NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U06875-1
Contig ID Contig-U06875-1
Contig update 2001. 8.30
Contig sequence 
>Contig-U06875-1 (Contig-U06875-1Q) /CSM_Contig/Contig-U06875-1Q.Seq.d
CCCGCGTCCGCCCCGCGTCCGCATATATTAAAGAATGGACGTTGATCACG
AAGTTAAGGAATTAGTCAAATTTATTAAAAAACTTGGAACCAAGGGTGCT
GATGGAAAGTACTCTGTCAAATATGGTGTTTTATTCAATGATGATGATGT
TGCAAACTTTTTCGAAGCATTAGTTGGTACACTCAAAGCTGCTAAAAAGA
GAGGTATCATCACTTTCCAAGGTGAAATCTTACTCCAACGTGTTCACGAC
AATGTTGATGTCATTTTACTTAAAGACGAATAAAATAAATATATATATAA
AGTTTTAACACACATGTAATAATAAAATATATCAATAAAATATCAATAAT
ATCTAAATACATTGTATTATATTTATTTAAAAAAAAA
Gap no gap
Contig length 387
Chromosome number (1..6, M) 2
Chromosome length 8467578
Start point 2051901
End point 2051535
Strand (PLUS/MINUS) MINUS
Number of clones 2
Number of EST 4
Link to clone list U06875
List of clone(s) 

est1=VSI585F,1,388
est2=VSI585Z,22,284
est3=VSH462F,40,327
est4=VSH462Z,40,314
Translated Amino Acid sequence 
prpprvriy*RMDVDHEVKELVKFIKKLGTKGADGKYSVKYGVLFNDDDVANFFEALVGT
LKAAKKRGIITFQGEILLQRVHDNVDVILLKDE*nkyiykvlthm***nisikyq*ylnt
lyyiylkk
Translated Amino Acid sequence (All Frames) 
Frame A:
pasaprphilkngr*srs*gisqiy*ktwnqgc*wkvlcqiwcfiq***ccklfrsiswy
tqsc*keryhhfpr*nltptcsrqc*chft*rrik*iyi*sfnthviikyinkisiisky
ivlylfkkk


Frame B:
prpprvriy*RMDVDHEVKELVKFIKKLGTKGADGKYSVKYGVLFNDDDVANFFEALVGT
LKAAKKRGIITFQGEILLQRVHDNVDVILLKDE*nkyiykvlthm***nisikyq*ylnt
lyyiylkk


Frame C:
rvrpasayikewtlitklrn*snllknleprvlmestlsnmvfysmmmmlqtfskh*lvh
skllkrevsslskvksysnvfttmlmsfylktnkiniyikf*htcnnkiyq*ninni*ih
ciifi*kk
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U06875-1 (Contig-U06875-1Q)
/CSM_Contig/Contig-U06875-1Q.Seq.d
         (387 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U06875-1 (Contig-U06875-1Q) /CSM_Contig/Conti...   571  e-163
Contig-U09793-1 (Contig-U09793-1Q) /CSM_Contig/Conti...    42  4e-04
Contig-U06853-1 (Contig-U06853-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U09170-1 (Contig-U09170-1Q) /CSM_Contig/Conti...    34  0.11
Contig-U08927-1 (Contig-U08927-1Q) /CSM_Contig/Conti...    34  0.11
Contig-U04390-1 (Contig-U04390-1Q) /CSM_Contig/Conti...    34  0.11
Contig-U14087-1 (Contig-U14087-1Q) /CSM_Contig/Conti...    32  0.42
Contig-U13828-1 (Contig-U13828-1Q) /CSM_Contig/Conti...    32  0.42
Contig-U12811-1 (Contig-U12811-1Q) /CSM_Contig/Conti...    32  0.42
Contig-U12131-1 (Contig-U12131-1Q) /CSM_Contig/Conti...    32  0.42

>Contig-U06875-1 (Contig-U06875-1Q) /CSM_Contig/Contig-U06875-1Q.Seq.d
          Length = 387

 Score =  571 bits (288), Expect = e-163
 Identities = 288/288 (100%)
 Strand = Plus / Plus

                                                                       
Query: 1   cccgcgtccgccccgcgtccgcatatattaaagaatggacgttgatcacgaagttaagga 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   cccgcgtccgccccgcgtccgcatatattaaagaatggacgttgatcacgaagttaagga 60

                                                                       
Query: 61  attagtcaaatttattaaaaaacttggaaccaagggtgctgatggaaagtactctgtcaa 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  attagtcaaatttattaaaaaacttggaaccaagggtgctgatggaaagtactctgtcaa 120

                                                                       
Query: 121 atatggtgttttattcaatgatgatgatgttgcaaactttttcgaagcattagttggtac 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 atatggtgttttattcaatgatgatgatgttgcaaactttttcgaagcattagttggtac 180

                                                                       
Query: 181 actcaaagctgctaaaaagagaggtatcatcactttccaaggtgaaatcttactccaacg 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 actcaaagctgctaaaaagagaggtatcatcactttccaaggtgaaatcttactccaacg 240

                                                           
Query: 241 tgttcacgacaatgttgatgtcattttacttaaagacgaataaaataa 288
           ||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 tgttcacgacaatgttgatgtcattttacttaaagacgaataaaataa 288


>Contig-U09793-1 (Contig-U09793-1Q) /CSM_Contig/Contig-U09793-1Q.Seq.d
          Length = 516

 Score = 42.1 bits (21), Expect = 4e-04
 Identities = 21/21 (100%)
 Strand = Plus / Plus

                               
Query: 1  cccgcgtccgccccgcgtccg 21
          |||||||||||||||||||||
Sbjct: 1  cccgcgtccgccccgcgtccg 21


>Contig-U06853-1 (Contig-U06853-1Q) /CSM_Contig/Contig-U06853-1Q.Seq.d
          Length = 320

 Score = 38.2 bits (19), Expect = 0.007
 Identities = 19/19 (100%)
 Strand = Plus / Plus

                             
Query: 4  gcgtccgccccgcgtccgc 22
          |||||||||||||||||||
Sbjct: 1  gcgtccgccccgcgtccgc 19


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 5164
Number of Sequences: 6905
Number of extensions: 5164
Number of successful extensions: 604
Number of sequences better than 10.0: 219
length of query: 387
length of database: 5,674,871
effective HSP length: 16
effective length of query: 371
effective length of database: 5,564,391
effective search space: 2064389061
effective search space used: 2064389061
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11.10
Homology vs DNA 
Query= Contig-U06875-1 (Contig-U06875-1Q) /CSM_Contig/Contig-U06875-1Q.Seq.d
         (387 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU268927) Dictyostelium discoideum vegetative cDNA clone:VS...   545   e-151  1
(AU268928) Dictyostelium discoideum vegetative cDNA clone:VS...   509   e-140  1
(AU267487) Dictyostelium discoideum vegetative cDNA clone:VS...   474   e-129  1
(AU267486) Dictyostelium discoideum vegetative cDNA clone:VS...   468   e-128  1
(CN817028) HRO4527_D12_H23ZS5 Lib AA071E1X Avena sativa cv. ...    36   0.006  3
(CN816834) HRO4525_C12_E23ZS5 Lib AA071E1X Avena sativa cv. ...    36   0.009  3
(EY837663) PT11-C2-301-090-A12-CT.F Poncirus trifoliata bark...    44   0.097  2
(BI888739) ZF637-2-000494 Zebrafish shield stage whole embry...    48   0.23   1
(EL891581) CGF2003364_D09 WLN-02:  walnut leaf from plants i...    36   0.66   2
(EA188510) Sequence 52825 from patent US 7214786.                  46   0.91   1
(EA170812) Sequence 35127 from patent US 7214786.                  46   0.91   1
(EI049453) hhd0005aa06.g2 hhd Oryza coarctata genomic clone ...    46   0.91   1
(EV115075) 0120387 Brassica napus Root library Brassica napu...    46   0.91   1
(AU268958) Dictyostelium discoideum vegetative cDNA clone:VS...    46   0.91   1
(DN784160) 90169561 Sea Urchin primary mesenchyme cell cDNA ...    46   0.91   1
(DN419621) LIB4215-068-R1-K1-G10 LIB4215 Canis lupus familia...    46   0.91   1
(DN369907) LIB3731-028-Q6-K1-H3 LIB3731 Canis lupus familiar...    46   0.91   1
(CN402402) 17000424050782 GRN_EB Homo sapiens cDNA 5', mRNA ...    46   0.91   1
(CN341718) 328823146 GRN_ES Homo sapiens cDNA 5', mRNA seque...    46   0.91   1
(CN306593) 17000424023367 GRN_ES Homo sapiens cDNA 5', mRNA ...    46   0.91   1
(CF872366) tric002xo14.b11 T.reesei mycelial culture, Versio...    46   0.91   1
(CF520026) AGENCOURT_15515159 NICHD_XGC_Kid1 Xenopus laevis ...    46   0.91   1
(CD332929) StrPu537.005752 Sea urchin embryo 20hr blastula s...    46   0.91   1
(CD318702) StrPu538.000064 Sea urchin embryo 7hr cleavage st...    46   0.91   1
(CD295355) StrPu691.006750 Sea urchin larva cDNA library MPM...    46   0.91   1
(CD291041) StrPu538.004200 Sea urchin embryo 7hr cleavage st...    46   0.91   1
(BQ427859) AGENCOURT_7912490 NIH_MGC_72 Homo sapiens cDNA cl...    46   0.91   1
(BQ256470) NISC_ko02h01.q3 Baker mouse embryo e6.5 Mus muscu...    46   0.91   1
(BM105065) 506376 MARC 3BOV Bos taurus cDNA 5', mRNA sequence.     46   0.91   1
(BI892435) ZF637-3-001690 Zebrafish shield stage whole embry...    46   0.91   1
(BI775133) 467515 MARC 1BOV Bos taurus cDNA 5', mRNA sequence.     46   0.91   1
(BF016614) uy33a10.y1 NCI_CGAP_Lu30 Mus musculus cDNA clone ...    46   0.91   1
(EY658467) CS00-C1-100-139-G02-CT.F Sweet orange leaf, green...    46   0.91   1
(DN783697) 91517165 Sea Urchin primary mesenchyme cell cDNA ...    38   1.5    2
(CK801792) NF34f04f44.r1 Tall Fescue PI283316 44 deg C Heat ...    34   2.5    2
(AP009359) Solanum lycopersicum genomic DNA, chromosome 8, c...    44   3.6    1
(EA190347) Sequence 54662 from patent US 7214786.                  44   3.6    1
(EA190289) Sequence 54604 from patent US 7214786.                  44   3.6    1
(EA189669) Sequence 53984 from patent US 7214786.                  44   3.6    1
(EA161219) Sequence 25534 from patent US 7214786.                  44   3.6    1
(EA153826) Sequence 18141 from patent US 7214786.                  44   3.6    1
(EA152460) Sequence 16775 from patent US 7214786.                  44   3.6    1
(EA145404) Sequence 9719 from patent US 7214786.                   44   3.6    1
(CQ493564) Sequence 25431 from Patent WO0160860.                   44   3.6    1
(CQ492261) Sequence 24128 from Patent WO0160860.                   44   3.6    1
(CQ414553) Sequence 21624 from Patent WO0170979.                   44   3.6    1
(CQ401209) Sequence 8280 from Patent WO0170979.                    44   3.6    1
(CQ394862) Sequence 1933 from Patent WO0170979.                    44   3.6    1
(AC231204) Lama pacos clone CH246-260A19, WORKING DRAFT SEQU...    44   3.6    1
(AC205946) Canis lupus familiaris clone XX-146L8, *** SEQUEN...    44   3.6    1
(AK284629) Gryllus bimaculatus mRNA, GBcontig31490.                44   3.6    1
(EK130683) 1093008800690 Global-Ocean-Sampling_GS-31-01-01-1...    44   3.6    1
(EK122075) 1092963674853 Global-Ocean-Sampling_GS-31-01-01-1...    44   3.6    1
(EI382301) POTCX12TF Solanum tuberosum RHPOTKEY BAC ends Sol...    44   3.6    1
(DU513277) 1098609643540 CHORI-243 Ovis aries genomic clone ...    44   3.6    1
(ES282448) PQ037G01.XT7 non-sporulating culture of P. brassi...    44   3.6    1
(EL772758) Plate_11b_G10 Hibernating 13-lined squirrel brain...    44   3.6    1
(EC618786) S_F11_a1_093.ab1 Rabbit heart cDNA library Orycto...    44   3.6    1
(DY557033) AGENCOURT_69679385 NICHD_XGC_Ov1 Xenopus laevis c...    44   3.6    1
(DW405755) EST000176 Trichophyton rubrum cDNA library Tricho...    44   3.6    1
(AU269367) Dictyostelium discoideum vegetative cDNA clone:VS...    44   3.6    1
(DR752190) CCCN1H05 Coprinus cinereus complex C/N source med...    44   3.6    1
(DN792153) 92980507 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN792039) 90835685 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN791818) 90893569 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN791317) 90178366 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN790496) 90879927 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN790490) 90853957 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN789617) 90955976 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN786286) 90911149 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN786073) 90188305 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN785528) 90179858 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN785060) 90188160 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN783109) 90185306 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN782433) 90175736 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN781974) 90951636 Sea Urchin primary mesenchyme cell cDNA ...    44   3.6    1
(DN438359) LIB4217-098-R1-K1-G2 LIB4217 Canis lupus familiar...    44   3.6    1
(DN428055) LIB4216-101-R1-K1-B6 LIB4216 Canis lupus familiar...    44   3.6    1
(DN420276) LIB4215-105-R1-K1-C3 LIB4215 Canis lupus familiar...    44   3.6    1
(DN414374) LIB4215-021-R1-K1-F8 LIB4215 Canis lupus familiar...    44   3.6    1
(DN146550) 4847_A09_B18 Switchgrass stem cDNA library Panicu...    44   3.6    1
(CO448584) MZCCL10122E08.g Maize Endosperm cDNA Library Zea ...    44   3.6    1
(CO445050) MZCCL10079G01.g Maize Endosperm cDNA Library Zea ...    44   3.6    1
(CO443239) MZCCL10060G09.g Maize Endosperm cDNA Library Zea ...    44   3.6    1
(CO441213) MZCCL10028E10.g Maize Endosperm cDNA Library Zea ...    44   3.6    1
(CN263711) 17000424178364 GRN_ES Homo sapiens cDNA 5', mRNA ...    44   3.6    1
(CF879080) tric019xo02.b11 T.reesei mycelial culture, Versio...    44   3.6    1
(CF877420) tric014xb17.b11 T.reesei mycelial culture, Versio...    44   3.6    1
(CF873451) tric033xe06.b1 T.reesei mycelial culture, Version...    44   3.6    1
(CF873266) tric005xd22.b11 T.reesei mycelial culture, Versio...    44   3.6    1
(CF872686) tric003xc02.b11 T.reesei mycelial culture, Versio...    44   3.6    1
(CD896073) G174.101M03F010821 G174 Triticum aestivum cDNA cl...    44   3.6    1
(CD322459) StrPu537.000821 Sea urchin embryo 20hr blastula s...    44   3.6    1
(CD321528) StrPu538.002890 Sea urchin embryo 7hr cleavage st...    44   3.6    1
(CD321488) StrPu538.002850 Sea urchin embryo 7hr cleavage st...    44   3.6    1
(CD321378) StrPu538.002740 Sea urchin embryo 7hr cleavage st...    44   3.6    1
(CD320998) StrPu538.002360 Sea urchin embryo 7hr cleavage st...    44   3.6    1
(CD320562) StrPu538.001924 Sea urchin embryo 7hr cleavage st...    44   3.6    1
(CD296578) StrPu691.007973 Sea urchin larva cDNA library MPM...    44   3.6    1
(CD291692) StrPu538.004851 Sea urchin embryo 7hr cleavage st...    44   3.6    1

>(AU268927) Dictyostelium discoideum vegetative cDNA clone:VSI585,
           5' end single read.
          Length = 388

 Score =  545 bits (275), Expect = e-151
 Identities = 277/278 (99%)
 Strand = Plus / Plus


Query: 1   cccgcgtccgccccgcgtccgcatatattaaagaatggacgttgatcacgaagttaagga 60
           |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||
Sbjct: 1   cccgcgtccgccccgcgtccgcatatattaaagaatggacgttgatnacgaagttaagga 60


Query: 61  attagtcaaatttattaaaaaacttggaaccaagggtgctgatggaaagtactctgtcaa 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  attagtcaaatttattaaaaaacttggaaccaagggtgctgatggaaagtactctgtcaa 120


Query: 121 atatggtgttttattcaatgatgatgatgttgcaaactttttcgaagcattagttggtac 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 atatggtgttttattcaatgatgatgatgttgcaaactttttcgaagcattagttggtac 180


Query: 181 actcaaagctgctaaaaagagaggtatcatcactttccaaggtgaaatcttactccaacg 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 actcaaagctgctaaaaagagaggtatcatcactttccaaggtgaaatcttactccaacg 240


Query: 241 tgttcacgacaatgttgatgtcattttacttaaagacg 278
           ||||||||||||||||||||||||||||||||||||||
Sbjct: 241 tgttcacgacaatgttgatgtcattttacttaaagacg 278

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 309,519,857
Number of extensions: 19798977
Number of successful extensions: 1690721
Number of sequences better than 10.0: 161
Length of query: 387
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 364
Effective length of database: 93,106,754,628
Effective search space: 33890858684592
Effective search space used: 33890858684592
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 6.23
Homology vs Protein 
Query= Contig-U06875-1 (Contig-U06875-1Q) /CSM_Contig/Contig-U06875-1Q.Seq.d
         (387 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q558Y7) RecName: Full=UPF0727 protein;                               164   1e-39
(Q498C5) RecName: Full=UPF0727 protein C6orf115 homolog;  &BC100...   120   1e-26
(A4IHJ3) RecName: Full=UPF0727 protein C6orf115 homolog;  &BC135...   120   2e-26
(Q6TGV7) RecName: Full=UPF0727 protein C6orf115 homolog;  &AY398...   116   2e-25
(Q3ZBN0) RecName: Full=UPF0727 protein C6orf115 homolog;  &BC103...   116   3e-25
(Q6V289) RecName: Full=UPF0727 protein C6orf115 homolog;              114   1e-24
AF161398_1(AF161398|pid:none) Homo sapiens HSPC280 mRNA, partial...   113   2e-24
(Q4KML4) RecName: Full=UPF0727 protein C6orf115 homolog;  &AK171...   111   9e-24
BC039801_1(BC039801|pid:none) Mus musculus RIKEN cDNA 3110003A17...   111   9e-24
BT079377_1(BT079377|pid:none) Esox lucius clone eluc-evq-534-108...   110   2e-23
(A7RHL5) RecName: Full=UPF0727 protein v1g158749;                     105   5e-22
BT048483_1(BT048483|pid:none) Salmo salar clone ssal-evf-523-056...   103   2e-21
BT081809_1(BT081809|pid:none) Rana catesbeiana clone rcat-evr-51...   101   9e-21
CP001331_108(CP001331|pid:none) Micromonas sp. RCC299 chromosome...   101   9e-21
(A9NK39) RecName: Full=UPF0727 protein WS02710_H03;  &EF081612_1...   100   1e-20
EU958918_1(EU958918|pid:none) Zea mays clone 208367 hypothetical...   100   2e-20
AL031394_13(AL031394|pid:none) Arabidopsis thaliana DNA chromoso...   100   3e-20
(Q8LBN7) RecName: Full=UPF0727 protein At4g33640;  &AK229299_1(A...    98   1e-19
EU975852_1(EU975852|pid:none) Zea mays clone 503112 hypothetical...    97   1e-19
AC148971_10(AC148971|pid:none) Medicago truncatula chromosome 2 ...    95   7e-19
(B4YYA9) RecName: Full=UPF0727 protein ST45-2;  &EU714072_1(EU71...    94   1e-18
AC174339_15(AC174339|pid:none) Medicago truncatula clone mth2-16...    90   3e-17
BC089921_1(BC089921|pid:none) Rattus norvegicus similar to Prote...    88   8e-17
BT077654_1(BT077654|pid:none) Lepeophtheirus salmonis clone lsal...    80   2e-14
CP000592_159(CP000592|pid:none) Ostreococcus lucimarinus CCE9901...    73   3e-12
CR954212_154(CR954212|pid:none) Ostreococcus tauri strain OTTH05...    67   3e-10
(Q8N0Z2) RecName: Full=Actin-binding Rho-activating protein; Alt...    44   0.001
Z35663_3(Z35663|pid:none) Caenorhabditis elegans Cosmid T04A8, c...    40   0.025
Z81532_9(Z81532|pid:none) Caenorhabditis elegans Cosmid F36F2, c...    39   0.074
CP000728_1489(CP000728|pid:none) Clostridium botulinum F str. La...    32   6.9
CP000583_207(CP000583|pid:none) Ostreococcus lucimarinus CCE9901...    32   9.0
AY234196_1(AY234196|pid:none) Neisseria meningitidis strain M647...    32   9.0
AM982812_1(AM982812|pid:none) Neisseria meningitidis siaD-WY gen...    32   9.0
AM982801_1(AM982801|pid:none) Neisseria meningitidis siaD-W-135 ...    32   9.0
EU164780_5(EU164780|pid:none) Neisseria meningitidis strain W:nt...    32   9.0
AY234197_1(AY234197|pid:none) Neisseria meningitidis strain M101...    32   9.0
CP000939_2209(CP000939|pid:none) Clostridium botulinum B1 str. O...    32   9.0
AM982804_1(AM982804|pid:none) Neisseria meningitidis siaD-W-135 ...    32   9.0
AM982805_1(AM982805|pid:none) Neisseria meningitidis siaD-W-135 ...    32   9.0
AM982802_1(AM982802|pid:none) Neisseria meningitidis siaD-W-135 ...    32   9.0

>(Q558Y7) RecName: Full=UPF0727 protein;
          Length = 82

 Score =  164 bits (414), Expect = 1e-39
 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Frame = +2

Query: 35  MDVDHEVKELVKFIKKLGTKGADGKYSVKYGVLFNDDDVANFFEALVGTLKAAKKRGIIT 214
           MDVDHEVKELVKFIKKLGTKGADGKYSVKYGVLFNDDDVANFFEALVGTLKAAKKRGIIT
Sbjct: 1   MDVDHEVKELVKFIKKLGTKGADGKYSVKYGVLFNDDDVANFFEALVGTLKAAKKRGIIT 60

Query: 215 FQGEILLQRVHDNVDVILLKDE 280
           FQGEILLQRVHDNVDVILLKDE
Sbjct: 61  FQGEILLQRVHDNVDVILLKDE 82

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 530,863,560
Number of extensions: 9102219
Number of successful extensions: 24376
Number of sequences better than 10.0: 40
Number of HSP's gapped: 24373
Number of HSP's successfully gapped: 40
Length of query: 129
Length of database: 1,040,966,779
Length adjustment: 94
Effective length of query: 35
Effective length of database: 739,763,989
Effective search space: 25891739615
Effective search space used: 25891739615
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)
PSORT 

 psg: 0.75  gvh: 0.43  alm: 0.50  top: 0.53  tms: 0.00  mit: 0.23  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.20  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 40.0 %: cytoplasmic
	 40.0 %: nuclear
	 12.0 %: cytoskeletal
	  8.0 %: mitochondrial

>> prediction for Contig-U06875-1 is cyt
VS (DIR, S) 2
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0