Contig-U08272-1
Contig ID Contig-U08272-1
Contig update 2002. 9.13
Contig sequence
>Contig-U08272-1 (Contig-U08272-1Q) /CSM_Contig/Contig-U08272-1Q.Seq.d
NNNNNNNNNNGAAGATGATGAAATTGGGAAATCAATTAAACATATTAATG
AAATTAATAAACAAATGAAATCATTCGATCTTGGTAGTAAACAAATTACA
AATGGTGGTAGAAGAATTAATAAATTAGTTACAATCTTTGAAAAAGAGAG
TAGAGAAGAGATTGAAAAGAGAAAAGAGCAAAGTAAGAAACCATTGAATA
CGATACTACGTGATGAGCCATGGCTAATAATGAGGGAATATGATAGAATC
AATCAAGGTACGTCGGTGTCTGGTGGCAACTATATTGATATACCAAAGAG
ACCACATTGGAGCTACAATATGTCTGGCGACAGGTTGAAAGAAGAGGAAA
GAATTATGTTCTCACGTTGGTTGGAGAATATCGTTATAAAATACGACAAA
AGTAGATTAAACTACTTTGAACATAATTTAGAGGTTTGGAGACAGCTTTG
GAGGGTTTCAGAGAGATCAGATGTAATTCTACTAGTAACCGATGCCAGAT
ACCCTTTATTCCATTTCCCACCATCTCTCTATAACTACATCAATGTAGAT
CTCAAGAAACCAATGATCTTAATCTTAAACAAGA

Gap no gap
Contig length 584
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 3189535
End point 3189048
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 1
Link to clone list U08272
List of clone(s)

est1=CFJ248Z,1,575
Translated Amino Acid sequence
XXXEDDEIGKSIKHINEINKQMKSFDLGSKQITNGGRRINKLVTIFEKESREEIEKRKEQ
SKKPLNTILRDEPWLIMREYDRINQGTSVSGGNYIDIPKRPHWSYNMSGDRLKEEERIMF
SRWLENIVIKYDKSRLNYFEHNLEVWRQLWRVSERSDVILLVTDARYPLFHFPPSLYNYI
NVDLKKPMILILNK


Translated Amino Acid sequence (All Frames)
Frame A:
xxxxr**nwein*ty**n**tneiirsw**tnykww*kn**isynl*kre*rrd*kekra
k*etieydtt**amannegi**nqsryvgvwwqly*ytkettlelqyvwrqverrgknyv
ltlvgeyrykirqk*ikll*t*frgletalegfreircnstsnrcqipfipfptisl*lh
qcrsqetndlnlkq


Frame B:
XXXEDDEIGKSIKHINEINKQMKSFDLGSKQITNGGRRINKLVTIFEKESREEIEKRKEQ
SKKPLNTILRDEPWLIMREYDRINQGTSVSGGNYIDIPKRPHWSYNMSGDRLKEEERIMF
SRWLENIVIKYDKSRLNYFEHNLEVWRQLWRVSERSDVILLVTDARYPLFHFPPSLYNYI
NVDLKKPMILILNK


Frame C:
xxxkmmklgnqlnilmklink*nhsilvvnklqmvveelin*lqslkkrvekrlkreksk
vrnh*iryyvmshg***gnmiesikvrrclvatiliyqrdhigaticlatg*kkrkelcs
hvgwrisl*nttkvd*ttlnii*rfgdsfggfqrdqm*fy**pmpdtlysishhlsitts
m*isrnq*s*s*tr


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U08272-1 (Contig-U08272-1Q)
/CSM_Contig/Contig-U08272-1Q.Seq.d
(584 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U08272-1 (Contig-U08272-1Q) /CSM_Contig/Conti... 781 0.0
Contig-U12096-1 (Contig-U12096-1Q) /CSM_Contig/Conti... 40 0.003
Contig-U11167-1 (Contig-U11167-1Q) /CSM_Contig/Conti... 38 0.010
Contig-U05079-1 (Contig-U05079-1Q) /CSM_Contig/Conti... 36 0.041
Contig-U04770-1 (Contig-U04770-1Q) /CSM_Contig/Conti... 36 0.041
Contig-U14764-1 (Contig-U14764-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U14596-1 (Contig-U14596-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U13914-1 (Contig-U13914-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U12361-1 (Contig-U12361-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U11911-1 (Contig-U11911-1Q) /CSM_Contig/Conti... 34 0.16

>Contig-U08272-1 (Contig-U08272-1Q) /CSM_Contig/Contig-U08272-1Q.Seq.d
Length = 584

Score = 781 bits (394), Expect = 0.0
Identities = 394/394 (100%)
Strand = Plus / Plus


Query: 191 ccattgaatacgatactacgtgatgagccatggctaataatgagggaatatgatagaatc 250
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 191 ccattgaatacgatactacgtgatgagccatggctaataatgagggaatatgatagaatc 250


Query: 251 aatcaaggtacgtcggtgtctggtggcaactatattgatataccaaagagaccacattgg 310
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 251 aatcaaggtacgtcggtgtctggtggcaactatattgatataccaaagagaccacattgg 310


Query: 311 agctacaatatgtctggcgacaggttgaaagaagaggaaagaattatgttctcacgttgg 370
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 311 agctacaatatgtctggcgacaggttgaaagaagaggaaagaattatgttctcacgttgg 370


Query: 371 ttggagaatatcgttataaaatacgacaaaagtagattaaactactttgaacataattta 430
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 371 ttggagaatatcgttataaaatacgacaaaagtagattaaactactttgaacataattta 430


Query: 431 gaggtttggagacagctttggagggtttcagagagatcagatgtaattctactagtaacc 490
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 431 gaggtttggagacagctttggagggtttcagagagatcagatgtaattctactagtaacc 490


Query: 491 gatgccagataccctttattccatttcccaccatctctctataactacatcaatgtagat 550
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 491 gatgccagataccctttattccatttcccaccatctctctataactacatcaatgtagat 550


Query: 551 ctcaagaaaccaatgatcttaatcttaaacaaga 584
||||||||||||||||||||||||||||||||||
Sbjct: 551 ctcaagaaaccaatgatcttaatcttaaacaaga 584


Score = 252 bits (127), Expect = 4e-67
Identities = 127/127 (100%)
Strand = Plus / Plus


Query: 11 gaagatgatgaaattgggaaatcaattaaacatattaatgaaattaataaacaaatgaaa 70
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 11 gaagatgatgaaattgggaaatcaattaaacatattaatgaaattaataaacaaatgaaa 70


Query: 71 tcattcgatcttggtagtaaacaaattacaaatggtggtagaagaattaataaattagtt 130
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 71 tcattcgatcttggtagtaaacaaattacaaatggtggtagaagaattaataaattagtt 130


Query: 131 acaatct 137
|||||||
Sbjct: 131 acaatct 137


>Contig-U12096-1 (Contig-U12096-1Q) /CSM_Contig/Contig-U12096-1Q.Seq.d
Length = 2308

Score = 40.1 bits (20), Expect = 0.003
Identities = 20/20 (100%)
Strand = Plus / Minus


Query: 282 atattgatataccaaagaga 301
||||||||||||||||||||
Sbjct: 1892 atattgatataccaaagaga 1873


>Contig-U11167-1 (Contig-U11167-1Q) /CSM_Contig/Contig-U11167-1Q.Seq.d
Length = 1744

Score = 38.2 bits (19), Expect = 0.010
Identities = 22/23 (95%)
Strand = Plus / Minus


Query: 39 aacatattaatgaaattaataaa 61
|||||||||||||| ||||||||
Sbjct: 833 aacatattaatgaatttaataaa 811


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 6338
Number of Sequences: 6905
Number of extensions: 6338
Number of successful extensions: 778
Number of sequences better than 10.0: 230
length of query: 584
length of database: 5,674,871
effective HSP length: 16
effective length of query: 568
effective length of database: 5,564,391
effective search space: 3160574088
effective search space used: 3160574088
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11.12
Homology vs DNA
Query= Contig-U08272-1 (Contig-U08272-1Q) /CSM_Contig/Contig-U08272-1Q.Seq.d
(584 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ375645) Dictyostelium discoideum cDNA clone:ddc19o12, 3' ... 781 0.0 2
(BX323988) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 56 0.001 1
(CP000848) Rickettsia rickettsii str. 'Sheila Smith', comple... 50 0.090 1
(CP000847) Rickettsia akari str. Hartford, complete genome. 50 0.090 1
(CP000766) Rickettsia rickettsii str. Iowa, complete genome. 50 0.090 1
(AJ235271) Rickettsia prowazekii strain Madrid E, complete g... 50 0.090 1
(AE008600) Rickettsia conorii str. Malish 7, section 32 of 1... 50 0.090 1
(BH762774) BMBAC330H11SP6_PSU Brugia malayi Genomic Bac Libr... 48 0.35 1
(CP000409) Rickettsia canadensis str. McKiel, complete genome. 48 0.35 1
(AC102715) Mus musculus clone RP24-491A14, WORKING DRAFT SEQ... 42 0.47 2
(AL954341) Mouse DNA sequence from clone RP23-213D14 on chro... 42 0.51 2
(CT009705) Zebrafish DNA sequence from clone DKEYP-81C5 in l... 46 1.4 1
(BX664743) Zebrafish DNA sequence from clone DKEY-11D20 in l... 46 1.4 1
(BX649497) Zebrafish DNA sequence from clone DKEYP-15A6 in l... 46 1.4 1
(BX088583) Zebrafish DNA sequence from clone CH211-211K8 in ... 46 1.4 1
(BX004879) Zebrafish DNA sequence from clone CH211-157L7 in ... 46 1.4 1
(AC187667) Microcebus murinus clone CH257-93L7, WORKING DRAF... 46 1.4 1
(ED800523) MG__Ba0083F10f MG__Ba Mimulus guttatus genomic, g... 46 1.4 1
(DW249216) Cm_mx1_19h05_SP6 Green Shore Crab Multiple Tissue... 46 1.4 1
(DV642991) Cm_mx1_01c04_SP6 Green Shore Crab Multiple Tissue... 46 1.4 1
(FF555604) MOPFP82TF MOP Vigna unguiculata cDNA 5', mRNA seq... 46 1.4 1
(FF548199) MOPFP82TR MOP Vigna unguiculata cDNA 3', mRNA seq... 46 1.4 1
(CP000683) Rickettsia massiliae MTU5, complete genome. 46 1.4 1
(CP000053) Rickettsia felis URRWXCal2, complete genome. 46 1.4 1
(AE017197) Rickettsia typhi str. Wilmington complete genome. 46 1.4 1
(ER385941) 1094424012480 Global-Ocean-Sampling_GS-34-01-01-1... 32 3.6 2
(BX649505) Zebrafish DNA sequence from clone CH211-113M13 in... 44 5.5 1
(AC158129) Mus musculus chromosome 15, clone RP24-359B13, co... 44 5.5 1
(AC101713) Mus musculus chromosome 15, clone RP23-282L9, com... 44 5.5 1
(AM438694) Vitis vinifera contig VV78X131380.8, whole genome... 44 5.5 1
(CQ584682) Sequence 12440 from Patent WO0171042. 44 5.5 1
(AR511849) Sequence 16809 from patent US 6703491. 44 5.5 1
(AR496567) Sequence 1527 from patent US 6703491. 44 5.5 1
(EU254621) Plasmodium sp. circ caseinolytic protease C (clpc... 44 5.5 1
(BT021336) Drosophila melanogaster RE01856 full insert cDNA. 44 5.5 1
(AY118381) Drosophila melanogaster RE26705 full insert cDNA. 44 5.5 1
(AJ235250) Ceratosolen stupefactus mitochondrial cytb gene, ... 44 5.5 1
(AC190477) Trichinella spiralis BAC clone TS195-7H12 from ch... 44 5.5 1
(AC079385) Homo sapiens 12q BAC RP11-482D24 (Roswell Park Ca... 44 5.5 1
(AC206069) Equus caballus clone CH241-56M3, WORKING DRAFT SE... 44 5.5 1
(AC202826) Gossypium hirsutum chromosome UNKNOWN clone ZMMBB... 44 5.5 1
(AC184318) Strongylocentrotus purpuratus clone R3-4005F4, WO... 44 5.5 1
(AC181341) Strongylocentrotus purpuratus clone R3-40C5, WORK... 44 5.5 1
(AC181299) Strongylocentrotus purpuratus clone R3-115H9, WOR... 44 5.5 1
(AC180391) Strongylocentrotus purpuratus clone R3-3106C19, W... 44 5.5 1
(AC179044) Strongylocentrotus purpuratus clone R3-4005D21, W... 44 5.5 1
(AC178353) Strongylocentrotus purpuratus clone R3-1114F12, W... 44 5.5 1
(AC176043) Strongylocentrotus purpuratus clone R3-18J7, WORK... 44 5.5 1
(AC167472) Bos taurus clone CH240-190C17, WORKING DRAFT SEQU... 44 5.5 1
(AC016253) Homo sapiens chromosome 12 clone RP11-115E9, WORK... 44 5.5 1
(AC006294) Homo sapiens chromosome 4, *** SEQUENCING IN PROG... 44 5.5 1
(FH705633) CHO_OF5172xn03r1.ab1 CHO_OF5 Nicotiana tabacum ge... 44 5.5 1
(FH705555) CHO_OF5172xn03f1.ab1 CHO_OF5 Nicotiana tabacum ge... 44 5.5 1
(FH049231) CHO_OF3319xe04f1.ab1 CHO_OF3 Nicotiana tabacum ge... 44 5.5 1
(ER739480) SB_BBc89-N21.R SB_BBc Sorghum bicolor genomic 3',... 44 5.5 1
(EK379442) 1095469454532 Global-Ocean-Sampling_GS-31-01-01-1... 44 5.5 1
(EJ233197) 1092404041009 Global-Ocean-Sampling_GS-27-01-01-1... 44 5.5 1
(EI361724) GM_WBc0115H06.r GM_WBc Glycine max genomic clone ... 44 5.5 1
(ED710640) GM_WBb0057J16.f GM_WBb Glycine max genomic clone ... 44 5.5 1
(ED071512) AUAC-aap36c11.b1 Ascaris suum whole genome shotgu... 44 5.5 1
(DX512488) 762_2_14169808_5489_43589_019 Arachis duranensis ... 44 5.5 1
(BZ075977) lkg93c08.g1 B.oleracea002 Brassica oleracea genom... 44 5.5 1
(BZ075918) lkg93c08.b1 B.oleracea002 Brassica oleracea genom... 44 5.5 1
(BH948104) obv16d11.b1 B.oleracea002 Brassica oleracea genom... 44 5.5 1
(EC245519) 218527 CK01 Drosophila melanogaster cDNA clone 46... 44 5.5 1
(EC236198) 330781 CK01 Drosophila melanogaster cDNA clone 80... 44 5.5 1
(CO283968) EK164923.5prime Exelixis FlyTag CK01 pCDNA-SK+ Dr... 44 5.5 1
(BQ120881) EST606457 mixed potato tissues Solanum tuberosum ... 44 5.5 1
(BI162571) RE01856.3prime RE Drosophila melanogaster normali... 44 5.5 1
(BG590507) EST498349 P. infestans-challenged leaf Solanum tu... 44 5.5 1
(AC218054) Peromyscus maniculatus rufinus clone CH233-1M7, W... 42 6.8 2
(AC164446) Bos taurus clone CH240-153P14, *** SEQUENCING IN ... 38 7.3 2
(AM461724) Vitis vinifera, whole genome shotgun sequence, co... 40 7.3 2
(EI000285) MUGQ_CH252P170K11Sp6_CN218_038 CHORI-252 Vervet M... 36 9.3 2

>(BJ375645) Dictyostelium discoideum cDNA clone:ddc19o12, 3' end,
single read.
Length = 575

Score = 781 bits (394), Expect(2) = 0.0
Identities = 394/394 (100%)
Strand = Plus / Minus


Query: 191 ccattgaatacgatactacgtgatgagccatggctaataatgagggaatatgatagaatc 250
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 395 ccattgaatacgatactacgtgatgagccatggctaataatgagggaatatgatagaatc 336


Query: 251 aatcaaggtacgtcggtgtctggtggcaactatattgatataccaaagagaccacattgg 310
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 335 aatcaaggtacgtcggtgtctggtggcaactatattgatataccaaagagaccacattgg 276


Query: 311 agctacaatatgtctggcgacaggttgaaagaagaggaaagaattatgttctcacgttgg 370
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 275 agctacaatatgtctggcgacaggttgaaagaagaggaaagaattatgttctcacgttgg 216


Query: 371 ttggagaatatcgttataaaatacgacaaaagtagattaaactactttgaacataattta 430
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 215 ttggagaatatcgttataaaatacgacaaaagtagattaaactactttgaacataattta 156


Query: 431 gaggtttggagacagctttggagggtttcagagagatcagatgtaattctactagtaacc 490
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 155 gaggtttggagacagctttggagggtttcagagagatcagatgtaattctactagtaacc 96


Query: 491 gatgccagataccctttattccatttcccaccatctctctataactacatcaatgtagat 550
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 95 gatgccagataccctttattccatttcccaccatctctctataactacatcaatgtagat 36


Query: 551 ctcaagaaaccaatgatcttaatcttaaacaaga 584
||||||||||||||||||||||||||||||||||
Sbjct: 35 ctcaagaaaccaatgatcttaatcttaaacaaga 2

Score = 254 bits (128), Expect(2) = 0.0
Identities = 128/128 (100%)
Strand = Plus / Minus


Query: 12 aagatgatgaaattgggaaatcaattaaacatattaatgaaattaataaacaaatgaaat 71
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 574 aagatgatgaaattgggaaatcaattaaacatattaatgaaattaataaacaaatgaaat 515


Query: 72 cattcgatcttggtagtaaacaaattacaaatggtggtagaagaattaataaattagtta 131
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 514 cattcgatcttggtagtaaacaaattacaaatggtggtagaagaattaataaattagtta 455


Query: 132 caatcttt 139
||||||||
Sbjct: 454 caatcttt 447

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 565,906,757
Number of extensions: 33372153
Number of successful extensions: 2664794
Number of sequences better than 10.0: 75
Length of query: 584
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 561
Effective length of database: 93,106,754,628
Effective search space: 52232889346308
Effective search space used: 52232889346308
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 6.24
Homology vs Protein
Query= Contig-U08272-1 (Contig-U08272-1Q) /CSM_Contig/Contig-U08272-1Q.Seq.d
(584 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

AB168258_1(AB168258|pid:none) Macaca fascicularis testis cDNA cl... 119 6e-26
BC094391_1(BC094391|pid:none) Mus musculus guanine nucleotide bi... 119 8e-26
BC129969_1(BC129969|pid:none) Mus musculus guanine nucleotide bi... 119 8e-26
BC142216_1(BC142216|pid:none) Bos taurus guanine nucleotide bind... 119 8e-26
(P36916) RecName: Full=Guanine nucleotide-binding protein-like 1... 119 8e-26
(Q7YR35) RecName: Full=Guanine nucleotide-binding protein-like 1... 118 1e-25
AL662800_2(AL662800|pid:none) Human DNA sequence from clone XXba... 118 1e-25
AB103601_2(AB103601|pid:none) Homo sapiens CAT56 gene for hypoth... 118 1e-25
BC063657_1(BC063657|pid:none) Homo sapiens guanine nucleotide bi... 116 5e-25
BC083888_1(BC083888|pid:none) Rattus norvegicus guanine nucleoti... 115 7e-25
AK301738_1(AK301738|pid:none) Homo sapiens cDNA FLJ52448 complet... 97 2e-19
AK298042_1(AK298042|pid:none) Homo sapiens cDNA FLJ51011 complet... 97 2e-19
CP000585_246(CP000585|pid:none) Ostreococcus lucimarinus CCE9901... 94 3e-18
CP001331_402(CP001331|pid:none) Micromonas sp. RCC299 chromosome... 91 2e-17
AE014134_3380(AE014134|pid:none) Drosophila melanogaster chromos... 90 5e-17
AC006932_9(AC006932|pid:none) Genomic sequence for Arabidopsis t... 87 3e-16
AC124955_4(AC124955|pid:none) Medicago truncatula clone mth2-12l... 84 2e-15
BC068833_1(BC068833|pid:none) Xenopus laevis hypothetical protei... 84 4e-15
AP008218_1382(AP008218|pid:none) Oryza sativa (japonica cultivar... 84 4e-15
CU640366_1189(CU640366|pid:none) Podospora anserina genomic DNA ... 83 6e-15
(Q10190) RecName: Full=Large subunit GTPase 1; EC=3.6.1... 82 1e-14
CR858177_1(CR858177|pid:none) Pongo abelii mRNA; cDNA DKFZp469D1... 81 2e-14
FN357414_3(FN357414|pid:none) Schistosoma mansoni genome sequenc... 80 4e-14
AL136897_1(AL136897|pid:none) Homo sapiens mRNA; cDNA DKFZp434E2... 80 4e-14
(Q9H089) RecName: Full=Large subunit GTPase 1 homolog; ... 80 4e-14
BC040119_1(BC040119|pid:none) Homo sapiens large subunit GTPase ... 80 4e-14
AK002163_1(AK002163|pid:none) Homo sapiens cDNA FLJ11301 fis, cl... 80 4e-14
CR954214_129(CR954214|pid:none) Ostreococcus tauri strain OTTH05... 80 5e-14
AK145186_1(AK145186|pid:none) Mus musculus mammary gland RCB-052... 79 7e-14
(Q3UM18) RecName: Full=Large subunit GTPase 1 homolog; ... 79 7e-14
FN392319_491(FN392319|pid:none) Pichia pastoris GS115 chromosome... 79 1e-13
(Q5ZJD3) RecName: Full=Large subunit GTPase 1 homolog; ... 79 1e-13
CR382129_823(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 78 2e-13
BC110397_1(BC110397|pid:none) Mus musculus guanine nucleotide bi... 77 3e-13
(Q6NY89) RecName: Full=Large subunit GTPase 1 homolog; ... 77 3e-13
AC116668_33(AC116668|pid:none) Trypanosoma brucei chromosome 5 c... 75 1e-12
AP007150_500(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 75 2e-12
(P53145) RecName: Full=Large subunit GTPase 1; EC=3.6.1... 74 2e-12
FM992693_198(FM992693|pid:none) Candida dubliniensis CD36 chromo... 74 4e-12
CP000498_204(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 74 4e-12
AM920436_1760(AM920436|pid:none) Penicillium chrysogenum Wiscons... 72 8e-12
CU928180_233(CU928180|pid:none) Kluyveromyces thermotolerans str... 72 1e-11
(Q9W590) RecName: Full=Large subunit GTPase 1 homolog; ... 72 1e-11
AB174354_1(AB174354|pid:none) Macaca fascicularis brain cDNA clo... 71 2e-11
AE017341_608(AE017341|pid:none) Cryptococcus neoformans var. neo... 69 7e-11
AE017343_145(AE017343|pid:none) Cryptococcus neoformans var. neo... 69 1e-10
CT005265_136(CT005265|pid:none) Leishmania major strain Friedlin... 65 1e-09
AF124737_1(AF124737|pid:none) Zea mays clone CDAPG77 unknown mRNA. 59 1e-07
AM910995_192(AM910995|pid:none) Plasmodium knowlesi strain H chr... 57 3e-07
AL590448_24(AL590448|pid:none) chromosome VIII of strain GB-M1 o... 56 8e-07
X65026_1(X65026|pid:none) M.musculus mRNA for GTP-binding protein. 53 7e-06
CR940347_552(CR940347|pid:none) Theileria annulata strain Ankara... 52 9e-06
AB202092_2(AB202092|pid:none) Homo sapiens PRR3, HSR1 genes for ... 50 3e-05
AF003143_4(AF003143|pid:none) Caenorhabditis elegans cosmid C53H... 49 8e-05
AE014187_219(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 41 0.021
AB171363_1(AB171363|pid:none) Macaca fascicularis brain cDNA clo... 39 0.078
BC080306_1(BC080306|pid:none) Mus musculus large subunit GTPase ... 39 0.078
AC159702_11(AC159702|pid:none) Trypanosoma brucei chromosome 7 c... 39 0.13
(O14236) RecName: Full=Nucleolar GTP-binding protein 2; &CU3296... 38 0.17
BC067320_1(BC067320|pid:none) Xenopus tropicalis hypothetical pr... 37 0.30
BC000107_1(BC000107|pid:none) Homo sapiens guanine nucleotide bi... 37 0.51
AL844504_283(AL844504|pid:none) Plasmodium falciparum 3D7 chromo... 37 0.51
FN357697_2(FN357697|pid:none) Schistosoma mansoni genome sequenc... 37 0.51
(Q13823) RecName: Full=Nucleolar GTP-binding protein 2; AltName:... 37 0.51
AM502223_46(AM502223|pid:none) Leishmania infantum chromosome 5. 36 0.66
BC154310_1(BC154310|pid:none) Danio rerio guanine nucleotide bin... 36 0.66
BC056293_1(BC056293|pid:none) Danio rerio guanine nucleotide bin... 36 0.66
BC045452_1(BC045452|pid:none) Danio rerio guanine nucleotide bin... 36 0.66
(Q6CSP9) RecName: Full=Nucleolar GTP-binding protein 2; &CR3821... 36 0.66
AK146404_1(AK146404|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 36 0.86
(Q99LH1) RecName: Full=Nucleolar GTP-binding protein 2; &BC0032... 36 0.86
FN392322_442(FN392322|pid:none) Pichia pastoris GS115 chromosome... 36 0.86
CP000583_59(CP000583|pid:none) Ostreococcus lucimarinus CCE9901 ... 36 0.86
BT059603_1(BT059603|pid:none) Salmo salar clone ssal-rgf-523-363... 36 0.86
AL626775_3(AL626775|pid:none) Mouse DNA sequence from clone RP23... 36 0.86
BT045755_1(BT045755|pid:none) Salmo salar clone ssal-rgf-530-197... 36 0.86
AK077532_1(AK077532|pid:none) Mus musculus 8 days embryo whole b... 36 0.86
(Q75DA4) RecName: Full=Nucleolar GTP-binding protein 2; &AE0168... 35 1.1
(P53742) RecName: Full=Nucleolar GTP-binding protein 2; &S63384... 35 1.1
CR940348_248(CR940348|pid:none) Theileria annulata strain Ankara... 35 1.5
CP001287_3918(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 35 1.5
BC042350_1(BC042350|pid:none) Xenopus laevis nucleolar GTPase, m... 35 1.5
AM989976_8(AM989976|pid:none) Zygosaccharomyces rouxii strain AT... 35 1.5
CP001504_1965(CP001504|pid:none) Burkholderia glumae BGR1 chromo... 35 1.9
AE017308_33(AE017308|pid:none) Mycoplasma mobile 163K complete g... 34 2.5
CP000505_815(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 34 3.3
CP000575_777(CP000575|pid:none) Staphylothermus marinus F1, comp... 34 3.3
AX354376_1(AX354376|pid:none) Sequence 22 from Patent WO0196523.... 34 3.3
AK027516_1(AK027516|pid:none) Homo sapiens cDNA FLJ14610 fis, cl... 34 3.3
AK027514_1(AK027514|pid:none) Homo sapiens cDNA FLJ14608 fis, cl... 34 3.3
CP000124_1632(CP000124|pid:none) Burkholderia pseudomallei 1710b... 34 3.3
AY825265_1(AY825265|pid:none) Homo sapiens cell-line LTEP-a-2 nu... 34 3.3
AB463711_1(AB463711|pid:none) Synthetic construct DNA, clone: pF... 34 3.3
AM465281_1(AM465281|pid:none) Vitis vinifera contig VV78X047933.... 34 3.3
AE014297_3357(AE014297|pid:none) Drosophila melanogaster chromos... 34 3.3
CP000588_204(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 33 4.3
CR382399_47(CR382399|pid:none) Plasmodium falciparum chromosome ... 33 4.3
CP001325_351(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 33 4.3
AF542528_31(AF542528|pid:none) Cryptococcus neoformans var. grub... 33 5.6
CP000883_121(CP000883|pid:none) Hemiselmis andersenii chromosome... 33 5.6
AY181025_1(AY181025|pid:none) Mus musculus strain 129/SvJ nucleo... 33 5.6
AP007157_570(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 33 5.6
AY185498_1(AY185498|pid:none) Mus musculus strain Swiss Webster ... 33 5.6
(Q8CI11) RecName: Full=Guanine nucleotide-binding protein-like 3... 33 5.6
AK167183_1(AK167183|pid:none) Mus musculus blastocyst blastocyst... 33 5.6
(Q6TGJ8) RecName: Full=Nucleolar GTP-binding protein 2; &AY4219... 33 5.6
AY710430_33(AY710430|pid:none) Cryptococcus gattii strain WM276 ... 33 5.6
AM920431_780(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 33 5.6
(Q8J109) RecName: Full=Nucleolar GTP-binding protein 2; &AF5425... 33 5.6
CP001291_1551(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 33 5.6
AM270075_53(AM270075|pid:none) Aspergillus niger contig An04c014... 33 5.6
CP000061_443(CP000061|pid:none) Aster yellows witches'-broom phy... 33 5.6
CP001331_296(CP001331|pid:none) Micromonas sp. RCC299 chromosome... 33 7.3
AK319049_1(AK319049|pid:none) Arabidopsis thaliana AT1G52980 mRN... 33 7.3
AC019018_24(AC019018|pid:none) Arabidopsis thaliana chromosome 1... 33 7.3
CR857435_1(CR857435|pid:none) Pongo abelii mRNA; cDNA DKFZp469D2... 33 7.3
(Q98RC1) RecName: Full=GTP-binding protein engA; &AL445563_88(A... 33 7.3
EU966176_1(EU966176|pid:none) Zea mays clone 292297 nucleolar GT... 32 9.5

>AB168258_1(AB168258|pid:none) Macaca fascicularis testis cDNA
clone: QtsA-10775, similar to human guanine nucleotide
binding protein-like 1 (GNL1), mRNA, RefSeq:
NM_005275.2.
Length = 607

Score = 119 bits (298), Expect = 6e-26
Identities = 51/103 (49%), Positives = 72/103 (69%)
Frame = +2

Query: 275 GNYIDIPKRPHWSYNMSGDRLKEEERIMFSRWLENIVIKYDKSRLNYFEHNLEVWRQLWR 454
G+ +D P+RP WSY MS ++L +E F +L I Y +L+YFEHNLE WRQLWR
Sbjct: 124 GSVLDFPRRPPWSYEMSKEQLMSQEERSFQEYLGKIHGAYSSEKLSYFEHNLETWRQLWR 183

Query: 455 VSERSDVILLVTDARYPLFHFPPSLYNYINVDLKKPMILILNK 583
V E SD++LL+TD R+P+ +FPP+LY Y+ +L ++L+LNK
Sbjct: 184 VLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNK 226

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 902,438,378
Number of extensions: 17358022
Number of successful extensions: 41246
Number of sequences better than 10.0: 118
Number of HSP's gapped: 41206
Number of HSP's successfully gapped: 118
Length of query: 194
Length of database: 1,040,966,779
Length adjustment: 122
Effective length of query: 72
Effective length of database: 650,044,009
Effective search space: 46803168648
Effective search space used: 46803168648
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

PSORT

psg: 0.75 gvh: 0.27 alm: 0.48 top: 0.53 tms: 0.00 mit: 0.10 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

44.0 %: nuclear
28.0 %: cytoplasmic
12.0 %: cytoskeletal
8.0 %: mitochondrial
4.0 %: vacuolar
4.0 %: vesicles of secretory system

>> prediction for Contig-U08272-1 is nuc

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 1
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0