Contig-U07481-1
Contig ID Contig-U07481-1
Contig update 2002. 5. 9
Contig sequence
>Contig-U07481-1 (Contig-U07481-1Q) /CSM_Contig/Contig-U07481-1Q.Seq.d
NNNNNNNNNNTAATCGCAGGAGCAGGGGNTTTTNTGNATNATTNNNGGAA
TAATAAANAAACATTTCNGTTNNTAGNGCCAGGGNCATTTCANNTTTTTT
NTTNACCATACAAAAAAAAATAATAATTATAATAATAATAATAAAACTTA
CTTGGNNTTNACTTGGAATCNTATTTAATGAGTNCACNATTTTTTCCACT
TTTATCAACACCAGCCCATGCTAAAAAGAATTTTAATTGACAACNGACAC
CTTCATCACATCTCATATCATNGNATTTGGTTGCACATTGATTANCGATA
CAGGAAGCACAATTTTTACAAATTGAAGTATCTCTATCACCATCCCAAAC
TGCATCCACAATGGCACCATTATCAAGTTGGAAAATGATAGTGAAATAGC
TGACAAATGTTCTTG

Gap no gap
Contig length 415
Chromosome number (1..6, M) -
Chromosome length -
Start point -
End point -
Strand (PLUS/MINUS) -
Number of clones 2
Number of EST 1
Link to clone list U07481
List of clone(s)

est1=FC-IC0780Z,1,406
Translated Amino Acid sequence
xxx*sqeqgxxxxixgiixkhfxx*xqghfxffxxhtkknnnynnnnktylxxtwnxi**
VHXFFHFYQHQPMLKRILIDNXHLHHISYHXIWLHIDXRYRKHNFYKLKYLYHHPKLHPQ
WHHYQVGK***ns*qmfl


Translated Amino Acid sequence (All Frames)
Frame A:
xxxxiagagxfxxxxxnnkxtfxxxxpgxfxxfxxpykkk**l*****nllgxxlesylm
sxxffpllstpahakknfn*qxtpsshlisxxlvah*lxiqeaqflqievslspsqtast
maplsswkmivk*ltnvl


Frame B:
xxx*sqeqgxxxxixgiixkhfxx*xqghfxffxxhtkknnnynnnnktylxxtwnxi**
VHXFFHFYQHQPMLKRILIDNXHLHHISYHXIWLHIDXRYRKHNFYKLKYLYHHPKLHPQ
WHHYQVGK***ns*qmfl


Frame C:
xxxnrrsrgfxxxxxe**xnisvxxarxisxfxxtiqkkiiiiiiiikltwxxlgixfne
xtifstfintspc*kef*lttdtfitshixxfgctlixdtgstiftn*sisitipncihn
gtiiklendseiadkcs


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U07481-1 (Contig-U07481-1Q)
/CSM_Contig/Contig-U07481-1Q.Seq.d
(415 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U07481-1 (Contig-U07481-1Q) /CSM_Contig/Conti... 478 e-135
Contig-U13902-1 (Contig-U13902-1Q) /CSM_Contig/Conti... 36 0.029
Contig-U12568-1 (Contig-U12568-1Q) /CSM_Contig/Conti... 36 0.029
Contig-U12162-1 (Contig-U12162-1Q) /CSM_Contig/Conti... 34 0.11
Contig-U12295-1 (Contig-U12295-1Q) /CSM_Contig/Conti... 32 0.45
Contig-U11579-1 (Contig-U11579-1Q) /CSM_Contig/Conti... 32 0.45
Contig-U09203-1 (Contig-U09203-1Q) /CSM_Contig/Conti... 32 0.45
Contig-U14498-1 (Contig-U14498-1Q) /CSM_Contig/Conti... 30 1.8
Contig-U13280-1 (Contig-U13280-1Q) /CSM_Contig/Conti... 30 1.8

>Contig-U07481-1 (Contig-U07481-1Q) /CSM_Contig/Contig-U07481-1Q.Seq.d
Length = 415

Score = 478 bits (241), Expect = e-135
Identities = 271/271 (100%)
Strand = Plus / Plus


Query: 145 aacttacttggnnttnacttggaatcntatttaatgagtncacnattttttccactttta 204
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 145 aacttacttggnnttnacttggaatcntatttaatgagtncacnattttttccactttta 204


Query: 205 tcaacaccagcccatgctaaaaagaattttaattgacaacngacaccttcatcacatctc 264
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 205 tcaacaccagcccatgctaaaaagaattttaattgacaacngacaccttcatcacatctc 264


Query: 265 atatcatngnatttggttgcacattgattancgatacaggaagcacaatttttacaaatt 324
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 265 atatcatngnatttggttgcacattgattancgatacaggaagcacaatttttacaaatt 324


Query: 325 gaagtatctctatcaccatcccaaactgcatccacaatggcaccattatcaagttggaaa 384
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 325 gaagtatctctatcaccatcccaaactgcatccacaatggcaccattatcaagttggaaa 384


Query: 385 atgatagtgaaatagctgacaaatgttcttg 415
|||||||||||||||||||||||||||||||
Sbjct: 385 atgatagtgaaatagctgacaaatgttcttg 415


Score = 99.6 bits (50), Expect = 2e-21
Identities = 101/101 (100%)
Strand = Plus / Plus


Query: 11 taatcgcaggagcaggggnttttntgnatnattnnnggaataataaanaaacatttcngt 70
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 11 taatcgcaggagcaggggnttttntgnatnattnnnggaataataaanaaacatttcngt 70


Query: 71 tnntagngccagggncatttcannttttttnttnaccatac 111
|||||||||||||||||||||||||||||||||||||||||
Sbjct: 71 tnntagngccagggncatttcannttttttnttnaccatac 111


>Contig-U13902-1 (Contig-U13902-1Q) /CSM_Contig/Contig-U13902-1Q.Seq.d
Length = 2177

Score = 36.2 bits (18), Expect = 0.029
Identities = 18/18 (100%)
Strand = Plus / Minus


Query: 311 aatttttacaaattgaag 328
||||||||||||||||||
Sbjct: 2041 aatttttacaaattgaag 2024


>Contig-U12568-1 (Contig-U12568-1Q) /CSM_Contig/Contig-U12568-1Q.Seq.d
Length = 1697

Score = 36.2 bits (18), Expect = 0.029
Identities = 18/18 (100%)
Strand = Plus / Plus


Query: 218 atgctaaaaagaatttta 235
||||||||||||||||||
Sbjct: 1329 atgctaaaaagaatttta 1346


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 2309
Number of Sequences: 6905
Number of extensions: 2309
Number of successful extensions: 213
Number of sequences better than 10.0: 65
length of query: 415
length of database: 5,674,871
effective HSP length: 16
effective length of query: 399
effective length of database: 5,564,391
effective search space: 2220192009
effective search space used: 2220192009
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11.11
Homology vs DNA
Query= Contig-U07481-1 (Contig-U07481-1Q) /CSM_Contig/Contig-U07481-1Q.Seq.d
(415 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU271818) Dictyostelium discoideum gamete cDNA clone:FC-IC0... 474 e-153 2
(AC116330) Dictyostelium discoideum chromosome 2 map 3191214... 412 e-111 1
(AC115684) Dictyostelium discoideum chromosome 2 map 3108975... 44 2.5 4
(AC172743) Medicago truncatula chromosome 2 BAC clone mth2-2... 44 3.9 1
(AY392439) Dictyostelium discoideum P-selectin gene, complet... 44 3.9 1
(CU372914) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 3.9 1
(CL329959) CH242_3M1.r CHORI-242 Sus scrofa genomic clone CH... 44 3.9 1
(DR062070) iq08c12.g1 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(CB089273) qs07b05.b1 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(EX927575) ll03a03.g7 Cycas ovule - normalized (NYBG) Cycas ... 44 3.9 1
(EX920794) lj39e08.g7 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(EX919947) lj37a07.g7 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(EX919748) lj34f11.g7 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(EX919601) lj32h11.g7 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(EX919321) lj29e12.g7 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(EX918404) lj18h03.g7 Cycas sporophyll (w/o ovule) (NYBG) Cy... 44 3.9 1
(AC161005) Pan troglodytes BAC clone CH251-668M6 from chromo... 34 8.1 4

>(AU271818) Dictyostelium discoideum gamete cDNA clone:FC-IC0780, 3'
end single read.
Length = 406

Score = 474 bits (239), Expect(2) = e-153
Identities = 269/269 (100%)
Strand = Plus / Plus


Query: 147 cttacttggnnttnacttggaatcntatttaatgagtncacnattttttccacttttatc 206
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 137 cttacttggnnttnacttggaatcntatttaatgagtncacnattttttccacttttatc 196


Query: 207 aacaccagcccatgctaaaaagaattttaattgacaacngacaccttcatcacatctcat 266
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 197 aacaccagcccatgctaaaaagaattttaattgacaacngacaccttcatcacatctcat 256


Query: 267 atcatngnatttggttgcacattgattancgatacaggaagcacaatttttacaaattga 326
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 257 atcatngnatttggttgcacattgattancgatacaggaagcacaatttttacaaattga 316


Query: 327 agtatctctatcaccatcccaaactgcatccacaatggcaccattatcaagttggaaaat 386
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 317 agtatctctatcaccatcccaaactgcatccacaatggcaccattatcaagttggaaaat 376


Query: 387 gatagtgaaatagctgacaaatgttcttg 415
|||||||||||||||||||||||||||||
Sbjct: 377 gatagtgaaatagctgacaaatgttcttg 405

Score = 99.6 bits (50), Expect(2) = e-153
Identities = 101/101 (100%)
Strand = Plus / Plus


Query: 11 taatcgcaggagcaggggnttttntgnatnattnnnggaataataaanaaacatttcngt 70
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 taatcgcaggagcaggggnttttntgnatnattnnnggaataataaanaaacatttcngt 60


Query: 71 tnntagngccagggncatttcannttttttnttnaccatac 111
|||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tnntagngccagggncatttcannttttttnttnaccatac 101

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 290,345,935
Number of extensions: 16162502
Number of successful extensions: 1159505
Number of sequences better than 10.0: 17
Length of query: 415
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 392
Effective length of database: 93,106,754,628
Effective search space: 36497847814176
Effective search space used: 36497847814176
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)

protein update 2009. 6.23
Homology vs Protein
Query= Contig-U07481-1 (Contig-U07481-1Q) /CSM_Contig/Contig-U07481-1Q.Seq.d
(415 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

AC116330_2(AC116330|pid:none) Dictyostelium discoideum chromosom... 151 6e-36
AC115684_25(AC115684|pid:none) Dictyostelium discoideum chromoso... 80 3e-14
AF514281_1(AF514281|pid:none) Oreochromis aureus vitellogenin re... 34 1.8
AK061238_1(AK061238|pid:none) Oryza sativa Japonica Group cDNA c... 33 3.1
AC145811_6(AC145811|pid:none) Oryza sativa (japonica cultivar-gr... 33 3.1
(P04929) Histidine-rich glycoprotein precursor. &KGZQHL(A22692)... 33 4.0
AJ879619_2(AJ879619|pid:none) Solea senegalensis mRNA for very l... 32 5.3
AJ879619_1(AJ879619|pid:none) Solea senegalensis mRNA for very l... 32 5.3
(Q8MP30) RecName: Full=Uncharacterized histidine-rich protein DD... 32 6.9
AE014134_613(AE014134|pid:none) Drosophila melanogaster chromoso... 32 8.9

>AC116330_2(AC116330|pid:none) Dictyostelium discoideum chromosome 2
map 3191214-3323468 strain AX4, complete sequence.
Length = 311

Score = 151 bits (382), Expect = 6e-36
Identities = 70/75 (93%), Positives = 70/75 (93%)
Frame = -3

Query: 413 RTFVSYFTIIFQLDNGAIVDAVWDGDRDTSICKNCASCIXNQCATKXXDMRCDEGVXCQL 234
RTFVSYFTIIFQLDNGAIVDAVWDGDRDTSICKNC SCI NQCATK DMRCDEGV CQL
Sbjct: 193 RTFVSYFTIIFQLDNGAIVDAVWDGDRDTSICKNCDSCIDNQCATKFDDMRCDEGVGCQL 252

Query: 233 KFFLAWAGVDKSGKN 189
KFFLAWAGVDKSGKN
Sbjct: 253 KFFLAWAGVDKSGKN 267

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 500,669,507
Number of extensions: 9622371
Number of successful extensions: 16606
Number of sequences better than 10.0: 10
Number of HSP's gapped: 16542
Number of HSP's successfully gapped: 13
Length of query: 138
Length of database: 1,040,966,779
Length adjustment: 102
Effective length of query: 36
Effective length of database: 714,129,709
Effective search space: 25708669524
Effective search space used: 25708669524
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)

PSORT

psg: 0.83 gvh: 0.31 alm: 0.59 top: 0.53 tms: 0.00 mit: 0.30 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.50 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

52.0 %: nuclear
32.0 %: cytoplasmic
8.0 %: mitochondrial
4.0 %: vesicles of secretory system
4.0 %: endoplasmic reticulum

>> prediction for Contig-U07481-1 is nuc

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 1
FC-IC (SUB) 1