C04B07.g AM1 Saccharum officinarum cDNA cl... 46 0.003 2
(CD445497) EL01T0403A11.b Endosperm_4 Zea mays cDNA, mRNA se... 46 0.003 2
(CW328436) 104_824_11479298_148_35985_005 Sorghum methylatio... 54 0.011 1
(CW185549) 104_603_11166115_116_36833_076 Sorghum methylatio... 54 0.011 1
(CW185548) 104_603_11166115_116_36697_076 Sorghum methylatio... 54 0.011 1
(CW177056) 104_590_11158819_148_36591_076 Sorghum methylatio... 54 0.011 1
(CA193118) SCRLAD1041F11.g AD1 Saccharum officinarum cDNA cl... 54 0.011 1
(CA081740) SCAGAM2017H09.g AM2 Saccharum officinarum cDNA cl... 54 0.011 1
(CA075908) SCJLAM1064F12.g AM1 Saccharum officinarum cDNA cl... 54 0.011 1
(BG049342) OV1_18_F12.g1_A002 Ovary 1 (OV1) Sorghum bicolor ... 54 0.011 1
(AC197555) Zea mays chromosome 3 clone CH201-31C19; ZMMBBc00... 46 0.017 3
(CA082844) SCBFAM2117H03.g AM2 Saccharum officinarum cDNA cl... 46 0.043 2
(AG450781) Mus musculus molossinus DNA, clone:MSMg01-335I20.... 34 0.090 3
(DB842673) Nilaparvata lugens mRNA, EST clone:NLEA3790, 5' e... 46 0.13 2
(CA111801) SCCCLB1023E07.g LB1 Saccharum officinarum cDNA cl... 50 0.18 1
(AC125983) Rattus norvegicus clone CH230-228H9, *** SEQUENCI... 36 0.33 6
(AC106691) Rattus norvegicus clone CH230-223J21, *** SEQUENC... 36 0.60 6
(AC166324) Mus musculus BAC clone RP24-500J7 from chromosome... 48 0.70 1
(FC573782) CAXP10700.fwd CAXP Lottia gigantea from head, foo... 48 0.70 1
(AC129369) Rattus norvegicus clone CH230-126A1, *** SEQUENCI... 42 1.3 5
(CU694939) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 1.4 2
(AC098092) Rattus norvegicus clone CH230-11K1, *** SEQUENCIN... 36 1.7 6
(AC124958) Medicago truncatula clone mth2-18i11, complete se... 42 1.8 4
(AX344551) Sequence 2 from Patent WO0200932. 34 2.1 11
(AC121233) Medicago truncatula chromosome 8 clone mth2-14g13... 36 2.2 4
(AC174146) Medicago truncatula chromosome 8 clone mth2-64g3,... 42 2.2 6
(AC157411) Bos taurus clone CH240-66P12, WORKING DRAFT SEQUE... 40 2.7 6
(BH151773) ENTPE70TF Entamoeba histolytica Sheared DNA Entam... 42 2.7 2
(AC144474) Medicago truncatula clone mth2-15l5, complete seq... 42 2.7 4
(AC140548) Medicago truncatula clone mth2-12n15, complete se... 46 2.8 1
(AC202512) Medicago truncatula clone mth2-56k14, WORKING DRA... 46 2.8 1
(AY110597) Zea mays CL317_1 mRNA sequence. 46 2.8 1
(CC011942) PUDJK17TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 46 2.8 1
(DB588618) Halocynthia roretzi cDNA clone:ma332k08, 5' end. 46 2.8 1
(AM285302) Spiroplasma citri GII3-3X chromosome, contig Cont... 46 2.8 1
(EK065779) 1092960121643 Global-Ocean-Sampling_GS-31-01-01-1... 36 2.8 2
(BH150126) ENTPJ66TR Entamoeba histolytica Sheared DNA Entam... 42 2.8 2
(EK050250) 1092959693796 Global-Ocean-Sampling_GS-31-01-01-1... 36 2.9 2
(AC139949) Rattus norvegicus clone CH230-124M14, WORKING DRA... 36 3.0 6
(AC098202) Rattus norvegicus clone CH230-139K9, WORKING DRAF... 42 3.7 6
(AC094932) Rattus norvegicus clone CH230-6D19, *** SEQUENCIN... 42 4.0 3
(AC125956) Rattus norvegicus clone CH230-253J11, *** SEQUENC... 38 4.4 5
(AC011274) Homo sapiens clone RP11-12O12, WORKING DRAFT SEQU... 34 4.4 5
(AL929504) Zebrafish DNA sequence from clone CH211-155A11 in... 32 5.2 2
(AC171155) Atelerix albiventris clone LB4-208A24, WORKING DR... 40 5.5 2
(AI049154) ub35f09.r1 Soares_thymus_2NbMT Mus musculus cDNA ... 40 5.6 2
(AC148749) Sorex araneus clone SA_Ba-584C10, WORKING DRAFT S... 36 5.6 3
(CP000111) Prochlorococcus marinus str. MIT 9312, complete g... 36 5.6 16
(BX529675) RZPD Mus musculus cDNA clone IMAGp998I093873 = IM... 40 6.3 2
(AC096141) Rattus norvegicus clone CH230-10P5, *** SEQUENCIN... 36 6.3 5
(CX247745) 1299667 NCCCWA 02RT Oncorhynchus mykiss cDNA clon... 34 6.9 2
(CX247744) 1299666 NCCCWA 02RT Oncorhynchus mykiss cDNA clon... 34 6.9 2
(Z72825) S.cerevisiae chromosome VII reading frame ORF YGR040w. 38 8.0 3
(BH356439) CH230-163J17.TV CHORI-230 Segment 1 Rattus norveg... 36 8.7 2
(FH633396) CHO_OF4562xf23f1.ab1 CHO_OF4 Nicotiana tabacum ge... 36 9.2 2
(BX294131) Zebrafish DNA sequence from clone CH211-254O18 in... 44 9.4 6
(BZ106674) CH230-228E9.TV CHORI-230 Segment 1 Rattus norvegi... 42 9.9 2
>(BJ361961) Dictyostelium discoideum cDNA clone:ddc19b16, 5' end,
single read.
Length = 628
Score = 1245 bits (628), Expect = 0.0
Identities = 628/628 (100%)
Strand = Plus / Plus
Query: 1 atttatttagtttgatggcatcaattatcaaatttacagcattatctggagcaaaagatg 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 atttatttagtttgatggcatcaattatcaaatttacagcattatctggagcaaaagatg 60
Query: 61 aatcaccaccatgttatttattagaaattgatgatttttgtatattattagattgtggtc 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 aatcaccaccatgttatttattagaaattgatgatttttgtatattattagattgtggtc 120
Query: 121 taagttataatttagacttttcattattagaaccattggaaaaggttgcaaagaaaatag 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 taagttataatttagacttttcattattagaaccattggaaaaggttgcaaagaaaatag 180
Query: 181 atgcagtattattatcacattcagatacgacacatattggtgggttaccatatgttgttg 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 atgcagtattattatcacattcagatacgacacatattggtgggttaccatatgttgttg 240
Query: 241 gtaaatatggattaacaggtacaatatatggtacaacaccagtattaaagatgggtacaa 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gtaaatatggattaacaggtacaatatatggtacaacaccagtattaaagatgggtacaa 300
Query: 301 tgtttttatatgatttatatgagaataagatgtcacaagaagagtttcaacaatatagtt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tgtttttatatgatttatatgagaataagatgtcacaagaagagtttcaacaatatagtt 360
Query: 361 tggataatattgatagttgttttggagaagatagatttaaagaattaagttttagtcagc 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 tggataatattgatagttgttttggagaagatagatttaaagaattaagttttagtcagc 420
Query: 421 attattcactctctggtaaaggtaaaggaatatcgataacaccttatttggcaggacaca 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 attattcactctctggtaaaggtaaaggaatatcgataacaccttatttggcaggacaca 480
Query: 481 caattggtgcatcagtttggaagattacaaaaggtacttattcaattgtttacgctatcg 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 caattggtgcatcagtttggaagattacaaaaggtacttattcaattgtttacgctatcg 540
Query: 541 attataatcatagaaatgaaggacatttagatagtttacaattgacaagtgatattttga 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 attataatcatagaaatgaaggacatttagatagtttacaattgacaagtgatattttga 600
Query: 601 agccatcctttgttaattaccgattcaa 628
||||||||||||||||||||||||||||
Sbjct: 601 agccatcctttgttaattaccgattcaa 628
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,277,054,808
Number of extensions: 71096832
Number of successful extensions: 5777409
Number of sequences better than 10.0: 67
Length of query: 1082
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1058
Effective length of database: 97,308,875,965
Effective search space: 102952790770970
Effective search space used: 102952790770970
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U08273-1 (Contig-U08273-1Q) /CSM_Contig/Contig-U08273-1Q.Seq.d
(1082 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q9P2I0) RecName: Full=Cleavage and polyadenylation specificity ... 201 7e-83
AJ851661_1(AJ851661|pid:none) Gallus gallus mRNA for hypothetica... 203 1e-82
BT059180_1(BT059180|pid:none) Salmo salar clone ssal-rgf-530-370... 201 1e-82
(O35218) RecName: Full=Cleavage and polyadenylation specificity ... 199 3e-82
AK140869_1(AK140869|pid:none) Mus musculus 16 days embryo head c... 199 3e-82
AK147746_1(AK147746|pid:none) Mus musculus melanocyte cDNA, RIKE... 199 3e-82
AK141325_1(AK141325|pid:none) Mus musculus 7 days embryo whole b... 199 3e-82
CP001574_294(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 187 2e-76
(Q9LKF9) RecName: Full=Cleavage and polyadenylation specificity ... 186 1e-73
AF283277_1(AF283277|pid:none) Arabidopsis thaliana polyadenylati... 185 2e-73
FN357366_42(FN357366|pid:none) Schistosoma mansoni genome sequen... 190 5e-72
CR954201_248(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 169 1e-70
(Q652P4) RecName: Full=Cleavage and polyadenylation specificity ... 182 2e-69
(O17403) RecName: Full=Probable cleavage and polyadenylation spe... 171 1e-68
BC007163_1(BC007163|pid:none) Mus musculus cleavage and polyaden... 152 6e-68
(A8XUS3) RecName: Full=Probable cleavage and polyadenylation spe... 174 2e-67
AF374376_29(AF374376|pid:none) Oikopleura dioica clone BAC clone... 164 6e-61
AK023583_1(AK023583|pid:none) Homo sapiens cDNA FLJ13521 fis, cl... 130 8e-54
AE014297_4475(AE014297|pid:none) Drosophila melanogaster chromos... 129 8e-51
(O74740) RecName: Full=Cleavage factor two protein 2; &AL031852... 101 1e-38
AB168421_1(AB168421|pid:none) Macaca fascicularis testis cDNA cl... 130 8e-29
AB037788_1(AB037788|pid:none) Homo sapiens mRNA for KIAA1367 pro... 126 1e-27
CP001576_344(CP001576|pid:none) Micromonas sp. RCC299 chromosome... 77 2e-27
(Q6FUA5) RecName: Full=Endoribonuclease YSH1; EC=3.1.27... 79 1e-26
FN392320_187(FN392320|pid:none) Pichia pastoris GS115 chromosome... 91 2e-26
BT055290_1(BT055290|pid:none) Zea mays full-length cDNA clone ZM... 83 7e-26
(Q6C2Z7) RecName: Full=Endoribonuclease YSH1; EC=3.1.27... 74 6e-25
AM920427_1581(AM920427|pid:none) Penicillium chrysogenum Wiscons... 70 1e-24
CP000499_477(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 75 1e-24
CR382129_878(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 79 2e-24
AC096688_31(AC096688|pid:none) Oryza sativa chromosome 3 BAC OSJ... 77 2e-24
AE014297_2649(AE014297|pid:none) Drosophila melanogaster chromos... 76 4e-24
AL590449_89(AL590449|pid:none) chromosome X of strain GB-M1 of E... 69 1e-23
CU633865_135(CU633865|pid:none) Podospora anserina genomic DNA c... 70 1e-23
AE017344_215(AE017344|pid:none) Cryptococcus neoformans var. neo... 94 1e-23
AL590449_134(AL590449|pid:none) chromosome X of strain GB-M1 of ... 79 3e-23
AC018908_15(AC018908|pid:none) Arabidopsis thaliana chromosome 1... 73 4e-23
Z48334_2(Z48334|pid:none) Caenorhabditis elegans Cosmid F10B5, c... 74 4e-23
T20694(T20694)hypothetical protein F10B5.8 - Caenorhabditis eleg... 74 4e-23
FN357545_3(FN357545|pid:none) Schistosoma mansoni genome sequenc... 70 5e-23
BC075564_1(BC075564|pid:none) Xenopus tropicalis cleavage and po... 72 1e-22
CR761773_1(CR761773|pid:none) Xenopus tropicalis finished cDNA, ... 72 1e-22
(Q9QXK7) RecName: Full=Cleavage and polyadenylation specificity ... 72 1e-22
BC084286_1(BC084286|pid:none) Xenopus laevis hypothetical LOC495... 71 1e-22
AK149953_1(AK149953|pid:none) Mus musculus bone marrow macrophag... 71 1e-22
(Q9UKF6) RecName: Full=Cleavage and polyadenylation specificity ... 71 2e-22
AB168921_1(AB168921|pid:none) Macaca fascicularis testis cDNA, c... 71 2e-22
AK157205_1(AK157205|pid:none) Mus musculus activated spleen cDNA... 70 2e-22
AK170842_1(AK170842|pid:none) Mus musculus NOD-derived CD11c +ve... 70 2e-22
BC023297_1(BC023297|pid:none) Mus musculus cleavage and polyaden... 70 2e-22
BC100569_1(BC100569|pid:none) Mus musculus cleavage and polyaden... 70 2e-22
BT044819_1(BT044819|pid:none) Salmo salar clone ssal-rgf-504-252... 69 3e-22
BC085402_1(BC085402|pid:none) Danio rerio cleavage and polyadeny... 69 5e-22
AK167607_1(AK167607|pid:none) Mus musculus 12 days pregnant adul... 77 9e-22
(Q9CWS4) RecName: Full=Integrator complex subunit 11; S... 77 9e-22
BC011155_1(BC011155|pid:none) Mus musculus cleavage and polyaden... 77 2e-21
CR857385_1(CR857385|pid:none) Pongo abelii mRNA; cDNA DKFZp469C1... 76 4e-21
BT030671_1(BT030671|pid:none) Bos taurus cleavage and polyadenyl... 77 4e-21
(Q9BW36) RecName: Full=Integrator complex subunit 11; S... 76 4e-21
FN357366_43(FN357366|pid:none) Schistosoma mansoni genome sequen... 104 5e-21
CR926113_1(CR926113|pid:none) Pongo abelii mRNA; cDNA DKFZp459J1... 76 1e-20
(Q5BEP0) RecName: Full=Endoribonuclease ysh1; EC=3.1.27... 64 1e-20
CR861432_1(CR861432|pid:none) Pongo abelii mRNA; cDNA DKFZp459J0... 71 2e-20
(Q2YDM2) RecName: Full=Integrator complex subunit 11; S... 75 2e-20
BT058904_1(BT058904|pid:none) Salmo salar clone ssal-rgf-512-186... 79 2e-20
AB463529_1(AB463529|pid:none) Synthetic construct DNA, clone: pF... 73 4e-20
AP007151_864(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 63 1e-19
CR940348_804(CR940348|pid:none) Theileria annulata strain Ankara... 64 2e-19
(Q4PEJ3) RecName: Full=Endoribonuclease YSH1; EC=3.1.27... 70 5e-19
AP007151_1088(AP007151|pid:none) Aspergillus oryzae RIB40 genomi... 69 1e-18
AP005577_16(AP005577|pid:none) Oryza sativa Japonica Group genom... 65 2e-18
AK221561_1(AK221561|pid:none) Arabidopsis thaliana mRNA for puta... 64 4e-18
AK297350_1(AK297350|pid:none) Homo sapiens cDNA FLJ55759 complet... 66 4e-18
AC091702_11(AC091702|pid:none) Trypanosoma brucei chromosome 4 c... 68 5e-18
AY669073_1(AY669073|pid:none) Trypanosoma cruzi cleavage polyade... 66 2e-17
CP000102_271(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 59 3e-17
(Q4IPN9) RecName: Full=Endoribonuclease YSH1; EC=3.1.27... 64 4e-17
AL590445_39(AL590445|pid:none) chromosome V of strain GB-M1 of E... 88 4e-16
AL844502_181(AL844502|pid:none) Plasmodium falciparum 3D7 chromo... 65 2e-15
CP000678_1038(CP000678|pid:none) Methanobrevibacter smithii ATCC... 61 3e-15
CU928176_255(CU928176|pid:none) Zygosaccharomyces rouxii strain ... 62 4e-15
AE000666_1183(AE000666|pid:none) Methanothermobacter thermautotr... 60 6e-15
AL670236_20(AL670236|pid:none) Mouse DNA sequence from clone RP2... 54 8e-15
CP001399_1330(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 56 1e-14
CP001403_1348(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 56 1e-14
CP001400_1243(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 56 1e-14
A99225(A99225) mRNA 3'-end processing factor, probable [imported... 55 2e-14
AM910994_678(AM910994|pid:none) Plasmodium knowlesi strain H chr... 54 2e-14
CP000682_2215(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 55 7e-14
AE016820_189(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 58 2e-12
CP000852_446(CP000852|pid:none) Caldivirga maquilingensis IC-167... 63 2e-12
AP009049_2585(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 65 2e-12
AE009950_1405(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 51 3e-12
CR940352_151(CR940352|pid:none) Theileria annulata strain Ankara... 48 1e-11
CP000561_30(CP000561|pid:none) Pyrobaculum calidifontis JCM 1154... 69 1e-11
CP000968_1397(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 60 1e-11
BT053624_1(BT053624|pid:none) Medicago truncatula clone MTYFT1G-... 73 1e-11
CP000504_1094(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 69 2e-11
BA000023_380(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 58 2e-11
AE017261_687(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 51 2e-11
AM114193_794(AM114193|pid:none) Uncultured methanogenic archaeon... 66 3e-11
CP000724_759(CP000724|pid:none) Alkaliphilus metalliredigens QYM... 56 3e-11
EU016611_44(EU016611|pid:none) Uncultured Group I marine crenarc... 51 5e-11
AL139287_11(AL139287|pid:none) Human DNA sequence from clone RP5... 71 7e-11
CP000300_346(CP000300|pid:none) Methanococcoides burtonii DSM 62... 70 1e-10
AE009441_562(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 65 2e-10
BC000675_1(BC000675|pid:none) Homo sapiens cleavage and polyaden... 50 3e-10
AK021939_1(AK021939|pid:none) Homo sapiens cDNA FLJ11877 fis, cl... 48 8e-10
CP000660_64(CP000660|pid:none) Pyrobaculum arsenaticum DSM 13514... 67 1e-09
CP000493_1508(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 66 2e-09
CP000743_48(CP000743|pid:none) Methanococcus aeolicus Nankai-3, ... 66 2e-09
AY669074_1(AY669074|pid:none) Trypanosoma cruzi cleavage polyade... 50 3e-09
(Q57626) RecName: Full=Uncharacterized protein MJ0162; &C64320(... 44 5e-09
FJ228727_1(FJ228727|pid:none) Fenneropenaeus penicillatus cyclin... 65 5e-09
AM502243_17(AM502243|pid:none) Leishmania infantum chromosome 25. 49 6e-09
CP001393_1211(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 53 6e-09
CR954209_224(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 64 7e-09
BA000002_386(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 52 1e-08
CP001099_606(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 53 1e-08
AE017199_76(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, com... 63 2e-08
BX640426_304(BX640426|pid:none) Bordetella parapertussis strain ... 59 2e-08
AE008384_695(AE008384|pid:none) Methanosarcina mazei strain Goe1... 62 3e-08
AE000782_474(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304,... 62 3e-08
AE010299_3771(AE010299|pid:none) Methanosarcina acetivorans str.... 62 3e-08
CP000575_922(CP000575|pid:none) Staphylothermus marinus F1, comp... 62 5e-08
AP009179_2182(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 49 9e-08
CP000382_1410(CP000382|pid:none) Clostridium novyi NT, complete ... 47 1e-07
CP000316_1194(CP000316|pid:none) Polaromonas sp. JS666, complete... 50 1e-07
CP000505_308(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 60 1e-07
CP001393_1859(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 60 1e-07
(Q58633) RecName: Full=Uncharacterized protein MJ1236; &C64454(... 60 1e-07
AE014187_362(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 60 2e-07
CP000606_3320(CP000606|pid:none) Shewanella loihica PV-4, comple... 55 2e-07
CP000609_873(CP000609|pid:none) Methanococcus maripaludis C5, co... 59 3e-07
CP001145_147(CP001145|pid:none) Coprothermobacter proteolyticus ... 59 3e-07
CP000975_268(CP000975|pid:none) Methylacidiphilum infernorum V4,... 48 3e-07
(Q5KCZ0) RecName: Full=Endoribonuclease YSH1; EC=3.1.27... 59 4e-07
CP000931_3275(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 54 4e-07
CP000774_351(CP000774|pid:none) Parvibaculum lavamentivorans DS-... 55 4e-07
AE017226_1433(AE017226|pid:none) Treponema denticola ATCC 35405,... 58 7e-07
(Q12102) RecName: Full=Cleavage factor two protein 2; AltName: F... 57 9e-07
AE017355_1546(AE017355|pid:none) Bacillus thuringiensis serovar ... 57 1e-06
AE017225_1588(AE017225|pid:none) Bacillus anthracis str. Sterne,... 57 1e-06
CP001283_1699(CP001283|pid:none) Bacillus cereus AH820, complete... 57 1e-06
CP001338_743(CP001338|pid:none) Candidatus Methanosphaerula palu... 57 1e-06
AY811875_1(AY811875|pid:none) Schistosoma japonicum SJCHGC03746 ... 57 1e-06
CP000302_3271(CP000302|pid:none) Shewanella denitrificans OS217,... 57 1e-06
CP000745_1704(CP000745|pid:none) Methanococcus maripaludis C7, c... 57 1e-06
CP000867_187(CP000867|pid:none) Methanococcus maripaludis C6, co... 57 1e-06
BX950229_694(BX950229|pid:none) Methanococcus maripaludis strain... 57 1e-06
CP000780_1379(CP000780|pid:none) Candidatus Methanoregula boonei... 56 2e-06
CP000454_2025(CP000454|pid:none) Arthrobacter sp. FB24, complete... 56 2e-06
AE017354_2213(AE017354|pid:none) Legionella pneumophila subsp. p... 52 2e-06
CP000742_1549(CP000742|pid:none) Methanococcus vannielii SB, com... 56 2e-06
AE016877_1552(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 56 2e-06
CP000816_9(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, comp... 56 2e-06
CP000962_1152(CP000962|pid:none) Clostridium botulinum A3 str. L... 42 3e-06
CP001407_1592(CP001407|pid:none) Bacillus cereus 03BB102, comple... 55 3e-06
CP001215_2759(CP001215|pid:none) Bacillus anthracis str. CDC 684... 55 3e-06
CP000968_34(CP000968|pid:none) Candidatus Korarchaeum cryptofilu... 51 3e-06
CP001177_1701(CP001177|pid:none) Bacillus cereus AH187, complete... 55 4e-06
AM180252_284(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 55 4e-06
CR628336_2214(CR628336|pid:none) Legionella pneumophila str. Par... 50 4e-06
AY596297_1159(AY596297|pid:none) Haloarcula marismortui ATCC 430... 54 7e-06
CR628337_2192(CR628337|pid:none) Legionella pneumophila str. Len... 50 7e-06
AE016879_1600(AE016879|pid:none) Bacillus anthracis str. Ames, c... 54 9e-06
CP000511_4047(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 54 9e-06
CP000507_495(CP000507|pid:none) Shewanella amazonensis SB2B, com... 54 1e-05
CP001071_1850(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 53 2e-05
CP000616_827(CP000616|pid:none) Burkholderia vietnamiensis G4 ch... 53 2e-05
CP000442_950(CP000442|pid:none) Burkholderia ambifaria AMMD chro... 53 2e-05
CP000027_1021(CP000027|pid:none) Dehalococcoides ethenogenes 195... 53 2e-05
CP001176_1619(CP001176|pid:none) Bacillus cereus B4264, complete... 53 2e-05
CP001080_829(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 53 2e-05
CP001336_2742(CP001336|pid:none) Desulfitobacterium hafniense DC... 53 2e-05
AM422018_6(AM422018|pid:none) Candidatus Phytoplasma australiens... 53 2e-05
CP000254_816(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 53 2e-05
CP000539_1451(CP000539|pid:none) Acidovorax sp. JS42, complete g... 45 3e-05
AM180088_736(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 52 3e-05
AK023356_1(AK023356|pid:none) Homo sapiens cDNA FLJ13294 fis, cl... 52 3e-05
CP001101_778(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 52 4e-05
CP000660_1662(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 52 4e-05
CP000233_627(CP000233|pid:none) Lactobacillus salivarius UCC118,... 52 4e-05
AJ965256_867(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 52 4e-05
CP001140_1313(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 52 4e-05
CP000675_1121(CP000675|pid:none) Legionella pneumophila str. Cor... 52 5e-05
FM209186_1422(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 52 5e-05
CP000688_932(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 52 5e-05
AE004091_3614(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 52 5e-05
CP001068_1679(CP001068|pid:none) Ralstonia pickettii 12J chromos... 51 6e-05
AJ248285_113(AJ248285|pid:none) Pyrococcus abyssi complete genom... 51 6e-05
AL139287_10(AL139287|pid:none) Human DNA sequence from clone RP5... 51 6e-05
CP000744_1514(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 51 6e-05
CP000742_1397(CP000742|pid:none) Methanococcus vannielii SB, com... 51 6e-05
AL139287_9(AL139287|pid:none) Human DNA sequence from clone RP5-... 51 6e-05
CP000903_1587(CP000903|pid:none) Bacillus weihenstephanensis KBA... 51 6e-05
AE006470_593(AE006470|pid:none) Chlorobium tepidum TLS, complete... 51 6e-05
BC008041_1(BC008041|pid:none) Homo sapiens cleavage and polyaden... 51 6e-05
AL139287_12(AL139287|pid:none) Human DNA sequence from clone RP5... 51 6e-05
CP001053_1574(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 51 8e-05
CP001145_711(CP001145|pid:none) Coprothermobacter proteolyticus ... 51 8e-05
CP001339_439(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 50 1e-04
AE009948_1159(AE009948|pid:none) Streptococcus agalactiae 2603V/... 50 1e-04
CP000114_1159(CP000114|pid:none) Streptococcus agalactiae A909, ... 50 1e-04
CP001114_2464(CP001114|pid:none) Deinococcus deserti VCD115, com... 50 1e-04
AE015451_3264(AE015451|pid:none) Pseudomonas putida KT2440 compl... 50 1e-04
CP000023_1093(CP000023|pid:none) Streptococcus thermophilus LMG ... 50 1e-04
BA000004_2398(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 50 1e-04
AL766849_121(AL766849|pid:none) Streptococcus agalactiae NEM316 ... 50 1e-04
CP000419_949(CP000419|pid:none) Streptococcus thermophilus LMD-9... 50 1e-04
CP000712_2425(CP000712|pid:none) Pseudomonas putida F1, complete... 50 1e-04
CP000141_1996(CP000141|pid:none) Carboxydothermus hydrogenoforma... 50 1e-04
CP000561_1726(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 45 2e-04
CP000407_1349(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 50 2e-04
CP000447_3567(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 50 2e-04
CP000866_1723(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 50 2e-04
BC013904_1(BC013904|pid:none) Homo sapiens cleavage and polyaden... 50 2e-04
CP000681_3310(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 49 2e-04
CP000503_605(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 49 2e-04
AK298918_1(AK298918|pid:none) Homo sapiens cDNA FLJ57562 complet... 49 2e-04
AK010566_1(AK010566|pid:none) Mus musculus ES cells cDNA, RIKEN ... 49 3e-04
BA000011_663(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 49 3e-04
CP001402_1734(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 49 3e-04
AF480912_12(AF480912|pid:none) Legionella pneumophila clone pA37... 49 3e-04
AM494962_17(AM494962|pid:none) Leishmania braziliensis chromosom... 49 3e-04
CR628336_2365(CR628336|pid:none) Legionella pneumophila str. Par... 49 3e-04
(Q5SLP1) RecName: Full=Ribonuclease TTHA0252; EC=3.1.-.... 44 3e-04
CP001401_1681(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 49 4e-04
CP000252_74(CP000252|pid:none) Syntrophus aciditrophicus SB, com... 49 4e-04
CP001399_1702(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 49 4e-04
CP000853_1630(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 48 5e-04
AL445064_284(AL445064|pid:none) Thermoplasma acidophilum complet... 48 5e-04
CP000517_717(CP000517|pid:none) Lactobacillus helveticus DPC 457... 48 5e-04
CP001069_600(CP001069|pid:none) Ralstonia pickettii 12J chromoso... 48 5e-04
(Q4R5Z4) RecName: Full=Integrator complex subunit 9; Sh... 48 5e-04
CP000529_2278(CP000529|pid:none) Polaromonas naphthalenivorans C... 48 5e-04
AE017221_1727(AE017221|pid:none) Thermus thermophilus HB27, comp... 43 6e-04
BX950229_431(BX950229|pid:none) Methanococcus maripaludis strain... 48 7e-04
CP000724_2378(CP000724|pid:none) Alkaliphilus metalliredigens QY... 48 7e-04
AE017282_1061(AE017282|pid:none) Methylococcus capsulatus str. B... 37 8e-04
CP000877_32(CP000877|pid:none) Herpetosiphon aurantiacus ATCC 23... 47 9e-04
CP000575_856(CP000575|pid:none) Staphylothermus marinus F1, comp... 47 9e-04
AP009178_922(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 47 9e-04
CP000679_1133(CP000679|pid:none) Caldicellulosiruptor saccharoly... 47 9e-04
AP006878_1429(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 47 9e-04
EU016589_14(EU016589|pid:none) Uncultured Group I marine crenarc... 47 0.001
CP000469_532(CP000469|pid:none) Shewanella sp. ANA-3, complete g... 47 0.001
CP000061_98(CP000061|pid:none) Aster yellows witches'-broom phyt... 47 0.001
AP009389_1833(AP009389|pid:none) Pelotomaculum thermopropionicum... 42 0.001
CP000589_322(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 47 0.002
CP000033_794(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 47 0.002
AL445065_21(AL445065|pid:none) Thermoplasma acidophilum complete... 47 0.002
CP000153_1263(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 42 0.002
CP000090_1138(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 46 0.002
AL935258_59(AL935258|pid:none) Lactobacillus plantarum strain WC... 46 0.002
CP000573_2584(CP000573|pid:none) Burkholderia pseudomallei 1106a... 46 0.002
CP000525_1314(CP000525|pid:none) Burkholderia mallei SAVP1 chrom... 46 0.002
DQ498893_1(DQ498893|pid:none) Staphylococcus xylosus metallo-bet... 46 0.002
AM236080_1892(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 46 0.002
CP000804_3971(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 46 0.002
CP000743_1032(CP000743|pid:none) Methanococcus aeolicus Nankai-3... 46 0.002
CP001124_3930(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 46 0.003
EU686631_17(EU686631|pid:none) Uncultured marine crenarchaeote K... 46 0.003
CP000555_3484(CP000555|pid:none) Methylibium petroleiphilum PM1,... 46 0.003
AE006641_347(AE006641|pid:none) Sulfolobus solfataricus P2, comp... 46 0.003
CP001129_1179(CP001129|pid:none) Streptococcus equi subsp. zooep... 46 0.003
CP000085_460(CP000085|pid:none) Burkholderia thailandensis E264 ... 46 0.003
CP000387_1483(CP000387|pid:none) Streptococcus sanguinis SK36, c... 45 0.003
AM180355_1331(AM180355|pid:none) Clostridium difficile 630 compl... 45 0.003
CP000011_163(CP000011|pid:none) Burkholderia mallei ATCC 23344 c... 45 0.003
AP006628_635(AP006628|pid:none) Onion yellows phytoplasma OY-M D... 45 0.003
CP000923_1003(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 37 0.003
AM474208_1(AM474208|pid:none) Vitis vinifera contig VV78X212369.... 37 0.004
CP000891_3931(CP000891|pid:none) Shewanella baltica OS195, compl... 45 0.004
CP000627_2546(CP000627|pid:none) Vibrio cholerae O395 chromosome... 45 0.004
CP001014_1514(CP001014|pid:none) Thermoproteus neutrophilus V24S... 45 0.004
AE003852_261(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 45 0.004
CP000745_1418(CP000745|pid:none) Methanococcus maripaludis C7, c... 45 0.004
CP000096_579(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 45 0.004
AE005176_1618(AE005176|pid:none) Lactococcus lactis subsp. lacti... 45 0.006
CP001027_677(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch... 45 0.006
CP000425_1586(CP000425|pid:none) Lactococcus lactis subsp. cremo... 45 0.006
CU207211_1427(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 45 0.006
BC124793_1(BC124793|pid:none) Danio rerio zgc:154012, mRNA (cDNA... 45 0.006
CP000155_1450(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 45 0.006
(P47385) RecName: Full=Ribonuclease J; Short=RNase J; ... 45 0.006
BA000002_128(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 44 0.007
CP000413_1136(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 44 0.007
AE017198_833(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 44 0.007
AE014133_1311(AE014133|pid:none) Streptococcus mutans UA159, com... 44 0.007
AM946015_1083(AM946015|pid:none) Streptococcus uberis 0140J comp... 44 0.007
CP000356_2455(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 39 0.008
AE017198_849(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 44 0.010
CR378671_246(CR378671|pid:none) Photobacterium profundum SS9; se... 44 0.010
CP001616_2445(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 44 0.010
CP001097_1761(CP001097|pid:none) Chlorobium limicola DSM 245, co... 44 0.010
AE015450_20(AE015450|pid:none) Mycoplasma gallisepticum strain R... 44 0.010
CP000408_1491(CP000408|pid:none) Streptococcus suis 98HAH33, com... 44 0.010
EU016616_6(EU016616|pid:none) Uncultured Group I marine crenarch... 44 0.010
CP000312_1709(CP000312|pid:none) Clostridium perfringens SM101, ... 44 0.010
AE017340_1535(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 44 0.010
BA000016_1775(BA000016|pid:none) Clostridium perfringens str. 13... 44 0.010
BA000037_372(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr... 44 0.010
CP000817_247(CP000817|pid:none) Lysinibacillus sphaericus C3-41,... 44 0.010
(P75497) RecName: Full=Ribonuclease J; Short=RNase J; ... 44 0.010
AM263198_265(AM263198|pid:none) Listeria welshimeri serovar 6b s... 44 0.013
CP000413_1122(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 44 0.013
EU016606_27(EU016606|pid:none) Uncultured Group I marine crenarc... 44 0.013
CP001581_1149(CP001581|pid:none) Clostridium botulinum A2 str. K... 44 0.013
CP000939_1102(CP000939|pid:none) Clostridium botulinum B1 str. O... 44 0.013
FM178379_265(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 44 0.013
CP000251_94(CP000251|pid:none) Anaeromyxobacter dehalogenans 2CP... 43 0.017
CP000033_780(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 43 0.017
CP000721_4053(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 43 0.017
CP000248_1593(CP000248|pid:none) Novosphingobium aromaticivorans... 43 0.017
CP000112_1777(CP000112|pid:none) Desulfovibrio desulfuricans G20... 43 0.017
CP000495_117(CP000495|pid:none) Bradyrhizobium sp. BTAi1, comple... 37 0.021
AE017263_92(AE017263|pid:none) Mesoplasma florum L1 complete gen... 43 0.022
CP000123_241(CP000123|pid:none) Mycoplasma capricolum subsp. cap... 43 0.022
CP001132_2243(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 43 0.022
CP001358_2009(CP001358|pid:none) Desulfovibrio desulfuricans sub... 43 0.022
CP000728_1082(CP000728|pid:none) Clostridium botulinum F str. La... 42 0.028
CP001083_2677(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 42 0.028
CP001332_166(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 42 0.028
CP000353_897(CP000353|pid:none) Ralstonia metallidurans CH34 meg... 42 0.028
CP000962_2542(CP000962|pid:none) Clostridium botulinum A3 str. L... 42 0.028
CP000896_802(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 42 0.028
CP000923_1457(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 42 0.028
AE015927_851(AE015927|pid:none) Clostridium tetani E88, complete... 42 0.028
CP001348_1735(CP001348|pid:none) Clostridium cellulolyticum H10,... 42 0.028
AL954747_25(AL954747|pid:none) Nitrosomonas europaea ATCC 19718,... 42 0.028
CP000473_2804(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 42 0.028
CP000423_1245(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 42 0.037
AP008937_616(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 42 0.037
AE009439_1227(AE009439|pid:none) Methanopyrus kandleri AV19, com... 42 0.037
CP000680_1274(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 42 0.037
CP001129_1343(CP001129|pid:none) Streptococcus equi subsp. zooep... 42 0.037
CP000568_604(CP000568|pid:none) Clostridium thermocellum ATCC 27... 42 0.037
DQ915177_48(DQ915177|pid:none) Vibrio cholerae strain NRT36S cap... 42 0.037
FM204883_1495(FM204883|pid:none) Streptococcus equi subsp. equi ... 42 0.037
BX293980_637(BX293980|pid:none) Mycoplasma mycoides subsp. mycoi... 42 0.037
FM204884_586(FM204884|pid:none) Streptococcus equi subsp. zooepi... 42 0.037
CP001392_2526(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 42 0.037
CP000001_4683(CP000001|pid:none) Bacillus cereus E33L, complete ... 42 0.037
CP000721_2232(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 42 0.048
CP000539_3094(CP000539|pid:none) Acidovorax sp. JS42, complete g... 42 0.048
CP000304_1488(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 42 0.048
CP000360_3885(CP000360|pid:none) Acidobacteria bacterium Ellin34... 42 0.048
CP000352_1265(CP000352|pid:none) Ralstonia metallidurans CH34, c... 42 0.048
AE014184_615(AE014184|pid:none) Tropheryma whipplei str. Twist, ... 42 0.048
AK077634_1(AK077634|pid:none) Mus musculus 8 days embryo whole b... 42 0.048
CP001083_1264(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 42 0.048
CP000123_591(CP000123|pid:none) Mycoplasma capricolum subsp. cap... 42 0.048
CP000505_1551(CP000505|pid:none) Thermofilum pendens Hrk 5, comp... 42 0.048
(Q8K114) RecName: Full=Integrator complex subunit 9; Sh... 42 0.048
CP000557_1119(CP000557|pid:none) Geobacillus thermodenitrificans... 42 0.048
CP001089_3381(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 41 0.063
AK298468_1(AK298468|pid:none) Homo sapiens cDNA FLJ51926 complet... 41 0.063
CP000024_1087(CP000024|pid:none) Streptococcus thermophilus CNRZ... 41 0.063
CP000930_2427(CP000930|pid:none) Heliobacterium modesticaldum Ic... 41 0.063
AE004092_380(AE004092|pid:none) Streptococcus pyogenes M1 GAS, c... 41 0.063
AP006628_631(AP006628|pid:none) Onion yellows phytoplasma OY-M D... 41 0.063
CP000003_471(CP000003|pid:none) Streptococcus pyogenes MGAS10394... 41 0.063
(Q9NV88) RecName: Full=Integrator complex subunit 9; Sh... 41 0.063
AP009484_868(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 41 0.063
CP000517_704(CP000517|pid:none) Lactobacillus helveticus DPC 457... 41 0.063
AJ012051_3(AJ012051|pid:none) Streptococcus pyogenes vic operon ... 41 0.063
AE017194_1723(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 41 0.082
CP000020_150(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 41 0.082
CP001390_3760(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 41 0.082
CP000726_2393(CP000726|pid:none) Clostridium botulinum A str. AT... 41 0.082
AM412317_2563(AM412317|pid:none) Clostridium botulinum A str. AT... 41 0.082
CP001281_1241(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 41 0.082
CP000109_24(CP000109|pid:none) Thiomicrospira crunogena XCL-2, c... 41 0.082
CP001139_145(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 41 0.082
AE005176_395(AE005176|pid:none) Lactococcus lactis subsp. lactis... 41 0.082
CP001392_1275(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 41 0.082
CP000860_1359(CP000860|pid:none) Candidatus Desulforudis audaxvi... 41 0.082
AE017285_1524(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 40 0.11
CP000909_963(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 40 0.11
CP001184_608(CP001184|pid:none) Ureaplasma urealyticum serovar 1... 40 0.11
AP008937_1549(AP008937|pid:none) Lactobacillus fermentum IFO 395... 40 0.11
CP000382_1375(CP000382|pid:none) Clostridium novyi NT, complete ... 40 0.11
CP000968_1341(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 40 0.11
CP000728_2487(CP000728|pid:none) Clostridium botulinum F str. La... 40 0.11
CP000416_1312(CP000416|pid:none) Lactobacillus brevis ATCC 367, ... 40 0.11
AE017194_5106(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 40 0.11
CP000922_1657(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 40 0.11
AE014133_1373(AE014133|pid:none) Streptococcus mutans UA159, com... 40 0.11
CP000083_2068(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 40 0.11
CP000851_1413(CP000851|pid:none) Shewanella pealeana ATCC 700345... 40 0.14
CP000875_4396(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 40 0.14
CP000227_4694(CP000227|pid:none) Bacillus cereus Q1, complete ge... 40 0.14
CP000485_4312(CP000485|pid:none) Bacillus thuringiensis str. Al ... 40 0.14
AE016879_4852(AE016879|pid:none) Bacillus anthracis str. Ames, c... 40 0.14
CP001032_552(CP001032|pid:none) Opitutus terrae PB90-1, complete... 40 0.14
AJ937770_20(AJ937770|pid:none) Uncultured gamma proteobacterium ... 40 0.14
AP008934_1211(AP008934|pid:none) Staphylococcus saprophyticus su... 40 0.14
AY372049_3(AY372049|pid:none) Lactobacillus johnsonii strain NCC... 40 0.14
CP000494_2875(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 40 0.14
CP001358_851(CP001358|pid:none) Desulfovibrio desulfuricans subs... 40 0.14
CP000505_445(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 40 0.14
AP006627_2205(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 40 0.18
AL766846_205(AL766846|pid:none) Streptococcus agalactiae NEM316 ... 40 0.18
CP001176_1540(CP001176|pid:none) Bacillus cereus B4264, complete... 40 0.18
CP001336_3466(CP001336|pid:none) Desulfitobacterium hafniense DC... 40 0.18
AK304525_1(AK304525|pid:none) Homo sapiens cDNA FLJ52404 complet... 40 0.18
CP001337_2367(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 40 0.18
CP000764_1278(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 40 0.18
CP001104_738(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 40 0.18
AE009948_700(AE009948|pid:none) Streptococcus agalactiae 2603V/R... 40 0.18
AM180252_560(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 40 0.18
AP009510_713(AP009510|pid:none) Uncultured Termite group 1 bacte... 40 0.18
CP000853_2739(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 40 0.18
CP000568_1292(CP000568|pid:none) Clostridium thermocellum ATCC 2... 40 0.18
CP000061_101(CP000061|pid:none) Aster yellows witches'-broom phy... 40 0.18
CP001189_1650(CP001189|pid:none) Gluconacetobacter diazotrophicu... 39 0.24
CP001177_1614(CP001177|pid:none) Bacillus cereus AH187, complete... 39 0.24
AE016879_1515(AE016879|pid:none) Bacillus anthracis str. Ames, c... 39 0.24
CP001407_1511(CP001407|pid:none) Bacillus cereus 03BB102, comple... 39 0.24
CP000655_1354(CP000655|pid:none) Polynucleobacter necessarius su... 39 0.24
AM778957_209(AM778957|pid:none) Microcystis aeruginosa PCC 7806 ... 39 0.24
CP000939_1291(CP000939|pid:none) Clostridium botulinum B1 str. O... 39 0.24
CP001186_1503(CP001186|pid:none) Bacillus cereus G9842, complete... 39 0.24
CP001283_1618(CP001283|pid:none) Bacillus cereus AH820, complete... 39 0.24
EU518648_1(EU518648|pid:none) Chlamydomonas reinhardtii chloropl... 39 0.24
AE017355_1466(AE017355|pid:none) Bacillus thuringiensis serovar ... 39 0.24
EU518649_1(EU518649|pid:none) Chlamydomonas reinhardtii chloropl... 39 0.24
AM412317_1288(AM412317|pid:none) Clostridium botulinum A str. AT... 39 0.24
CR378679_160(CR378679|pid:none) Photobacterium profundum SS9 chr... 39 0.24
CP001215_2860(CP001215|pid:none) Bacillus anthracis str. CDC 684... 39 0.24
BA000045_1019(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 39 0.24
CP000866_1535(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 39 0.24
CP000769_96(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, com... 39 0.31
CP000227_1054(CP000227|pid:none) Bacillus cereus Q1, complete ge... 39 0.31
CP000487_1708(CP000487|pid:none) Campylobacter fetus subsp. fetu... 39 0.31
CU469464_210(CU469464|pid:none) Candidatus Phytoplasma mali stra... 39 0.31
CP001022_2498(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 39 0.31
(O31760) RecName: Full=Ribonuclease J 2; Short=RNase J2... 39 0.31
CP000885_2264(CP000885|pid:none) Clostridium phytofermentans ISD... 39 0.31
CP001013_2475(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 39 0.31
AE016830_2557(AE016830|pid:none) Enterococcus faecalis V583, com... 39 0.31
CP000859_1396(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 39 0.31
CP000919_534(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 39 0.41
CP001096_4555(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 39 0.41
CP000142_716(CP000142|pid:none) Pelobacter carbinolicus DSM 2380... 39 0.41
CP000920_576(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 39 0.41
AP008230_2376(AP008230|pid:none) Desulfitobacterium hafniense Y5... 39 0.41
AM422018_11(AM422018|pid:none) Candidatus Phytoplasma australien... 39 0.41
CP001157_3726(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 39 0.41
CP000527_2098(CP000527|pid:none) Desulfovibrio vulgaris subsp. v... 39 0.41
CP000448_2373(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 39 0.41
BA000011_437(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 39 0.41
AM778957_149(AM778957|pid:none) Microcystis aeruginosa PCC 7806 ... 39 0.41
CP001601_1508(CP001601|pid:none) Corynebacterium aurimucosum ATC... 39 0.41
CP001056_1812(CP001056|pid:none) Clostridium botulinum B str. Ek... 39 0.41
AE005672_581(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 39 0.41
CU466930_262(CU466930|pid:none) Candidatus Cloacamonas acidamino... 39 0.41
CP000412_637(CP000412|pid:none) Lactobacillus delbrueckii subsp.... 39 0.41
AE017355_2165(AE017355|pid:none) Bacillus thuringiensis serovar ... 38 0.53
CP000806_294(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 38 0.53
BA000043_1278(BA000043|pid:none) Geobacillus kaustophilus HTA426... 38 0.53
CP000413_63(CP000413|pid:none) Lactobacillus gasseri ATCC 33323,... 38 0.53
CP001095_1964(CP001095|pid:none) Bifidobacterium longum subsp. i... 38 0.53
CP001186_2208(CP001186|pid:none) Bacillus cereus G9842, complete... 38 0.53
CP000605_950(CP000605|pid:none) Bifidobacterium longum DJO10A, c... 38 0.53
CP001197_2901(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 38 0.53
FM954972_570(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 38 0.53
AL009126_1056(AL009126|pid:none) Bacillus subtilis subsp. subtil... 38 0.53
AP007281_626(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 38 0.53
AE017125_1173(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 38 0.53
AE014295_833(AE014295|pid:none) Bifidobacterium longum NCC2705, ... 38 0.53
AP007281_1425(AP007281|pid:none) Lactobacillus reuteri JCM 1112 ... 38 0.53
CP000852_1951(CP000852|pid:none) Caldivirga maquilingensis IC-16... 38 0.53
CP000089_989(CP000089|pid:none) Dechloromonas aromatica RCB, com... 38 0.53
CP000679_1083(CP000679|pid:none) Caldicellulosiruptor saccharoly... 38 0.53
CP000922_2242(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 38 0.53
CP000142_719(CP000142|pid:none) Pelobacter carbinolicus DSM 2380... 38 0.70
CP001078_2013(CP001078|pid:none) Clostridium botulinum E3 str. A... 38 0.70
CP000557_3361(CP000557|pid:none) Geobacillus thermodenitrificans... 38 0.70
AE016958_2863(AE016958|pid:none) Mycobacterium avium subsp. para... 38 0.70
CP001359_111(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C... 38 0.70
CP000859_2578(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 38 0.70
BX294148_208(BX294148|pid:none) Rhodopirellula baltica SH 1 comp... 38 0.70
AM746676_378(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ... 38 0.70
CP001403_805(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,... 38 0.70
BA000004_2662(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 38 0.70
CP000412_102(CP000412|pid:none) Lactobacillus delbrueckii subsp.... 38 0.70
CP000557_908(CP000557|pid:none) Geobacillus thermodenitrificans ... 37 0.91
CP001037_781(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 37 0.91
(Q54X24) RecName: Full=RCC1 domain-containing protein DDB_G02792... 37 0.91
CP000939_443(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 37 0.91
AE016877_4763(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 37 0.91
CP000453_485(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 37 0.91
BX248358_92(BX248358|pid:none) Corynebacterium diphtheriae gravi... 37 0.91
CP000140_1658(CP000140|pid:none) Parabacteroides distasonis ATCC... 37 0.91
CP000267_1930(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 37 0.91
AP006716_1371(AP006716|pid:none) Staphylococcus haemolyticus JCS... 37 0.91
S52353(S52353) dglB protein - Staphylococcus xylosus (fragment) ... 37 0.91
BA000043_667(BA000043|pid:none) Geobacillus kaustophilus HTA426 ... 37 0.91
>(Q9P2I0) RecName: Full=Cleavage and polyadenylation specificity
factor subunit 2; AltName: Full=Cleavage and
polyadenylation specificity factor 100 kDa subunit;
Short=CPSF 100 kDa subunit;
&AK001627_1(AK001627|pid:none)
Length = 782
Score = 201 bits (512), Expect(2) = 7e-83
Identities = 98/191 (51%), Positives = 131/191 (68%), Gaps = 1/191 (0%)
Frame = +3
Query: 15 MASIIKFTALSGAKDESPPCYLLEIDDFCILLDCGLSYNLDFSLLEPLEKVAKKIDAVLL 194
M SIIK T LSG ++ES CYLL++D+F LLDCG + +++ L K +IDAVLL
Sbjct: 1 MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL 60
Query: 195 SHSDTTHIGGLPYVVGKYGLTGTIYGTTPVLKMGTMFLYDLYENKMSQEEFQQYSLDNID 374
SH D H+G LPY VGK GL IY T PV KMG MF+YDLY+++ + E+F ++LD++D
Sbjct: 61 SHPDPLHLGALPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVD 120
Query: 375 SCFGEDRFKELSFSQHYSLSGKGKGISITPYLAGHTIGASVWKITK-GTYSIVYAIDYNH 551
+ F D+ ++L FSQ +L GKG G+SITP AGH IG ++WKI K G IVYA+D+NH
Sbjct: 121 AAF--DKIQQLKFSQIVNLKGKGHGLSITPLPAGHMIGGTIWKIVKDGEEEIVYAVDFNH 178
Query: 552 RNEGHLDSLQL 584
+ E HL+ L
Sbjct: 179 KREIHLNGCSL 189
Score = 130 bits (327), Expect(2) = 7e-83
Identities = 71/157 (45%), Positives = 96/157 (61%), Gaps = 1/157 (0%)
Frame = +1
Query: 610 LLITDSKGVDKTLAFKKTITRDQSLFEQINRNLRDGGNVLIPVDTAGRVLELLLCIENYW 789
LLITDS + T + RD+ L + LR GNVLI VDTAGRVLEL ++ W
Sbjct: 197 LLITDS--FNATYVQPRRKQRDEQLLTNVLETLRGDGNVLIAVDTAGRVLELAQLLDQIW 254
Query: 790 -SKNKSLALYSVVFLGRFSFSVCQFARSQLEFMSSTASVKFEQNIENPFSFKHIKILSSL 966
+K+ L +YS+ L S++V +F++SQ+E+MS FE NPF F+H+ + L
Sbjct: 255 RTKDAGLGVYSLALLNNVSYNVVEFSKSQVEWMSDKLMRCFEDKRNNPFQFRHLSLCHGL 314
Query: 967 EELQELPDTNKVILTSSQDLETGFSRELFIQWCSDPK 1077
+L +P + KV+L S DLE GFSR+LFIQWC DPK
Sbjct: 315 SDLARVP-SPKVVLASQPDLECGFSRDLFIQWCQDPK 350
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,726,432,049
Number of extensions: 34739082
Number of successful extensions: 95727
Number of sequences better than 10.0: 665
Number of HSP's gapped: 95146
Number of HSP's successfully gapped: 836
Length of query: 360
Length of database: 1,040,966,779
Length adjustment: 130
Effective length of query: 230
Effective length of database: 624,409,729
Effective search space: 143614237670
Effective search space used: 143614237670
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|