NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U06959-1
Contig ID Contig-U06959-1
Contig update 2001. 8.30
Contig sequence 
>Contig-U06959-1 (Contig-U06959-1Q) /CSM_Contig/Contig-U06959-1Q.Seq.d
CGGGCCCCCCCTCGGGTCGACCCCGCGTCCGCACCAATTAAGGAATATAT
ATACCTATATGTTTATTATTTATATATAACATTAATAAAAAAATAAAAAA
ATGGCAATGTTAGAATCATATTTAAAGAAACAAGTCCTTGTTTTAACAGC
AGATGGTAGAAGTATAATTGGTACATTGAGAGGAATTGATCAAACCATTA
ATGTAGTTTTAGAAAAGTGTCATGAAAGAGTTTACTCTGATGAAGGAATT
GAAGTTATTCCATTGGGTGTACATTTAATAAAAGGTGATGATGTGGCTGT
AATAGGGGAAGTAGATGATGAATTAGATAAAAAATTAAACCTAAAAGAGA
TAATAGCAGAGCCGATGAAGCCTATTGTCCACTAATTACAAAAATTTATA
AAAATAATCTATAAAAGAAGAAAAGAAAGAAAAGAAAAAGAAAAAAAAAG
ACAAAAAAATAAAAAATAAAAAAAATTGT
Gap no gap
Contig length 479
Chromosome number (1..6, M) 5
Chromosome length 5062330
Start point 1565897
End point 1565452
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 2
Link to clone list U06959
List of clone(s) 

est1=VSI748F,1,480
est2=VSI748Z,32,477
Translated Amino Acid sequence 
gpplgstprphqlrniytymfiiyi*h**KNKKMAMLESYLKKQVLVLTADGRSIIGTLR
GIDQTINVVLEKCHERVYSDEGIEVIPLGVHLIKGDDVAVIGEVDDELDKKLNLKEIIAE
PMKPIVH*lqkfikiiykrrkerkekekkrqknkk*kkl
Translated Amino Acid sequence (All Frames) 
Frame A:
rapprvdpasapikeyiylyvyylyitlikk*kngnvriifketspcfnsrw*kynwyie
rn*snh*csfrkvs*ksll**rn*sysigctfnkr**cgcnrgsr**ir*kikpkrdnsr
adeaycplitkiyknnl*kkkrkkrkrkkktkk*kikki


Frame B:
gpplgstprphqlrniytymfiiyi*h**KNKKMAMLESYLKKQVLVLTADGRSIIGTLR
GIDQTINVVLEKCHERVYSDEGIEVIPLGVHLIKGDDVAVIGEVDDELDKKLNLKEIIAE
PMKPIVH*lqkfikiiykrrkerkekekkrqknkk*kkl


Frame C:
gppsgrprvrtn*giyipicllfiyninkkikkwqc*nhi*rnkslf*qqmvev*lvh*e
elikplm*f*ksvmkeftlmkelklfhwvyi**kvmmwl**gk*mmn*ikn*t*kr**qs
r*sllstnyknl*k*sikeekkekkkkkkdkkiknkknc
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U06959-1 (Contig-U06959-1Q)
/CSM_Contig/Contig-U06959-1Q.Seq.d
         (479 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U06959-1 (Contig-U06959-1Q) /CSM_Contig/Conti...   571  e-163
Contig-U04925-1 (Contig-U04925-1Q) /CSM_Contig/Conti...    46  3e-05
Contig-U01539-1 (Contig-U01539-1Q) /CSM_Contig/Conti...    44  1e-04
Contig-U14905-1 (Contig-U14905-1Q) /CSM_Contig/Conti...    40  0.002
Contig-U10133-1 (Contig-U10133-1Q) /CSM_Contig/Conti...    40  0.002
Contig-U07011-1 (Contig-U07011-1Q) /CSM_Contig/Conti...    40  0.002
Contig-U06085-1 (Contig-U06085-1Q) /CSM_Contig/Conti...    40  0.002
Contig-U05312-1 (Contig-U05312-1Q) /CSM_Contig/Conti...    40  0.002
Contig-U02284-1 (Contig-U02284-1Q) /CSM_Contig/Conti...    40  0.002
Contig-U14423-1 (Contig-U14423-1Q) /CSM_Contig/Conti...    38  0.008

>Contig-U06959-1 (Contig-U06959-1Q) /CSM_Contig/Contig-U06959-1Q.Seq.d
          Length = 479

 Score =  571 bits (288), Expect = e-163
 Identities = 288/288 (100%)
 Strand = Plus / Plus

                                                                       
Query: 102 tggcaatgttagaatcatatttaaagaaacaagtccttgttttaacagcagatggtagaa 161
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 102 tggcaatgttagaatcatatttaaagaaacaagtccttgttttaacagcagatggtagaa 161

                                                                       
Query: 162 gtataattggtacattgagaggaattgatcaaaccattaatgtagttttagaaaagtgtc 221
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 162 gtataattggtacattgagaggaattgatcaaaccattaatgtagttttagaaaagtgtc 221

                                                                       
Query: 222 atgaaagagtttactctgatgaaggaattgaagttattccattgggtgtacatttaataa 281
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 222 atgaaagagtttactctgatgaaggaattgaagttattccattgggtgtacatttaataa 281

                                                                       
Query: 282 aaggtgatgatgtggctgtaataggggaagtagatgatgaattagataaaaaattaaacc 341
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 282 aaggtgatgatgtggctgtaataggggaagtagatgatgaattagataaaaaattaaacc 341

                                                           
Query: 342 taaaagagataatagcagagccgatgaagcctattgtccactaattac 389
           ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 342 taaaagagataatagcagagccgatgaagcctattgtccactaattac 389


 Score =  149 bits (75), Expect = 3e-36
 Identities = 75/75 (100%)
 Strand = Plus / Plus

                                                                      
Query: 12 tcgggtcgaccccgcgtccgcaccaattaaggaatatatatacctatatgtttattattt 71
          ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 12 tcgggtcgaccccgcgtccgcaccaattaaggaatatatatacctatatgtttattattt 71

                         
Query: 72 atatataacattaat 86
          |||||||||||||||
Sbjct: 72 atatataacattaat 86


>Contig-U04925-1 (Contig-U04925-1Q) /CSM_Contig/Contig-U04925-1Q.Seq.d
          Length = 871

 Score = 46.1 bits (23), Expect = 3e-05
 Identities = 23/23 (100%)
 Strand = Plus / Plus

                                 
Query: 12 tcgggtcgaccccgcgtccgcac 34
          |||||||||||||||||||||||
Sbjct: 12 tcgggtcgaccccgcgtccgcac 34


>Contig-U01539-1 (Contig-U01539-1Q) /CSM_Contig/Contig-U01539-1Q.Seq.d
          Length = 1452

 Score = 44.1 bits (22), Expect = 1e-04
 Identities = 22/22 (100%)
 Strand = Plus / Plus

                                
Query: 12 tcgggtcgaccccgcgtccgca 33
          ||||||||||||||||||||||
Sbjct: 13 tcgggtcgaccccgcgtccgca 34


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 6566
Number of Sequences: 6905
Number of extensions: 6566
Number of successful extensions: 763
Number of sequences better than 10.0: 228
length of query: 479
length of database: 5,674,871
effective HSP length: 16
effective length of query: 463
effective length of database: 5,564,391
effective search space: 2576313033
effective search space used: 2576313033
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11.11
Homology vs DNA 
Query= Contig-U06959-1 (Contig-U06959-1Q) /CSM_Contig/Contig-U06959-1Q.Seq.d
         (479 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU269176) Dictyostelium discoideum vegetative cDNA clone:VS...   571   e-170  2
(AU269177) Dictyostelium discoideum vegetative cDNA clone:VS...   571   e-159  2
(EC761188) PSE00007348 rw_mgpallid Polysphondylium pallidum ...    52   0.001  2
(EY829296) PT11-C2-300-022-D01-CT.F Poncirus trifoliata bark...    52   0.018  1
(EY798873) CR05-C3-701-069-F04-CT.F Mandarin fruit, developm...    52   0.018  1
(EY747859) CS00-C5-003-049-F12-CT.F Sweet orange flower, gre...    52   0.018  1
(CT651946) Danio rerio EST, clone ZF_mu_142b16 5'.                 40   0.035  2
(AU269337) Dictyostelium discoideum vegetative cDNA clone:VS...    50   0.073  1
(CV432516) RT0836 Chinese cabbage root library Brassica rapa...    50   0.073  1
(CT634769) Danio rerio EST, clone ZF_mu_108h17 5'.                 50   0.073  1
(CT629168) Danio rerio EST, clone ZF_mu_76b04 3'.                  50   0.073  1
(CT618758) Danio rerio EST, clone ZF_mu_79m02 5'.                  50   0.073  1
(CT729175) Danio rerio EST, clone ZF_mu_262h09 3'.                 46   0.13   2
(CT635261) Danio rerio EST, clone ZF_mu_104m22 3'.                 38   0.13   2
(EY751041) CS00-C5-003-103-A08-CT.F Sweet orange flower, gre...    42   0.16   2
(DN791666) 90162088 Sea Urchin primary mesenchyme cell cDNA ...    48   0.29   1
(CV864612) PDUts1007H09 Porcine testis cDNA library I Sus sc...    48   0.29   1
(CT633155) Danio rerio EST, clone ZF_mu_74f16 5'.                  48   0.29   1
(CO975395) BeG90N15H11 BeG90N Blastocladiella emersonii cDNA...    48   0.29   1
(AJ703048) Zantedeschia aethiopica EST, clone L-24-6.              48   0.29   1
(FD910790) CBOX16136.fwd CBOX Volvox carteri f. nagariensis ...    48   0.29   1
(EY815969) PT11-C1-900-069-A03-CT.F Poncirus trifoliata leaf...    48   0.29   1
(EY667085) CS00-C1-102-028-A01-CT.F Sweet orange leaf, infec...    48   0.29   1
(DW405906) EST000327 Trichophyton rubrum cDNA library Tricho...    42   0.35   2
(EY835603) PT11-C2-301-042-E05-CT.F Poncirus trifoliata bark...    44   0.57   2
(AC142561) Didelphis virginiana clone LB3-9F6, complete sequ...    46   1.1    1
(AC202904) Zea mays chromosome 9 clone CH201-546L10; ZMMBBc0...    46   1.1    1
(EJ091333) 1095460186925 Global-Ocean-Sampling_GS-26-01-01-1...    46   1.1    1
(CZ403051) ZMMBF0185D05f ZMMBF Zea mays genomic clone ZMMBF0...    46   1.1    1
(DW678671) EST002152 Trichophyton rubrum cDNA library 0 Tric...    46   1.1    1
(AU269381) Dictyostelium discoideum vegetative cDNA clone:VS...    46   1.1    1
(DN792136) 90920693 Sea Urchin primary mesenchyme cell cDNA ...    46   1.1    1
(DN785227) 90895419 Sea Urchin primary mesenchyme cell cDNA ...    46   1.1    1
(DN557161) Ls_af1_11f02_T7 Litomosoides sigmodontis adult fe...    46   1.1    1
(CT699741) Danio rerio EST, clone ZF_mu_284k09 3'.                 46   1.1    1
(CT676469) Danio rerio EST, clone ZF_mu_155k06 3'.                 46   1.1    1
(CT635394) Danio rerio EST, clone ZF_mu_63m20 3'.                  46   1.1    1
(CO969488) BeG120N07D12 BeG120N Blastocladiella emersonii cD...    46   1.1    1
(CO967946) BeE90N14D10 BeE90N Blastocladiella emersonii cDNA...    46   1.1    1
(CO440304) MZCCL10018F08.g Maize Endosperm cDNA Library Zea ...    46   1.1    1
(CN651522) Eg_PSSLS_09F04_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651506) Eg_PSSLS_09D08_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651450) Eg_PSSLS_08E07_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651437) Eg_PSSLS_08C10_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651430) Eg_PSSLS_08B09_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651388) Eg_PSSLS_07E07_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651382) Eg_PSSLS_07E01_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651359) Eg_PSSLS_07B05_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651281) Eg_PSSLS_06A11_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651280) Eg_PSSLS_06A10_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651258) Eg_PSSLS_05G07_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651199) Eg_PSSLS_04H02_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651174) Eg_PSSLS_04D12_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651114) Eg_PSSLS_03E01_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651091) Eg_PSSLS_03B06_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN651083) Eg_PSSLS_03A07_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN650993) Eg_PSSLS_10H02_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN650980) Eg_PSSLS_10F07_T7 Echinococcus granulosus protosc...    46   1.1    1
(CN650971) Eg_PSSLS_10E01_T7 Echinococcus granulosus protosc...    46   1.1    1
(CJ975925) Bursaphelenchus mucronatus cDNA clone: Bm_U1_02G0...    46   1.1    1
(CF602913) BACCA01_000124 Grape Berry pSPORT1 Library Vitis ...    46   1.1    1
(CF580707) AGENCOURT_11361582_updated NIH_MGC_137 Mus muscul...    46   1.1    1
(FD841017) CBHA10084.fwd CBHA Volvox carteri f. nagariensis ...    46   1.1    1
(EY824070) PT11-C1-901-060-A01-CT.F Poncirus trifoliata leaf...    46   1.1    1
(EY818781) PT11-C1-900-099-H03-CT.F Poncirus trifoliata leaf...    46   1.1    1
(EY781994) CR05-C1-103-084-F09-CT.F Mandarin leaf, infected ...    46   1.1    1
(EY780090) CR05-C1-103-063-G11-CT.F Mandarin leaf, infected ...    46   1.1    1
(EY667101) CS00-C1-102-028-B08-CT.F Sweet orange leaf, infec...    46   1.1    1
(EY665942) CS00-C1-102-007-F06-CT.F Sweet orange leaf, infec...    46   1.1    1
(EV189689) 0087170 Brassica napus Cold acclimation - dark Br...    46   1.1    1
(BB973751) Plasmodium berghei strain ANKA cDNA clone:OK00353...    42   1.2    2
(BB972867) Plasmodium berghei strain ANKA cDNA clone:OK00259...    40   1.2    2
(BB974797) Plasmodium berghei strain ANKA cDNA clone:OK00461...    38   1.2    2
(BB972782) Plasmodium berghei strain ANKA cDNA clone:OK00251...    40   1.3    2
(CJ370113) Molgula tectiformis cDNA, gastrula/neurula clone:...    42   1.5    2
(CT625697) Danio rerio EST, clone ZF_mu_74n13 5'.                  38   1.5    2
(CT691601) Danio rerio EST, clone ZF_mu_208l11 5'.                 40   1.8    2
(EV150253) 0140175 Brassica napus Early anther Brassica napu...    42   1.8    2
(EY669671) CS00-C1-102-050-H07-CT.F Sweet orange leaf, infec...    40   1.8    2
(CT732680) Danio rerio EST, clone ZF_mu_287m13 3'.                 40   1.9    2
(EY808979) CR05-C3-702-099-E04-CT.F Mandarin fruit, developm...    40   2.0    2
(DN782433) 90175736 Sea Urchin primary mesenchyme cell cDNA ...    40   2.1    2
(DN784067) 90188955 Sea Urchin primary mesenchyme cell cDNA ...    40   2.2    2
(CU463166) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    32   2.2    2
(CT190101) Sus scrofa genomic clone PigE-85J3, genomic surve...    32   3.0    2
(Y18548) Solanum tuberosum mRNA for lipoxygenase.                  44   4.5    1
(EF064251) Blastocladiella emersonii cob(I)alamin adenosyltr...    44   4.5    1
(AY995153) Solanum tuberosum cultivar Superior lipoxygenase ...    44   4.5    1
(AP009292) Solanum lycopersicum genomic DNA, chromosome 8, c...    44   4.5    1
(AF019614) Solanum tuberosum lipoxygenase (plox2) mRNA, comp...    44   4.5    1
(AF019613) Solanum tuberosum lipoxygenase (plox1) mRNA, comp...    44   4.5    1
(AX345405) Sequence 476 from Patent WO0200928.                     44   4.5    1
(AC135931) Rattus norvegicus clone CH230-285B11, *** SEQUENC...    44   4.5    1
(AC098516) Rattus norvegicus clone CH230-67L4, *** SEQUENCIN...    44   4.5    1
(AC097086) Rattus norvegicus clone CH230-133M16, WORKING DRA...    44   4.5    1
(EV112344) 0117656 Brassica napus Senescent leaves Brassica ...    44   4.5    1
(EV109046) 0114358 Brassica napus Senescent leaves Brassica ...    44   4.5    1
(EV107179) 0112491 Brassica napus Senescent leaves Brassica ...    44   4.5    1
(EV095381) 0193382 Brassica napus Apical meristem Brassica n...    44   4.5    1
(ES277776) PQ028A01.XT7 non-sporulating culture of P. brassi...    44   4.5    1

>(AU269176) Dictyostelium discoideum vegetative cDNA clone:VSI748,
           5' end single read.
          Length = 480

 Score =  571 bits (288), Expect(2) = e-170
 Identities = 288/288 (100%)
 Strand = Plus / Plus


Query: 102 tggcaatgttagaatcatatttaaagaaacaagtccttgttttaacagcagatggtagaa 161
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 102 tggcaatgttagaatcatatttaaagaaacaagtccttgttttaacagcagatggtagaa 161


Query: 162 gtataattggtacattgagaggaattgatcaaaccattaatgtagttttagaaaagtgtc 221
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 162 gtataattggtacattgagaggaattgatcaaaccattaatgtagttttagaaaagtgtc 221


Query: 222 atgaaagagtttactctgatgaaggaattgaagttattccattgggtgtacatttaataa 281
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 222 atgaaagagtttactctgatgaaggaattgaagttattccattgggtgtacatttaataa 281


Query: 282 aaggtgatgatgtggctgtaataggggaagtagatgatgaattagataaaaaattaaacc 341
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 282 aaggtgatgatgtggctgtaataggggaagtagatgatgaattagataaaaaattaaacc 341


Query: 342 taaaagagataatagcagagccgatgaagcctattgtccactaattac 389
           ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 342 taaaagagataatagcagagccgatgaagcctattgtccactaattac 389

 Score = 65.9 bits (33), Expect(2) = e-170
 Identities = 33/33 (100%)
 Strand = Plus / Plus


Query: 12 tcgggtcgaccccgcgtccgcaccaattaagga 44
          |||||||||||||||||||||||||||||||||
Sbjct: 12 tcgggtcgaccccgcgtccgcaccaattaagga 44

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 363,650,774
Number of extensions: 22243935
Number of successful extensions: 1799275
Number of sequences better than 10.0: 320
Length of query: 479
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 456
Effective length of database: 93,106,754,628
Effective search space: 42456680110368
Effective search space used: 42456680110368
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 6.23
Homology vs Protein 
Query= Contig-U06959-1 (Contig-U06959-1Q) /CSM_Contig/Contig-U06959-1Q.Seq.d
         (479 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q1ZXD5) RecName: Full=Probable U6 snRNA-associated Sm-like prot...   185   4e-46
BC068881_1(BC068881|pid:none) Xenopus laevis hypothetical protei...   107   2e-22
BT047877_1(BT047877|pid:none) Salmo salar clone ssal-evf-576-357...   107   2e-22
(O95777) RecName: Full=U6 snRNA-associated Sm-like protein LSm8;...   106   2e-22
BT075557_1(BT075557|pid:none) Osmerus mordax clone omor-eva-509-...   106   2e-22
BT046947_1(BT046947|pid:none) Salmo salar clone ssal-evd-570-376...   105   7e-22
BT038753_1(BT038753|pid:none) Zea mays full-length cDNA clone ZM...   104   9e-22
AC084197_12(AC084197|pid:none) Caenorhabditis elegans cosmid Y73...   101   1e-20
CP000588_15(CP000588|pid:none) Ostreococcus lucimarinus CCE9901 ...   101   1e-20
CP001325_779(CP001325|pid:none) Micromonas sp. RCC299 chromosome...   101   1e-20
EF083429_1(EF083429|pid:none) Picea sitchensis clone WS02726_M17...    97   1e-19
AY070767_1(AY070767|pid:none) Arabidopsis thaliana At1g65700/F1E...    96   4e-19
AM910987_16(AM910987|pid:none) Plasmodium knowlesi strain H chro...    95   9e-19
AE017341_530(AE017341|pid:none) Cryptococcus neoformans var. neo...    89   7e-17
DQ864835_1(DQ864835|pid:none) Pfiesteria piscicida clone ppi-5p-...    88   9e-17
FN357894_5(FN357894|pid:none) Schistosoma mansoni genome sequenc...    84   1e-15
(O74483) RecName: Full=U6 snRNA-associated Sm-like protein LSm8;...    82   8e-15
BC045532_1(BC045532|pid:none) Homo sapiens LSM8 homolog, U6 smal...    76   3e-13
FM992692_260(FM992692|pid:none) Candida dubliniensis CD36 chromo...    73   4e-12
CR382139_305(CR382139|pid:none) Debaryomyces hansenii strain CBS...    72   5e-12
CP001160_694(CP001160|pid:none) Thalassiosira pseudonana CCMP133...    71   1e-11
AY084768_1(AY084768|pid:none) Arabidopsis thaliana clone 117369 ...    70   2e-11
AF411792_1(AF411792|pid:none) Arabidopsis thaliana At1g19120/F14...    69   7e-11
EF083458_1(EF083458|pid:none) Picea sitchensis clone WS02710_J20...    68   1e-10
AY085185_1(AY085185|pid:none) Arabidopsis thaliana clone 13659 m...    68   1e-10
DQ443201_1(DQ443201|pid:none) Bombyx mori LSM1-like protein mRNA...    66   3e-10
EU952554_1(EU952554|pid:none) Zea mays clone 1283561 small nucle...    66   5e-10
AP008210_918(AP008210|pid:none) Oryza sativa (japonica cultivar-...    65   8e-10
BC078334_1(BC078334|pid:none) Danio rerio zgc:101136, mRNA (cDNA...    65   1e-09
(P87173) RecName: Full=U6 snRNA-associated Sm-like protein LSm1;...    64   2e-09
AM487733_1(AM487733|pid:none) Vitis vinifera contig VV78X192487....    64   2e-09
CU633901_326(CU633901|pid:none) Podospora anserina genomic DNA c...    64   2e-09
EU952263_1(EU952263|pid:none) Zea mays clone 1273479 small nucle...    64   2e-09
BT078264_1(BT078264|pid:none) Lepeophtheirus salmonis clone lsal...    64   2e-09
AP000600_3(AP000600|pid:none) Arabidopsis thaliana genomic DNA, ...    63   4e-09
CP000592_143(CP000592|pid:none) Ostreococcus lucimarinus CCE9901...    62   5e-09
(O15116) RecName: Full=U6 snRNA-associated Sm-like protein LSm1;...    62   7e-09
BC110194_1(BC110194|pid:none) Bos taurus Lsm1 protein, mRNA (cDN...    62   7e-09
DQ214704_1(DQ214704|pid:none) Taeniopygia guttata clone 0062P000...    62   7e-09
BT047905_1(BT047905|pid:none) Salmo salar clone ssal-evd-533-087...    61   1e-08
BC141743_1(BC141743|pid:none) Xenopus laevis hypothetical protei...    61   1e-08
EF148825_1(EF148825|pid:none) Populus trichocarpa x Populus delt...    61   1e-08
BT081914_1(BT081914|pid:none) Rana catesbeiana clone rcat-evr-53...    61   1e-08
BC087559_1(BC087559|pid:none) Xenopus tropicalis LSM1 homolog, U...    61   1e-08
BT049862_1(BT049862|pid:none) Salmo salar clone ssal-sjb-017-022...    60   2e-08
BT084216_1(BT084216|pid:none) Zea mays full-length cDNA clone ZM...    60   2e-08
FN392321_455(FN392321|pid:none) Pichia pastoris GS115 chromosome...    59   7e-08
AM270005_14(AM270005|pid:none) Aspergillus niger contig An02c010...    58   9e-08
CR380958_237(CR380958|pid:none) Candida glabrata strain CBS138 c...    58   1e-07
(P47017) RecName: Full=Sm-like protein LSm1; AltName: Full=SPB8 ...    57   2e-07
AM920435_1390(AM920435|pid:none) Penicillium chrysogenum Wiscons...    57   3e-07
CP001160_395(CP001160|pid:none) Thalassiosira pseudonana CCMP133...    57   3e-07
AE016819_24(AE016819|pid:none) Ashbya gossypii (= Eremothecium g...    56   5e-07
AM502243_180(AM502243|pid:none) Leishmania infantum chromosome 25.     56   5e-07
AE017352_269(AE017352|pid:none) Cryptococcus neoformans var. neo...    56   5e-07
CT005264_177(CT005264|pid:none) Leishmania major strain Friedlin...    55   6e-07
CU928170_252(CU928170|pid:none) Kluyveromyces thermotolerans str...    55   6e-07
CR940352_385(CR940352|pid:none) Theileria annulata strain Ankara...    55   1e-06
AC068602_28(AC068602|pid:none) Genomic sequence for Arabidopsis ...    54   2e-06
AM269982_58(AM269982|pid:none) Aspergillus niger contig An01c035...    50   3e-05
CU638743_658(CU638743|pid:none) Podospora anserina genomic DNA c...    49   4e-05
GN111416_1(GN111416|pid:none) Sequence 16197 from Patent WO20090...    49   6e-05
GN111410_1(GN111410|pid:none) Sequence 16191 from Patent WO20090...    48   1e-04
CR382134_278(CR382134|pid:none) Debaryomyces hansenii strain CBS...    48   1e-04
GN111426_1(GN111426|pid:none) Sequence 16207 from Patent WO20090...    47   3e-04
S55211(S55211;S57037;S57040) hypothetical protein YJR022w - yeas...    46   4e-04
(P47093) RecName: Full=U6 snRNA-associated Sm-like protein LSm8;       46   4e-04
FB336515_1(FB336515|pid:none) Sequence 4041 from Patent WO200711...    46   5e-04
CP001575_575(CP001575|pid:none) Micromonas sp. RCC299 chromosome...    45   6e-04
AM494969_117(AM494969|pid:none) Leishmania braziliensis chromoso...    45   6e-04
AM920431_1284(AM920431|pid:none) Penicillium chrysogenum Wiscons...    45   6e-04
CR940347_422(CR940347|pid:none) Theileria annulata strain Ankara...    45   6e-04
CP001326_60(CP001326|pid:none) Micromonas sp. RCC299 chromosome ...    45   0.001
CP000500_584(CP000500|pid:none) Pichia stipitis CBS 6054 chromos...    44   0.002
CU928166_49(CU928166|pid:none) Kluyveromyces thermotolerans stra...    44   0.002
AL590445_134(AL590445|pid:none) chromosome V of strain GB-M1 of ...    44   0.002
AM270376_11(AM270376|pid:none) Aspergillus niger contig An16c024...    43   0.003
CU633438_37(CU633438|pid:none) Podospora anserina genomic DNA ch...    43   0.004
CU928179_471(CU928179|pid:none) Zygosaccharomyces rouxii strain ...    43   0.004
CU928166_241(CU928166|pid:none) Kluyveromyces thermotolerans str...    42   0.005
AE016816_81(AE016816|pid:none) Ashbya gossypii (= Eremothecium g...    42   0.007
EU953181_1(EU953181|pid:none) Zea mays clone 1389544 small nucle...    41   0.016
BT022354_1(BT022354|pid:none) Drosophila melanogaster IP05048 fu...    41   0.016
(O74966) RecName: Full=Probable small nuclear ribonucleoprotein ...    40   0.020
CS560214_1(CS560214|pid:none) Sequence 801 from Patent WO2006032...    40   0.020
EF145882_1(EF145882|pid:none) Populus trichocarpa clone WS0113_P...    40   0.020
(P24715) RecName: Full=Probable small nuclear ribonucleoprotein ...    40   0.027
AM910995_79(AM910995|pid:none) Plasmodium knowlesi strain H chro...    40   0.035
GN111408_1(GN111408|pid:none) Sequence 16189 from Patent WO20090...    40   0.035
CP000780_93(CP000780|pid:none) Candidatus Methanoregula boonei 6...    39   0.045
CR382132_1243(CR382132|pid:none) Yarrowia lipolytica strain CLIB...    39   0.045
CP000505_420(CP000505|pid:none) Thermofilum pendens Hrk 5, compl...    39   0.045
CP000584_60(CP000584|pid:none) Ostreococcus lucimarinus CCE9901 ...    39   0.059
FM992692_313(FM992692|pid:none) Candida dubliniensis CD36 chromo...    39   0.059
GN111484_1(GN111484|pid:none) Sequence 16265 from Patent WO20090...    39   0.059
AK243024_1(AK243024|pid:none) Oryza sativa Japonica Group cDNA, ...    39   0.077
BT036143_1(BT036143|pid:none) Zea mays full-length cDNA clone ZM...    39   0.077
GN111438_1(GN111438|pid:none) Sequence 16219 from Patent WO20090...    39   0.077
GN111374_1(GN111374|pid:none) Sequence 16155 from Patent WO20090...    39   0.077
AM449690_2(AM449690|pid:none) Vitis vinifera contig VV78X262250....    39   0.077
BT078414_1(BT078414|pid:none) Lepeophtheirus salmonis clone lsal...    38   0.10
CS560210_1(CS560210|pid:none) Sequence 797 from Patent WO2006032...    38   0.10
GN111358_1(GN111358|pid:none) Sequence 16139 from Patent WO20090...    38   0.10
BT038364_1(BT038364|pid:none) Zea mays full-length cDNA clone ZM...    38   0.10
GN111476_1(GN111476|pid:none) Sequence 16257 from Patent WO20090...    38   0.10
GN111368_1(GN111368|pid:none) Sequence 16149 from Patent WO20090...    38   0.10
GN111480_1(GN111480|pid:none) Sequence 16261 from Patent WO20090...    38   0.13
CP000559_148(CP000559|pid:none) Methanocorpusculum labreanum Z, ...    38   0.13
CP000593_73(CP000593|pid:none) Ostreococcus lucimarinus CCE9901 ...    38   0.13
CR940348_258(CR940348|pid:none) Theileria annulata strain Ankara...    38   0.13
EF082204_1(EF082204|pid:none) Picea sitchensis clone WS0277_L06 ...    38   0.13
AE017341_9(AE017341|pid:none) Cryptococcus neoformans var. neofo...    38   0.13
AB012242_19(AB012242|pid:none) Arabidopsis thaliana genomic DNA,...    37   0.17
AC008153_16(AC008153|pid:none) Arabidopsis thaliana chromosome 3...    37   0.17
AK229657_1(AK229657|pid:none) Arabidopsis thaliana mRNA for Sm-l...    37   0.17
AC148406_21(AC148406|pid:none) Medicago truncatula clone mth2-46...    37   0.17
AM910991_218(AM910991|pid:none) Plasmodium knowlesi strain H chr...    37   0.23
BC150414_1(BC150414|pid:none) Danio rerio zgc:171959, mRNA (cDNA...    37   0.23
BT077484_1(BT077484|pid:none) Lepeophtheirus salmonis clone lsal...    37   0.23
GN111394_1(GN111394|pid:none) Sequence 16175 from Patent WO20090...    37   0.23
BC078466_1(BC078466|pid:none) Xenopus laevis MGC85219 protein, m...    37   0.29
FB336453_1(FB336453|pid:none) Sequence 3979 from Patent WO200711...    37   0.29
CP001328_390(CP001328|pid:none) Micromonas sp. RCC299 chromosome...    37   0.29
CR954213_81(CR954213|pid:none) Ostreococcus tauri strain OTTH059...    37   0.29
AX879753_1(AX879753|pid:none) Sequence 14658 from Patent EP10746...    37   0.29
BC168072_1(BC168072|pid:none) Xenopus tropicalis cDNA clone MGC:...    37   0.29
DQ217063_1(DQ217063|pid:none) Taeniopygia guttata clone 0061P000...    37   0.29
(P62322) RecName: Full=U6 snRNA-associated Sm-like protein LSm5;...    37   0.29
CR382125_713(CR382125|pid:none) Kluyveromyces lactis strain NRRL...    37   0.29
FB336467_1(FB336467|pid:none) Sequence 3993 from Patent WO200711...    37   0.29
FB336539_1(FB336539|pid:none) Sequence 4065 from Patent WO200711...    36   0.38
BT076425_1(BT076425|pid:none) Caligus rogercresseyi clone crog-e...    36   0.38
CP000939_1710(CP000939|pid:none) Clostridium botulinum B1 str. O...    36   0.50
AM412317_1771(AM412317|pid:none) Clostridium botulinum A str. AT...    36   0.50
CP000852_847(CP000852|pid:none) Caldivirga maquilingensis IC-167...    36   0.50
BT079262_1(BT079262|pid:none) Esox lucius clone eluc-evq-529-177...    36   0.50
CP000962_1772(CP000962|pid:none) Clostridium botulinum A3 str. L...    36   0.50
CP000852_1498(CP000852|pid:none) Caldivirga maquilingensis IC-16...    36   0.50
AL445065_271(AL445065|pid:none) Thermoplasma acidophilum complet...    36   0.50
CP000807_406(CP000807|pid:none) Cyanothece sp. ATCC 51142 linear...    35   0.65
CP000816_974(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co...    35   0.65
CP000587_305(CP000587|pid:none) Ostreococcus lucimarinus CCE9901...    35   0.65
BT047688_1(BT047688|pid:none) Salmo salar clone ssal-evf-541-335...    35   0.65
FN357384_26(FN357384|pid:none) Schistosoma mansoni genome sequen...    35   0.65
DQ311193_1(DQ311193|pid:none) Bombyx mori U6 snRNA-associated Sm...    35   0.65
AL844507_214(AL844507|pid:none) Plasmodium falciparum 3D7 chromo...    35   0.65
CP001083_1876(CP001083|pid:none) Clostridium botulinum Ba4 str. ...    35   0.65
FB336521_1(FB336521|pid:none) Sequence 4047 from Patent WO200711...    35   0.65
(O82221) RecName: Full=Probable small nuclear ribonucleoprotein ...    35   0.65
FB336523_1(FB336523|pid:none) Sequence 4049 from Patent WO200711...    35   0.86
CP001140_94(CP001140|pid:none) Desulfurococcus kamchatkensis 122...    35   0.86
EU415262_1(EU415262|pid:none) Drosophila melanogaster clone glu_...    35   0.86
GN111430_1(GN111430|pid:none) Sequence 16211 from Patent WO20090...    35   0.86
EU415241_1(EU415241|pid:none) Drosophila melanogaster clone GLU_...    35   0.86
(P62308) RecName: Full=Small nuclear ribonucleoprotein G;       ...    35   0.86
AE014134_2851(AE014134|pid:none) Drosophila melanogaster chromos...    35   0.86
AE016820_499(AE016820|pid:none) Ashbya gossypii (= Eremothecium ...    35   1.1
CR382125_447(CR382125|pid:none) Kluyveromyces lactis strain NRRL...    35   1.1
EU415250_1(EU415250|pid:none) Drosophila melanogaster clone glu_...    35   1.1
BC150237_1(BC150237|pid:none) Danio rerio cDNA clone IMAGE:81283...    35   1.1
AE014187_409(AE014187|pid:none) Plasmodium falciparum 3D7 chromo...    35   1.1
DQ311312_1(DQ311312|pid:none) Bombyx mori small nuclear ribonucl...    35   1.1
EU415253_1(EU415253|pid:none) Drosophila melanogaster clone glu_...    35   1.1
FM992689_353(FM992689|pid:none) Candida dubliniensis CD36 chromo...    35   1.1
(Q9YEQ5) RecName: Full=Putative snRNP Sm-like protein;  &BA00000...    35   1.1
(A2BIG9) RecName: Full=LSM domain-containing protein 1;  &BX9273...    35   1.1
CP001399_1333(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,...    34   1.5
AE016818_771(AE016818|pid:none) Ashbya gossypii (= Eremothecium ...    34   1.9
GN111434_1(GN111434|pid:none) Sequence 16215 from Patent WO20090...    34   1.9
EU976289_1(EU976289|pid:none) Zea mays clone 697911 small nuclea...    34   1.9
(Q05856) RecName: Full=Small nuclear ribonucleoprotein-associate...    34   1.9
AY232087_1(AY232087|pid:none) Drosophila yakuba clone yak-ad_SmB...    34   1.9
DQ214410_1(DQ214410|pid:none) Taeniopygia guttata clone 0061P003...    34   1.9
FN392319_571(FN392319|pid:none) Pichia pastoris GS115 chromosome...    34   1.9
AE014187_143(AE014187|pid:none) Plasmodium falciparum 3D7 chromo...    34   1.9
GN111398_1(GN111398|pid:none) Sequence 16179 from Patent WO20090...    34   1.9
AM468572_1(AM468572|pid:none) Vitis vinifera contig VV78X242294....    33   2.5
FN313866_1(FN313866|pid:none) Schistosoma japonicum isolate Anhu...    33   2.5
CR382139_228(CR382139|pid:none) Debaryomyces hansenii strain CBS...    33   3.3
AB017065_13(AB017065|pid:none) Arabidopsis thaliana genomic DNA,...    33   3.3
CR380956_238(CR380956|pid:none) Candida glabrata strain CBS138 c...    33   3.3
AE006641_179(AE006641|pid:none) Sulfolobus solfataricus P2, comp...    33   3.3
BT054114_1(BT054114|pid:none) Zea mays full-length cDNA clone ZM...    33   3.3
AY389602_1(AY389602|pid:none) Hyacinthus orientalis small nuclea...    33   3.3
AM910987_88(AM910987|pid:none) Plasmodium knowlesi strain H chro...    33   3.3
CR380958_183(CR380958|pid:none) Candida glabrata strain CBS138 c...    33   3.3
AC079038_15(AC079038|pid:none) Oryza sativa chromosome 7 clone O...    33   3.3
AK176073_1(AK176073|pid:none) Arabidopsis thaliana mRNA, complet...    33   3.3
EU956899_1(EU956899|pid:none) Zea mays clone 1576952 unknown mRNA.     33   3.3
(Q12330) RecName: Full=Small nuclear ribonucleoprotein E;       ...    33   3.3
(O59734) RecName: Full=Probable small nuclear ribonucleoprotein ...    33   3.3
BT046760_1(BT046760|pid:none) Salmo salar clone ssal-eve-560-178...    33   4.2
BT057553_1(BT057553|pid:none) Salmo salar clone ssal-evd-548-321...    33   4.2
CR380950_90(CR380950|pid:none) Candida glabrata strain CBS138 ch...    33   4.2
BT077091_1(BT077091|pid:none) Caligus rogercresseyi clone crog-e...    33   4.2
EU969873_1(EU969873|pid:none) Zea mays clone 336692 small nuclea...    33   4.2
BT080081_1(BT080081|pid:none) Esox lucius clone eluc-evq-522-154...    33   4.2
BT076780_1(BT076780|pid:none) Caligus rogercresseyi clone crog-e...    33   4.2
AE014296_1122(AE014296|pid:none) Drosophila melanogaster chromos...    33   4.2
BT074310_1(BT074310|pid:none) Oncorhynchus mykiss clone omyk-evo...    33   4.2
CR940348_600(CR940348|pid:none) Theileria annulata strain Ankara...    33   4.2
BT057469_1(BT057469|pid:none) Salmo salar clone ssal-evf-539-344...    33   4.2
FB336519_1(FB336519|pid:none) Sequence 4045 from Patent WO200711...    32   5.5
(Q6NU60) LSM domain-containing protein 1-B.  &BC068740_1(BC06874...    32   5.5
AM494964_213(AM494964|pid:none) Leishmania braziliensis chromoso...    32   5.5
CP000499_50(CP000499|pid:none) Pichia stipitis CBS 6054 chromoso...    32   5.5
CR382130_576(CR382130|pid:none) Yarrowia lipolytica strain CLIB1...    32   5.5
GM016639_237(GM016639|pid:none) Sequence 1469 from Patent EP1923...    32   5.5
FN357345_14(FN357345|pid:none) Schistosoma mansoni genome sequen...    32   5.5
U58510_4(U58510|pid:none) Chlorarachnion CCMP621 small subunit r...    32   7.2
BA000023_829(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ...    32   7.2
BC135307_1(BC135307|pid:none) Xenopus tropicalis LSM domain-cont...    32   7.2
(Q6GQ67) LSM domain-containing protein 1-A.  &BC072881_1(BC07288...    32   7.2
FB887763_1(FB887763|pid:none) Sequence 107036 from Patent WO2008...    32   7.2
CR940347_234(CR940347|pid:none) Theileria annulata strain Ankara...    32   7.2
EU959714_1(EU959714|pid:none) Zea mays clone 219534 small nuclea...    32   7.2
FB887761_1(FB887761|pid:none) Sequence 107034 from Patent WO2008...    32   7.2
DQ158858_4(DQ158858|pid:none) Bigelowiella natans nucleomorph ch...    32   7.2
(A4IGZ4) RecName: Full=LSM domain-containing protein 1;                32   7.2
BA000023_254(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ...    32   9.5
FB887755_1(FB887755|pid:none) Sequence 107028 from Patent WO2008...    32   9.5
AF362732_1(AF362732|pid:none) Oxalis regnellii succinate dehydro...    32   9.5
(Q10163) RecName: Full=Small nuclear ribonucleoprotein-associate...    32   9.5
(P40089) RecName: Full=U6 snRNA-associated Sm-like protein LSm5;...    32   9.5
CP000493_1510(CP000493|pid:none) Hyperthermus butylicus DSM 5456...    32   9.5
(B6YUU5) RecName: Full=Putative snRNP Sm-like protein;  &CP00085...    32   9.5

>(Q1ZXD5) RecName: Full=Probable U6 snRNA-associated Sm-like protein
           LSm8;
          Length = 94

 Score =  185 bits (470), Expect = 4e-46
 Identities = 94/94 (100%), Positives = 94/94 (100%)
 Frame = +2

Query: 101 MAMLESYLKKQVLVLTADGRSIIGTLRGIDQTINVVLEKCHERVYSDEGIEVIPLGVHLI 280
           MAMLESYLKKQVLVLTADGRSIIGTLRGIDQTINVVLEKCHERVYSDEGIEVIPLGVHLI
Sbjct: 1   MAMLESYLKKQVLVLTADGRSIIGTLRGIDQTINVVLEKCHERVYSDEGIEVIPLGVHLI 60

Query: 281 KGDDVAVIGEVDDELDKKLNLKEIIAEPMKPIVH 382
           KGDDVAVIGEVDDELDKKLNLKEIIAEPMKPIVH
Sbjct: 61  KGDDVAVIGEVDDELDKKLNLKEIIAEPMKPIVH 94

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 588,173,792
Number of extensions: 9788315
Number of successful extensions: 24182
Number of sequences better than 10.0: 226
Number of HSP's gapped: 24141
Number of HSP's successfully gapped: 227
Length of query: 159
Length of database: 1,040,966,779
Length adjustment: 118
Effective length of query: 41
Effective length of database: 662,861,149
Effective search space: 27177307109
Effective search space used: 27177307109
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
PSORT 

 psg: 0.61  gvh: 0.40  alm: 0.39  top: 0.53  tms: 0.00  mit: 0.17  mip: 0.08
 nuc: 0.00  erl: 0.00  erm: 0.20  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 52.0 %: cytoplasmic
	 28.0 %: nuclear
	  8.0 %: cytoskeletal
	  8.0 %: peroxisomal
	  4.0 %: mitochondrial

>> prediction for Contig-U06959-1 is cyt
VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0