Contig-U06711-1
Contig ID Contig-U06711-1
Contig update 2001. 8.30
Contig sequence
>Contig-U06711-1 (Contig-U06711-1Q) /CSM_Contig/Contig-U06711-1Q.Seq.d
CTCAACTGATATTTTCCTTAGAGTAATGGTAGATATGGGTGGTTGTAGTG
GTTATCAATATATAATAAAGGTTGAAAATAAATTACAAGATGATGATGTA
TTATTTATTAGGAATGGGGCTAAAGTAATTATAGATAAAATTTCATTAGA
AATGATGGAAGGTTCAATCATTGATTATGAAACAGCATTAATGAGAAGTT
CTTTTGTTGTTGCCTCAAACCCAAATACAATAAAATCATGTGGTTGTAAA
ATTTCATTTGAATTAAAGAAATAAAATTAAATTAAATTAAAATAAATAAA
TAAATATAAAAAAATAAGGCAACACCAAAACCAAAAATAAAAAAAAAGAA
TAAAATAGAACAAAACTGGTTTAAAAAATCTAAAAAAAAA

Gap no gap
Contig length 390
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 2511849
End point 2511459
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 2
Link to clone list U06711
List of clone(s)

est1=VSF502F,1,391
est2=VSF502Z,1,367
Translated Amino Acid sequence
STDIFLRVMVDMGGCSGYQYIIKVENKLQDDDVLFIRNGAKVIIDKISLEMMEGSIIDYE
TALMRSSFVVASNPNTIKSCGCKISFELKK*n*iklk*inkykkirqhqnqk*kkrik*n
ktglknlkk


Translated Amino Acid sequence (All Frames)
Frame A:
ln*yfp*sngrygwl*wlsiynkg*k*itr**ciiy*ewg*snyr*nfirndgrfnh*l*
nsinekffccclkpkynkimwl*nfi*ikeikln*ikink*i*knkatpkpkikkknkie
qnwfkkskkk


Frame B:
STDIFLRVMVDMGGCSGYQYIIKVENKLQDDDVLFIRNGAKVIIDKISLEMMEGSIIDYE
TALMRSSFVVASNPNTIKSCGCKISFELKK*n*iklk*inkykkirqhqnqk*kkrik*n
ktglknlkk


Frame C:
qlifsle*w*iwvvvvvini**rlkinykmmmyyllgmglk*l*ikfh*k*wkvqslimk
qh**evllllpqtqiq*nhvvvkfhln*rnkikln*nk*inikk*gntktknkkke*nrt
klv*ki*kk


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U06711-1 (Contig-U06711-1Q)
/CSM_Contig/Contig-U06711-1Q.Seq.d
(390 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U06711-1 (Contig-U06711-1Q) /CSM_Contig/Conti... 515 e-146
Contig-U08746-1 (Contig-U08746-1Q) /CSM_Contig/Conti... 34 0.11
Contig-U04881-1 (Contig-U04881-1Q) /CSM_Contig/Conti... 34 0.11
Contig-U01424-1 (Contig-U01424-1Q) /CSM_Contig/Conti... 34 0.11
Contig-U14170-1 (Contig-U14170-1Q) /CSM_Contig/Conti... 32 0.42
Contig-U13857-1 (Contig-U13857-1Q) /CSM_Contig/Conti... 32 0.42
Contig-U13125-1 (Contig-U13125-1Q) /CSM_Contig/Conti... 32 0.42
Contig-U12428-1 (Contig-U12428-1Q) /CSM_Contig/Conti... 32 0.42
Contig-U12403-1 (Contig-U12403-1Q) /CSM_Contig/Conti... 32 0.42
Contig-U12197-1 (Contig-U12197-1Q) /CSM_Contig/Conti... 32 0.42

>Contig-U06711-1 (Contig-U06711-1Q) /CSM_Contig/Contig-U06711-1Q.Seq.d
Length = 390

Score = 515 bits (260), Expect = e-146
Identities = 260/260 (100%)
Strand = Plus / Plus


Query: 1 ctcaactgatattttccttagagtaatggtagatatgggtggttgtagtggttatcaata 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ctcaactgatattttccttagagtaatggtagatatgggtggttgtagtggttatcaata 60


Query: 61 tataataaaggttgaaaataaattacaagatgatgatgtattatttattaggaatggggc 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tataataaaggttgaaaataaattacaagatgatgatgtattatttattaggaatggggc 120


Query: 121 taaagtaattatagataaaatttcattagaaatgatggaaggttcaatcattgattatga 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 taaagtaattatagataaaatttcattagaaatgatggaaggttcaatcattgattatga 180


Query: 181 aacagcattaatgagaagttcttttgttgttgcctcaaacccaaatacaataaaatcatg 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aacagcattaatgagaagttcttttgttgttgcctcaaacccaaatacaataaaatcatg 240


Query: 241 tggttgtaaaatttcatttg 260
||||||||||||||||||||
Sbjct: 241 tggttgtaaaatttcatttg 260


>Contig-U08746-1 (Contig-U08746-1Q) /CSM_Contig/Contig-U08746-1Q.Seq.d
Length = 935

Score = 34.2 bits (17), Expect = 0.11
Identities = 17/17 (100%)
Strand = Plus / Minus


Query: 131 atagataaaatttcatt 147
|||||||||||||||||
Sbjct: 644 atagataaaatttcatt 628


>Contig-U04881-1 (Contig-U04881-1Q) /CSM_Contig/Contig-U04881-1Q.Seq.d
Length = 500

Score = 34.2 bits (17), Expect = 0.11
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 140 atttcattagaaatgat 156
|||||||||||||||||
Sbjct: 124 atttcattagaaatgat 140


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 6047
Number of Sequences: 6905
Number of extensions: 6047
Number of successful extensions: 558
Number of sequences better than 10.0: 178
length of query: 390
length of database: 5,674,871
effective HSP length: 16
effective length of query: 374
effective length of database: 5,564,391
effective search space: 2081082234
effective search space used: 2081082234
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11. 9
Homology vs DNA
Query= Contig-U06711-1 (Contig-U06711-1Q) /CSM_Contig/Contig-U06711-1Q.Seq.d
(390 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU265331) Dictyostelium discoideum vegetative cDNA clone:VS... 452 e-123 1
(AU265330) Dictyostelium discoideum vegetative cDNA clone:VS... 452 e-123 1
(AC053484) Homo sapiens chromosome 12 clone RP11-20E24, WORK... 34 0.14 2
(AC107032) Homo sapiens 12 BAC RP11-613M5 (Roswell Park Canc... 34 0.14 2
(AC023961) Homo sapiens chromosome 12 clone RP11-613M5 map 1... 34 0.14 2
(AG727387) Macaca fuscata fuscata DNA, clone: MSB2-181H19_F,... 34 0.18 2
(CC080559) CSU-K33r.21K20.SP6 CSU-K33r Aedes aegypti genomic... 48 0.23 1
(AC161283) Pan troglodytes BAC clone CH251-354N8 from chromo... 46 0.91 1
(AC006350) Homo sapiens PAC clone RP5-998H4 from 7, complete... 46 0.91 1
(FC819024) Sr_pAMT7_013k03_T7 S. ratti mixed stage pAMP Stro... 46 0.91 1
(AL022577) Human DNA sequence from clone RP3-353H6 on chromo... 44 3.6 1
(AC126927) Felis catus clone RP86-611J24, WORKING DRAFT SEQU... 44 3.6 1
(AC044898) Homo sapiens chromosome 2 clone RP11-475L2 map 2,... 44 3.6 1
(ER315041) 1092344133898 Global-Ocean-Sampling_GS-34-01-01-1... 44 3.6 1
(CX806495) JGI_CAAJ17794.fwd NIH_XGC_tropBrn2 Xenopus (Silur... 44 3.6 1
(AC131348) Rattus norvegicus clone CH230-7G14, *** SEQUENCIN... 38 4.1 2
(AC094852) Rattus norvegicus clone CH230-6A13, *** SEQUENCIN... 38 4.3 2
(AL844509) Plasmodium falciparum chromosome 13. 32 5.5 2
(AC172158) Bos taurus clone CH240-262I10, WORKING DRAFT SEQU... 40 5.6 3
(AC104640) Homo sapiens 3 BAC RP11-809F4 (Roswell Park Cance... 32 6.6 2
(CU466484) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 30 6.6 2
(AC068566) Homo sapiens chromosome 3 clone RP11-809F4 map 3,... 32 6.7 2
(AC104150) Homo sapiens 3q BAC RP11-523G9 (Roswell Park Canc... 32 6.7 2
(AL109814) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 32 7.0 2
(AC186047) Medicago truncatula chromosome 6 clone mth2-181g2... 42 7.7 2
(BV645393) S217P61690FG11.T0 Noemie Pan troglodytes troglody... 32 9.0 2
(FE329353) CANY4818.fwd CANY_Daphnia_pulex_Log50_Library_20 ... 32 9.1 2

>(AU265331) Dictyostelium discoideum vegetative cDNA clone:VSF502,
3' end single read.
Length = 367

Score = 452 bits (228), Expect = e-123
Identities = 228/228 (100%)
Strand = Plus / Plus


Query: 1 ctcaactgatattttccttagagtaatggtagatatgggtggttgtagtggttatcaata 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ctcaactgatattttccttagagtaatggtagatatgggtggttgtagtggttatcaata 60


Query: 61 tataataaaggttgaaaataaattacaagatgatgatgtattatttattaggaatggggc 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tataataaaggttgaaaataaattacaagatgatgatgtattatttattaggaatggggc 120


Query: 121 taaagtaattatagataaaatttcattagaaatgatggaaggttcaatcattgattatga 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 taaagtaattatagataaaatttcattagaaatgatggaaggttcaatcattgattatga 180


Query: 181 aacagcattaatgagaagttcttttgttgttgcctcaaacccaaatac 228
||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aacagcattaatgagaagttcttttgttgttgcctcaaacccaaatac 228

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 319,284,325
Number of extensions: 21117612
Number of successful extensions: 1695382
Number of sequences better than 10.0: 28
Length of query: 390
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 367
Effective length of database: 93,106,754,628
Effective search space: 34170178948476
Effective search space used: 34170178948476
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)

protein update 2009. 6.22
Homology vs Protein
Query= Contig-U06711-1 (Contig-U06711-1Q) /CSM_Contig/Contig-U06711-1Q.Seq.d
(390 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

AY086333_1(AY086333|pid:none) Arabidopsis thaliana clone 24058 m... 92 7e-18
(Q8LCY2) RecName: Full=Iron-sulfur assembly protein IscA-like 2,... 92 7e-18
AY815279_1(AY815279|pid:none) Schistosoma japonicum SJCHGC05455 ... 91 2e-17
EU959224_1(EU959224|pid:none) Zea mays clone 212452 protein aq_1... 88 8e-17
AC147007_21(AC147007|pid:none) Medicago truncatula clone mth2-26... 86 4e-16
(O43045) RecName: Full=Iron sulfur assembly protein 2; &AL02207... 85 9e-16
AM260525_1227(AM260525|pid:none) Bartonella tribocorum CIP 10547... 80 2e-14
AL034488_14(AL034488|pid:none) Caenorhabditis elegans YAC Y54G11... 80 3e-14
BC032893_1(BC032893|pid:none) Homo sapiens iron-sulfur cluster a... 79 4e-14
(Q86U28) RecName: Full=Iron-sulfur cluster assembly 2 homolog, m... 79 4e-14
(Q9DCB8) RecName: Full=Iron-sulfur cluster assembly 2 homolog, m... 79 5e-14
AK002936_1(AK002936|pid:none) Mus musculus adult male brain cDNA... 79 5e-14
BT074360_1(BT074360|pid:none) Oncorhynchus mykiss clone omyk-evo... 79 6e-14
BT073117_1(BT073117|pid:none) Oncorhynchus mykiss clone omyk-evn... 79 6e-14
BT073545_1(BT073545|pid:none) Oncorhynchus mykiss clone omyk-evn... 79 6e-14
CP000774_3004(CP000774|pid:none) Parvibaculum lavamentivorans DS... 78 8e-14
BT048911_1(BT048911|pid:none) Salmo salar clone ssal-evf-544-092... 78 8e-14
(A1TYH3) RecName: Full=Iron-sulfur cluster insertion protein erp... 77 1e-13
CP001074_1871(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 77 1e-13
BX897700_744(BX897700|pid:none) Bartonella quintana str. Toulous... 77 1e-13
CP001191_1469(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 77 2e-13
BA000012_864(BA000012|pid:none) Mesorhizobium loti MAFF303099 DN... 77 2e-13
CP000781_4205(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 77 2e-13
AY458632_34(AY458632|pid:none) Uncultured marine bacterium 311 c... 77 2e-13
AP007255_2531(AP007255|pid:none) Magnetospirillum magneticum AMB... 76 3e-13
AE005673_1996(AE005673|pid:none) Caulobacter crescentus CB15, co... 76 3e-13
BX897699_970(BX897699|pid:none) Bartonella henselae strain Houst... 75 5e-13
(O32113) RecName: Full=Uncharacterized protein yutM; &AL009126_... 75 5e-13
CP000524_709(CP000524|pid:none) Bartonella bacilliformis KC583, ... 75 5e-13
AP008955_4770(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 75 7e-13
CP000633_1962(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 75 7e-13
CP000009_1691(CP000009|pid:none) Gluconobacter oxydans 621H, com... 75 9e-13
CP000449_1911(CP000449|pid:none) Maricaulis maris MCS10, complet... 75 9e-13
CP001349_2101(CP001349|pid:none) Methylobacterium nodulans ORS 2... 75 9e-13
(P45344) RecName: Full=Iron-sulfur cluster insertion protein erp... 75 9e-13
(A5UBF7) RecName: Full=Iron-sulfur cluster insertion protein erp... 75 9e-13
CP000133_1787(CP000133|pid:none) Rhizobium etli CFN 42, complete... 75 9e-13
CP000386_2705(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 74 1e-12
AY657127_1(AY657127|pid:none) Synthetic construct Peudomonas aer... 74 1e-12
(B0UU19) RecName: Full=Iron--sulfur cluster insertion protein er... 74 1e-12
(Q0I3N9) RecName: Full=Iron-sulfur cluster insertion protein erp... 74 1e-12
CP000143_1245(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 74 2e-12
CP000301_2478(CP000301|pid:none) Rhodopseudomonas palustris BisB... 74 2e-12
(A4T031) RecName: Full=Putative iron--sulfur cluster insertion p... 74 2e-12
CP000830_1723(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 74 2e-12
AC2787(AC2787) conserved hypothetical protein Atu1713 [imported]... 74 2e-12
CP000283_2785(CP000283|pid:none) Rhodopseudomonas palustris BisB... 74 2e-12
CP000560_2810(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 74 2e-12
CP001281_1191(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 74 2e-12
CP000927_3114(CP000927|pid:none) Caulobacter sp. K31, complete g... 74 2e-12
AM286690_362(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 74 2e-12
AP009384_2808(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 73 3e-12
(P46052) RecName: Full=Protein hesB, vegetative; &CP000117_4230... 73 3e-12
(Q21MI1) RecName: Full=Iron-sulfur cluster insertion protein erp... 73 3e-12
CP001010_1333(CP001010|pid:none) Polynucleobacter necessarius su... 73 3e-12
BX572602_87(BX572602|pid:none) Rhodopseudomonas palustris CGA009... 73 3e-12
(A3M0R4) RecName: Full=Iron-sulfur cluster insertion protein erp... 73 3e-12
(Q0BI89) RecName: Full=Putative iron-sulfur cluster insertion pr... 73 3e-12
CP001016_2625(CP001016|pid:none) Beijerinckia indica subsp. indi... 73 4e-12
(Q5P7U0) RecName: Full=Putative iron-sulfur cluster insertion pr... 73 4e-12
(A6UZG6) RecName: Full=Iron-sulfur cluster insertion protein erp... 73 4e-12
CP000943_2332(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 73 4e-12
CP000115_1802(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 73 4e-12
CP000749_1000(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 73 4e-12
(B0TZ08) RecName: Full=Iron--sulfur cluster insertion protein er... 72 5e-12
CP000866_1299(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 72 5e-12
(A1K969) RecName: Full=Putative iron-sulfur cluster insertion pr... 72 6e-12
CP000884_5893(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 72 6e-12
CP000908_3349(CP000908|pid:none) Methylobacterium extorquens PA1... 72 6e-12
(Q13N17) RecName: Full=Putative iron-sulfur cluster insertion pr... 72 6e-12
CP000911_869(CP000911|pid:none) Brucella suis ATCC 23445 chromos... 72 8e-12
(Q0KED6) RecName: Full=Putative iron-sulfur cluster insertion pr... 72 8e-12
FM954972_2376(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 72 8e-12
(A1W3Q0) RecName: Full=Putative iron-sulfur cluster insertion pr... 72 8e-12
(Q60AU6) RecName: Full=Iron-sulfur cluster insertion protein erp... 72 8e-12
CP000377_901(CP000377|pid:none) Silicibacter sp. TM1040, complet... 72 8e-12
(A1V053) RecName: Full=Putative iron-sulfur cluster insertion pr... 71 1e-11
(Q6FG12) RecName: Full=Iron-sulfur cluster insertion protein erp... 71 1e-11
(A4XZB1) RecName: Full=Iron-sulfur cluster insertion protein erp... 71 1e-11
CP000359_320(CP000359|pid:none) Deinococcus geothermalis DSM 113... 71 1e-11
(Q4K514) RecName: Full=Iron-sulfur cluster insertion protein erp... 71 1e-11
(A1VJJ5) RecName: Full=Putative iron-sulfur cluster insertion pr... 71 1e-11
AL591688_1526(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 71 1e-11
(A4VHK9) RecName: Full=Iron-sulfur cluster insertion protein erp... 71 1e-11
CU234118_3834(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 71 1e-11
(A2SKL7) RecName: Full=Putative iron-sulfur cluster insertion pr... 71 1e-11
CP000591_85(CP000591|pid:none) Ostreococcus lucimarinus CCE9901 ... 71 1e-11
CP000264_1504(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 71 1e-11
CP000922_2378(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 71 1e-11
(Q1LRC6) RecName: Full=Putative iron-sulfur cluster insertion pr... 71 1e-11
FP236842_859(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 70 2e-11
(A4JRL3) RecName: Full=Putative iron-sulfur cluster insertion pr... 70 2e-11
CP000949_4740(CP000949|pid:none) Pseudomonas putida W619, comple... 70 2e-11
AE015451_429(AE015451|pid:none) Pseudomonas putida KT2440 comple... 70 2e-11
CP000319_1668(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 70 2e-11
AE013598_513(AE013598|pid:none) Xanthomonas oryzae pv. oryzae KA... 70 2e-11
(Q9CNH3) RecName: Full=Iron-sulfur cluster insertion protein erp... 70 2e-11
(A7MGR3) RecName: Full=Iron-sulfur cluster insertion protein erp... 70 2e-11
CP000967_4598(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 70 2e-11
(Q3K5W6) RecName: Full=Iron-sulfur cluster insertion protein erp... 70 2e-11
(Q1IFY7) RecName: Full=Iron-sulfur cluster insertion protein erp... 70 2e-11
(Q124P0) RecName: Full=Putative iron-sulfur cluster insertion pr... 70 2e-11
CP000463_2605(CP000463|pid:none) Rhodopseudomonas palustris BisA... 70 2e-11
CU468135_880(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 70 2e-11
(Q13UB4) RecName: Full=Putative iron-sulfur cluster insertion pr... 70 2e-11
(Q2NVP9) RecName: Full=Iron-sulfur cluster insertion protein erp... 70 2e-11
GN111835_1(GN111835|pid:none) Sequence 16616 from Patent WO20090... 70 2e-11
CP001157_4444(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 70 3e-11
(Q47IC1) RecName: Full=Putative iron-sulfur cluster insertion pr... 70 3e-11
(A4W6Q3) RecName: Full=Iron--sulfur cluster insertion protein er... 70 3e-11
(A9I246) RecName: Full=Putative iron--sulfur cluster insertion p... 70 3e-11
(P64342) RecName: Full=Iron-sulfur cluster insertion protein erp... 69 4e-11
CP001068_361(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 69 4e-11
(A4TPW8) RecName: Full=Iron-sulfur cluster insertion protein erp... 69 4e-11
CP001103_1593(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 69 5e-11
CP000975_464(CP000975|pid:none) Methylacidiphilum infernorum V4,... 69 5e-11
CP001111_3695(CP001111|pid:none) Stenotrophomonas maltophilia R5... 69 5e-11
(Q3BY98) RecName: Full=Iron-sulfur cluster insertion protein erp... 69 5e-11
(A1IQG0) RecName: Full=Putative iron-sulfur cluster insertion pr... 69 7e-11
CP000381_473(CP000381|pid:none) Neisseria meningitidis 053442, c... 69 7e-11
(A0KNY6) RecName: Full=Iron-sulfur cluster insertion protein erpA; 69 7e-11
CU234118_5129(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 69 7e-11
(Q60C62) RecName: Full=Iron-sulfur cluster insertion protein erp... 69 7e-11
CP000462_3405(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 69 7e-11
(Q7NRT6) RecName: Full=Putative iron-sulfur cluster insertion pr... 69 7e-11
(Q2S8Y5) RecName: Full=Iron-sulfur cluster insertion protein erp... 69 7e-11
(A1S3U4) RecName: Full=Iron-sulfur cluster insertion protein erp... 68 9e-11
(Q2YBK7) RecName: Full=Putative iron-sulfur cluster insertion pr... 68 9e-11
CP001600_2992(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 68 9e-11
(Q8Y242) RecName: Full=Putative iron-sulfur cluster insertion pr... 68 9e-11
CP000103_555(CP000103|pid:none) Nitrosospira multiformis ATCC 25... 68 9e-11
CP000285_2830(CP000285|pid:none) Chromohalobacter salexigens DSM... 68 1e-10
(Q7N843) RecName: Full=Iron-sulfur cluster insertion protein erp... 68 1e-10
AM920437_2056(AM920437|pid:none) Penicillium chrysogenum Wiscons... 68 1e-10
(Q5QVQ4) RecName: Full=Iron-sulfur cluster insertion protein erp... 68 1e-10
(Q07YU9) RecName: Full=Iron-sulfur cluster insertion protein erp... 67 1e-10
(B0RN15) RecName: Full=Iron--sulfur cluster insertion protein er... 67 1e-10
(A1WVE3) RecName: Full=Iron-sulfur cluster insertion protein erp... 67 1e-10
CP001196_2236(CP001196|pid:none) Oligotropha carboxidovorans OM5... 67 1e-10
CP000789_3300(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 67 1e-10
(Q82UQ4) RecName: Full=Putative iron-sulfur cluster insertion pr... 67 1e-10
(A7MUU6) RecName: Full=Iron-sulfur cluster insertion protein erpA; 67 1e-10
AE017221_1266(AE017221|pid:none) Thermus thermophilus HB27, comp... 67 1e-10
(A6VN49) RecName: Full=Iron-sulfur cluster insertion protein erp... 67 1e-10
(A1VMK3) RecName: Full=Putative iron-sulfur cluster insertion pr... 67 2e-10
CP000489_922(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 67 2e-10
AY458641_98(AY458641|pid:none) Uncultured marine bacterium 463 c... 67 2e-10
CP000943_3376(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 67 3e-10
(A0KZS2) RecName: Full=Iron-sulfur cluster insertion protein erp... 67 3e-10
(A8H175) RecName: Full=Iron--sulfur cluster insertion protein er... 67 3e-10
(A1RMG3) RecName: Full=Iron-sulfur cluster insertion protein erp... 67 3e-10
CP000821_1093(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 67 3e-10
(Q8EHC4) RecName: Full=Iron-sulfur cluster insertion protein erpA; 67 3e-10
AE016822_1206(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 67 3e-10
EU559167_70(EU559167|pid:none) Candidatus Nitrospira defluvii Co... 67 3e-10
(Q87LY4) RecName: Full=Iron-sulfur cluster insertion protein erp... 66 3e-10
(A9MPK5) RecName: Full=Iron--sulfur cluster insertion protein er... 66 3e-10
AP009484_565(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 66 3e-10
CP000857_214(CP000857|pid:none) Salmonella enterica subsp. enter... 66 3e-10
CP001321_1816(CP001321|pid:none) Haemophilus parasuis SH0165, co... 66 3e-10
(B5Y1L3) RecName: Full=Iron--sulfur cluster insertion protein er... 66 3e-10
CP000910_1561(CP000910|pid:none) Renibacterium salmoninarum ATCC... 66 3e-10
(P18501) RecName: Full=Protein hesB; &AD1985(AD1985) &BA000019_... 66 3e-10
CP001189_439(CP001189|pid:none) Gluconacetobacter diazotrophicus... 66 4e-10
AM270369_7(AM270369|pid:none) Aspergillus niger contig An16c0170... 66 4e-10
CP001341_1926(CP001341|pid:none) Arthrobacter chlorophenolicus A... 66 4e-10
(Q1QSB5) RecName: Full=Iron-sulfur cluster insertion protein erp... 66 4e-10
CP001229_1383(CP001229|pid:none) Sulfurihydrogenibium azorense A... 66 4e-10
CP000687_1430(CP000687|pid:none) Actinobacillus pleuropneumoniae... 65 6e-10
CP000283_1081(CP000283|pid:none) Rhodopseudomonas palustris BisB... 65 6e-10
(P46051) RecName: Full=Protein hesB, heterocyst; &CP000117_3918... 65 6e-10
(Q31IS8) RecName: Full=Iron-sulfur cluster insertion protein erp... 65 6e-10
CP000248_155(CP000248|pid:none) Novosphingobium aromaticivorans ... 65 6e-10
(Q8DBX7) RecName: Full=Iron-sulfur cluster insertion protein erpA; 65 6e-10
BA000037_2727(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 65 6e-10
(Q7MHZ0) RecName: Full=Iron-sulfur cluster insertion protein erpA; 65 6e-10
BX572607_274(BX572607|pid:none) Rhodopseudomonas palustris CGA00... 65 6e-10
AE016795_1550(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 65 6e-10
(Q8D3C7) RecName: Full=Iron-sulfur cluster insertion protein erp... 65 6e-10
(Q15YG5) RecName: Full=Iron-sulfur cluster insertion protein erp... 65 7e-10
CP000250_977(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 65 7e-10
CP001277_333(CP001277|pid:none) Candidatus Hamiltonella defensa ... 65 7e-10
AP006716_2011(AP006716|pid:none) Staphylococcus haemolyticus JCS... 65 7e-10
AP009153_2001(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 65 7e-10
CP000084_952(CP000084|pid:none) Candidatus Pelagibacter ubique H... 65 1e-09
CP000713_47(CP000713|pid:none) Psychrobacter sp. PRwf-1, complet... 65 1e-09
(A5F947) RecName: Full=Iron-sulfur cluster insertion protein erp... 65 1e-09
CP001337_3546(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 65 1e-09
(B7JAH6) RecName: Full=Iron--sulfur cluster insertion protein er... 65 1e-09
(Q5WWW0) RecName: Full=Iron-sulfur cluster insertion protein erp... 65 1e-09
(Q1LTN5) RecName: Full=Iron-sulfur cluster insertion protein erp... 65 1e-09
FJ170277_6(FJ170277|pid:none) Uncultured cyanobacterium group A ... 64 1e-09
AE015929_634(AE015929|pid:none) Staphylococcus epidermidis ATCC ... 64 1e-09
CP000909_25(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl,... 64 1e-09
(Q0AFU6) RecName: Full=Putative iron-sulfur cluster insertion pr... 64 1e-09
(Q0ABJ8) RecName: Full=Iron-sulfur cluster insertion protein erp... 64 1e-09
CP000661_1244(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 64 1e-09
CP000496_860(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 64 2e-09
CU207366_3089(CU207366|pid:none) Gramella forsetii KT0803 comple... 64 2e-09
AP009384_3409(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 64 2e-09
(A5CVH1) RecName: Full=Iron-sulfur cluster insertion protein erp... 64 2e-09
CP000029_518(CP000029|pid:none) Staphylococcus epidermidis RP62A... 64 2e-09
AM849034_1374(AM849034|pid:none) Clavibacter michiganensis subsp... 64 2e-09
CP001091_1469(CP001091|pid:none) Actinobacillus pleuropneumoniae... 64 2e-09
(A3N2B0) RecName: Full=Iron-sulfur cluster insertion protein erp... 64 2e-09
CP000764_3372(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 63 3e-09
CP001280_3522(CP001280|pid:none) Methylocella silvestris BL2, co... 63 3e-09
(Q5X5H7) RecName: Full=Iron-sulfur cluster insertion protein erp... 63 3e-09
AY728386_25(AY728386|pid:none) Cyanothece sp. ATCC 51142, genomi... 63 3e-09
(A5IBN0) RecName: Full=Iron-sulfur cluster insertion protein erp... 63 3e-09
AP009324_936(AP009324|pid:none) Staphylococcus aureus subsp. aur... 63 4e-09
CP000450_1202(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 63 4e-09
CP000686_2049(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 63 4e-09
CP001472_2421(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 63 4e-09
AJ938182_806(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 63 4e-09
AM180088_1785(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 63 4e-09
CP000509_3098(CP000509|pid:none) Nocardioides sp. JS614, complet... 63 4e-09
(Q9ZE83) RecName: Full=Uncharacterized protein RP063; &AJ235270... 63 4e-09
FM992690_647(FM992690|pid:none) Candida dubliniensis CD36 chromo... 63 4e-09
(Q5E2W7) RecName: Full=Iron-sulfur cluster insertion protein erp... 62 5e-09
AF003700_9(AF003700|pid:none) Cyanothece PCC 8801 NifK (nifK) ge... 62 5e-09
CP001130_676(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 62 5e-09
CP001131_625(CP001131|pid:none) Anaeromyxobacter sp. K, complete... 62 5e-09
AE016795_414(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 62 5e-09
CP000251_592(CP000251|pid:none) Anaeromyxobacter dehalogenans 2C... 62 6e-09
CP001618_1873(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 62 6e-09
CP001291_2062(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 62 6e-09
CP000569_917(CP000569|pid:none) Actinobacillus pleuropneumoniae ... 62 6e-09
CP000975_465(CP000975|pid:none) Methylacidiphilum infernorum V4,... 62 6e-09
(Q47887) RecName: Full=Uncharacterized protein in nifB-nifU inte... 62 6e-09
AE017197_65(AE017197|pid:none) Rickettsia typhi str. Wilmington ... 62 8e-09
CP001407_4852(CP001407|pid:none) Bacillus cereus 03BB102, comple... 62 8e-09
CP001037_475(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 62 8e-09
AE017143_926(AE017143|pid:none) Haemophilus ducreyi strain 35000... 62 8e-09
CU234118_3353(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 62 8e-09
CP000360_482(CP000360|pid:none) Acidobacteria bacterium Ellin345... 62 8e-09
(Q44540) RecName: Full=Uncharacterized protein in nifU 5'region;... 62 8e-09
CP000001_4620(CP000001|pid:none) Bacillus cereus E33L, complete ... 62 8e-09
AE017225_4757(AE017225|pid:none) Bacillus anthracis str. Sterne,... 62 8e-09
(A1JKQ4) RecName: Full=Iron-binding protein iscA; AltName: Full=... 62 8e-09
AE016877_4698(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 62 8e-09
CP000393_3449(CP000393|pid:none) Trichodesmium erythraeum IMS101... 62 8e-09
CP001615_770(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 62 8e-09
(A1ST94) RecName: Full=Iron-sulfur cluster insertion protein erp... 62 8e-09
CP000967_2077(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 61 1e-08
CP000887_854(CP000887|pid:none) Brucella abortus S19 chromosome ... 61 1e-08
CP000951_220(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 61 1e-08
AE017194_5038(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 61 1e-08
AE014291_911(AE014291|pid:none) Brucella suis 1330 chromosome I,... 61 1e-08
CP000377_765(CP000377|pid:none) Silicibacter sp. TM1040, complet... 61 1e-08
(A4TMV2) RecName: Full=Iron-binding protein iscA; AltName: Full=... 61 1e-08
CP000283_2451(CP000283|pid:none) Rhodopseudomonas palustris BisB... 61 1e-08
AE013598_2378(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 61 1e-08
CP000708_863(CP000708|pid:none) Brucella ovis ATCC 25840 chromos... 61 1e-08
S04873(S04873) hypothetical protein 118 (nifS 5' region) - Brady... 61 1e-08
AD3381(AD3381) hesB protein [imported] - Brucella melitensis (st... 61 1e-08
CP000975_485(CP000975|pid:none) Methylacidiphilum infernorum V4,... 61 1e-08
CP000117_203(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 61 1e-08
CP000903_4636(CP000903|pid:none) Bacillus weihenstephanensis KBA... 61 1e-08
CP000828_3080(CP000828|pid:none) Acaryochloris marina MBIC11017,... 61 1e-08
BX572601_14(BX572601|pid:none) Rhodopseudomonas palustris CGA009... 61 1e-08
CP000471_531(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 61 1e-08
CP000089_1503(CP000089|pid:none) Dechloromonas aromatica RCB, co... 61 1e-08
GN111823_1(GN111823|pid:none) Sequence 16604 from Patent WO20090... 61 1e-08
AE008692_1832(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 60 2e-08
BA000039_866(BA000039|pid:none) Thermosynechococcus elongatus BP... 60 2e-08
BX842649_74(BX842649|pid:none) Bdellovibrio bacteriovorus comple... 60 2e-08
CR954246_2603(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 60 2e-08
CP000947_154(CP000947|pid:none) Haemophilus somnus 2336, complet... 60 2e-08
CP000769_3550(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 60 2e-08
EU955233_1(EU955233|pid:none) Zea mays clone 1519386 iron-sulfur... 60 2e-08
CP001132_1203(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 60 2e-08
BX248358_257(BX248358|pid:none) Corynebacterium diphtheriae grav... 60 2e-08
GN111819_1(GN111819|pid:none) Sequence 16600 from Patent WO20090... 60 2e-08
CP000746_854(CP000746|pid:none) Actinobacillus succinogenes 130Z... 60 2e-08
CP000481_951(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 60 2e-08
CP000250_2978(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 60 2e-08
(P37029) RecName: Full=Uncharacterized protein blr1755; &AF3220... 60 3e-08
(Q89AQ6) RecName: Full=Iron-sulfur cluster insertion protein erp... 60 3e-08
AJ005696_4(AJ005696|pid:none) Rhizobium etli prxS gene, rpoN2 ge... 60 3e-08
CP000529_1553(CP000529|pid:none) Polaromonas naphthalenivorans C... 60 3e-08
CP000109_617(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 60 3e-08
AP008957_3605(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 60 3e-08
CP000020_612(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 60 3e-08
CP000769_632(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, co... 60 3e-08
CP000301_4397(CP000301|pid:none) Rhodopseudomonas palustris BisB... 60 3e-08
CT573213_5018(CT573213|pid:none) Frankia alni str. ACN14A chromo... 60 3e-08
EF148767_1(EF148767|pid:none) Populus trichocarpa x Populus delt... 60 3e-08
AP008231_633(AP008231|pid:none) Synechococcus elongatus PCC 6301... 59 4e-08
AM920689_2731(AM920689|pid:none) Xanthomonas campestris pv. camp... 59 4e-08
A82286(A82286) hesB family protein VC0750 [imported] - Vibrio ch... 59 4e-08
(A1AXV9) RecName: Full=Iron-sulfur cluster insertion protein erp... 59 4e-08
CP000249_3083(CP000249|pid:none) Frankia sp. CcI3, complete geno... 59 5e-08
AE008692_1402(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 59 5e-08
CP000053_111(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 59 5e-08
CP000766_109(CP000766|pid:none) Rickettsia rickettsii str. Iowa,... 59 5e-08
CP000644_2417(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 59 5e-08
CP000089_1939(CP000089|pid:none) Dechloromonas aromatica RCB, co... 59 7e-08
AL939111_198(AL939111|pid:none) Streptomyces coelicolor A3(2) co... 59 7e-08
BT071734_1(BT071734|pid:none) Picea sitchensis clone WS0444_E04 ... 59 7e-08
AK070964_1(AK070964|pid:none) Oryza sativa Japonica Group cDNA c... 59 7e-08
CP000850_3402(CP000850|pid:none) Salinispora arenicola CNS-205, ... 59 7e-08
AE016827_1723(AE016827|pid:none) Mannheimia succiniciproducens M... 59 7e-08
CP001612_74(CP001612|pid:none) Rickettsia africae ESF-5, complet... 59 7e-08
AE008922_1538(AE008922|pid:none) Xanthomonas campestris pv. camp... 59 7e-08
AE016828_1171(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 59 7e-08
CP000806_21(CP000806|pid:none) Cyanothece sp. ATCC 51142 circula... 59 7e-08
AL672114_24(AL672114|pid:none) Mesorhizobium loti R7A symbiosis ... 59 7e-08
BX908798_1085(BX908798|pid:none) Parachlamydia-related symbiont ... 59 7e-08
CP000789_989(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 58 9e-08
CP000113_4873(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 58 9e-08
AM746676_5877(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 58 9e-08
CP001344_3554(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 58 9e-08
CP000084_739(CP000084|pid:none) Candidatus Pelagibacter ubique H... 58 9e-08
CP000462_1703(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 58 9e-08
BA000035_2087(BA000035|pid:none) Corynebacterium efficiens YS-31... 58 9e-08
CP000683_57(CP000683|pid:none) Rickettsia massiliae MTU5, comple... 58 9e-08
EU962521_1(EU962521|pid:none) Zea mays clone 243416 iron-sulfur ... 58 1e-07
CP001100_2664(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 58 1e-07
CP000088_1009(CP000088|pid:none) Thermobifida fusca YX, complete... 58 1e-07
CP000828_5601(CP000828|pid:none) Acaryochloris marina MBIC11017,... 58 1e-07
AE004439_320(AE004439|pid:none) Pasteurella multocida subsp. mul... 58 1e-07
CP001131_3532(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 58 1e-07
AE015451_835(AE015451|pid:none) Pseudomonas putida KT2440 comple... 58 1e-07
AM236080_2577(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 58 1e-07
AM494971_126(AM494971|pid:none) Leishmania braziliensis chromoso... 58 1e-07
AM942759_1839(AM942759|pid:none) Proteus mirabilis strain HI4320... 58 1e-07
CP000473_4148(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 57 2e-07
AP011115_868(AP011115|pid:none) Rhodococcus opacus B4 DNA, compl... 57 2e-07
CP000158_2567(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 57 2e-07
AJ821816_1(AJ821816|pid:none) Guillardia theta partial mRNA for ... 57 2e-07
CP000409_60(CP000409|pid:none) Rickettsia canadensis str. McKiel... 57 2e-07
CR555306_3660(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 57 2e-07
AY728387_19(AY728387|pid:none) Cyanobacterium endosymbiont of Rh... 57 2e-07
CP000264_2525(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 57 2e-07
AL646052_1022(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 57 2e-07
CP000362_2748(CP000362|pid:none) Roseobacter denitrificans OCh 1... 57 2e-07
CP000057_429(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 57 2e-07
CP000577_595(CP000577|pid:none) Rhodobacter sphaeroides ATCC 170... 57 2e-07
BX251411_235(BX251411|pid:none) Tropheryma whipplei TW08/27, com... 57 2e-07
CP000463_2938(CP000463|pid:none) Rhodopseudomonas palustris BisA... 57 2e-07
AP009247_510(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 57 2e-07
AE014184_242(AE014184|pid:none) Tropheryma whipplei str. Twist, ... 57 2e-07
(Q01195) RecName: Full=Uncharacterized protein in nifU 5'region;... 57 2e-07
CP000628_1904(CP000628|pid:none) Agrobacterium radiobacter K84 c... 57 3e-07
AL157959_1410(AL157959|pid:none) Neisseria meningitidis serogrou... 57 3e-07
(A4WDA9) RecName: Full=Iron-binding protein iscA; AltName: Full=... 57 3e-07
AE002098_1322(AE002098|pid:none) Neisseria meningitidis MC58, co... 57 3e-07
AE017282_2738(AE017282|pid:none) Methylococcus capsulatus str. B... 57 3e-07
CP001050_1282(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945... 57 3e-07
CP001032_2641(CP001032|pid:none) Opitutus terrae PB90-1, complet... 57 3e-07
CP000847_95(CP000847|pid:none) Rickettsia akari str. Hartford, c... 57 3e-07
CP001111_2586(CP001111|pid:none) Stenotrophomonas maltophilia R5... 57 3e-07
CP000854_3204(CP000854|pid:none) Mycobacterium marinum M, comple... 57 3e-07
AE016958_1944(AE016958|pid:none) Mycobacterium avium subsp. para... 56 3e-07
AM420293_1618(AM420293|pid:none) Saccharopolyspora erythraea NRR... 56 3e-07
CP000133_2209(CP000133|pid:none) Rhizobium etli CFN 42, complete... 56 3e-07
CU458896_1936(CU458896|pid:none) Mycobacterium abscessus chromos... 56 3e-07
CP000479_2188(CP000479|pid:none) Mycobacterium avium 104, comple... 56 3e-07
CP000656_2926(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 56 3e-07
CP000384_3287(CP000384|pid:none) Mycobacterium sp. MCS, complete... 56 3e-07
CP001620_668(CP001620|pid:none) Corynebacterium kroppenstedtii D... 56 4e-07
AM743169_2979(AM743169|pid:none) Stenotrophomonas maltophilia K2... 56 4e-07
CP000480_4126(CP000480|pid:none) Mycobacterium smegmatis str. MC... 56 4e-07
AE014075_2978(AE014075|pid:none) Escherichia coli CFT073, comple... 56 4e-07
CP001339_2032(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 56 4e-07
AE004091_3811(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 56 4e-07
CP000360_1578(CP000360|pid:none) Acidobacteria bacterium Ellin34... 56 4e-07
CP000284_803(CP000284|pid:none) Methylobacillus flagellatus KT, ... 56 4e-07
AE016828_1628(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 55 6e-07
CP001020_165(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 55 6e-07
(A9NAW9) RecName: Full=Iron--sulfur cluster insertion protein er... 55 6e-07
CP000270_2862(CP000270|pid:none) Burkholderia xenovorans LB400 c... 55 6e-07
CP000733_97(CP000733|pid:none) Coxiella burnetii Dugway 5J108-11... 55 6e-07
CP001019_235(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com... 55 6e-07
(A9MHJ6) RecName: Full=Iron-binding protein iscA; AltName: Full=... 55 6e-07
(A7MGY0) RecName: Full=Iron-binding protein iscA; AltName: Full=... 55 6e-07
CP001191_1876(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 55 8e-07
CP000661_338(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 55 8e-07
AP008955_3961(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 55 8e-07
CP001472_2959(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 55 8e-07
AM502253_142(AM502253|pid:none) Leishmania infantum chromosome 35. 55 8e-07
CP001074_2316(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 55 8e-07
AP006618_1715(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 55 8e-07
AM260479_1149(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 55 1e-06
CP000239_1568(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 55 1e-06
(A6TCE9) RecName: Full=Iron-binding protein iscA; AltName: Full=... 55 1e-06
CP000606_2308(CP000606|pid:none) Shewanella loihica PV-4, comple... 55 1e-06
CP000851_1486(CP000851|pid:none) Shewanella pealeana ATCC 700345... 55 1e-06
CP000090_1056(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 55 1e-06
CP000758_2231(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 55 1e-06
(B5XNJ9) RecName: Full=Iron-binding protein iscA; AltName: Full=... 55 1e-06
CP001013_1355(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 55 1e-06
(Q1XDR9) RecName: Full=Uncharacterized protein ycf83; &AP006715... 54 1e-06
CP000472_1620(CP000472|pid:none) Shewanella piezotolerans WP3, c... 54 1e-06
AF2348(AF2348) hypothetical protein all4341 [imported] - Nostoc ... 54 1e-06
CP000301_2804(CP000301|pid:none) Rhodopseudomonas palustris BisB... 54 1e-06
AM286690_1869(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 54 1e-06
BA000045_2105(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 54 1e-06
AM942444_1241(AM942444|pid:none) Corynebacterium urealyticum DSM... 54 2e-06
AY597275_1(AY597275|pid:none) Pseudomonas viridiflava strain ME3... 54 2e-06
AM167904_1510(AM167904|pid:none) Bordetella avium 197N complete ... 54 2e-06
CP001025_2012(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 54 2e-06
CP000781_4575(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 54 2e-06
CU928170_450(CU928170|pid:none) Kluyveromyces thermotolerans str... 54 2e-06
CP000058_1257(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 54 2e-06
CP000113_2522(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 54 2e-06
CU633749_1114(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 54 2e-06
CP000503_1846(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 53 3e-06
CP000267_1823(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 53 3e-06
CP001037_3461(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 53 3e-06
CP000352_1027(CP000352|pid:none) Ralstonia metallidurans CH34, c... 53 3e-06
CP000563_2351(CP000563|pid:none) Shewanella baltica OS155, compl... 53 3e-06
AP009385_2065(AP009385|pid:none) Burkholderia multivorans ATCC 1... 53 3e-06
CP000094_4605(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 53 3e-06
AE017282_243(AE017282|pid:none) Methylococcus capsulatus str. Ba... 53 3e-06
AM494475_1104(AM494475|pid:none) Orientia tsutsugamushi Boryong ... 53 3e-06
CP000951_2033(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 53 3e-06
CP001389_1510(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 53 3e-06
CP000529_2269(CP000529|pid:none) Polaromonas naphthalenivorans C... 53 4e-06
CP000316_2140(CP000316|pid:none) Polaromonas sp. JS666, complete... 53 4e-06
CP000927_2584(CP000927|pid:none) Caulobacter sp. K31, complete g... 53 4e-06
CP000713_1612(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 53 4e-06
CP000555_2254(CP000555|pid:none) Methylibium petroleiphilum PM1,... 53 4e-06
CP000458_2121(CP000458|pid:none) Burkholderia cenocepacia HI2424... 52 5e-06
CP000159_1354(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 52 5e-06
BX950851_1838(BX950851|pid:none) Erwinia carotovora subsp. atros... 52 5e-06
CP000087_945(CP000087|pid:none) Rickettsia bellii RML369-C, comp... 52 5e-06
AE006914_728(AE006914|pid:none) Rickettsia conorii str. Malish 7... 52 5e-06
CP000010_1465(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 52 5e-06
CP000521_1792(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 52 5e-06
CP000380_465(CP000380|pid:none) Burkholderia cenocepacia AU 1054... 52 5e-06
CP001196_1972(CP001196|pid:none) Oligotropha carboxidovorans OM5... 52 5e-06
CR543861_1280(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 52 6e-06
CR937011_13(CR937011|pid:none) uncultured archaeon fos0625e3. 52 6e-06
CP001287_1486(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 52 6e-06
AE017340_149(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 52 6e-06
CP000323_1651(CP000323|pid:none) Psychrobacter cryohalolentis K5... 52 6e-06
CP000961_1761(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 52 6e-06
CP000847_726(CP000847|pid:none) Rickettsia akari str. Hartford, ... 52 8e-06
(P78859) RecName: Full=Iron sulfur assembly protein 1; &AL04949... 52 8e-06
CP000507_1290(CP000507|pid:none) Shewanella amazonensis SB2B, co... 52 8e-06
AE017197_454(AE017197|pid:none) Rickettsia typhi str. Wilmington... 52 8e-06
CP000390_1765(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 51 1e-05
CP000821_2863(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 51 1e-05
CP000282_1416(CP000282|pid:none) Saccharophagus degradans 2-40, ... 51 1e-05
CP000053_843(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 51 1e-05
CP000655_1483(CP000655|pid:none) Polynucleobacter necessarius su... 51 1e-05
CP000766_768(CP000766|pid:none) Rickettsia rickettsii str. Iowa,... 51 1e-05
BX569695_23(BX569695|pid:none) Synechococcus sp. WH8102 complete... 51 1e-05
AM746676_7344(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 51 1e-05
CP000016_347(CP000016|pid:none) Candidatus Blochmannia pennsylva... 51 1e-05
CP000116_1166(CP000116|pid:none) Thiobacillus denitrificans ATCC... 51 1e-05
BT063184_1(BT063184|pid:none) Zea mays full-length cDNA clone ZM... 50 2e-05
CP000542_2328(CP000542|pid:none) Verminephrobacter eiseniae EF01... 50 2e-05
AE003849_2546(AE003849|pid:none) Xylella fastidiosa 9a5c, comple... 50 2e-05
CP000097_332(CP000097|pid:none) Synechococcus sp. CC9902, comple... 50 2e-05
EU953469_1(EU953469|pid:none) Zea mays clone 1418190 HESB-like d... 50 2e-05
CP000302_1448(CP000302|pid:none) Shewanella denitrificans OS217,... 50 2e-05
AE005673_1845(AE005673|pid:none) Caulobacter crescentus CB15, co... 50 2e-05
CP000884_3981(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 50 2e-05
AP009552_98(AP009552|pid:none) Microcystis aeruginosa NIES-843 D... 50 2e-05
CP001340_1932(CP001340|pid:none) Caulobacter crescentus NA1000, ... 50 2e-05
CP001154_2846(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 50 3e-05
(Q12425) RecName: Full=Iron sulfur assembly protein 2; &GN11180... 50 3e-05
CP000159_1284(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 50 3e-05
CP000269_1254(CP000269|pid:none) Janthinobacterium sp. Marseille... 49 4e-05
EU959173_1(EU959173|pid:none) Zea mays clone 211500 HESB-like do... 49 5e-05
CP001029_4365(CP001029|pid:none) Methylobacterium populi BJ001, ... 49 5e-05
CP000449_1317(CP000449|pid:none) Maricaulis maris MCS10, complet... 49 7e-05
AM778944_53(AM778944|pid:none) Microcystis aeruginosa PCC 7806 g... 49 7e-05
AP008232_1431(AP008232|pid:none) Sodalis glossinidius str. 'mors... 49 7e-05
CP000588_271(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 48 9e-05
AY102552_1(AY102552|pid:none) Arabidopsis thaliana hypothetical ... 48 9e-05
AK066672_1(AK066672|pid:none) Oryza sativa Japonica Group cDNA c... 48 9e-05
(P0C7M5) Putative iron-sulfur cluster assembly 1 homolog-like pr... 48 9e-05
AE014298_2294(AE014298|pid:none) Drosophila melanogaster chromos... 48 1e-04
(P74596) RecName: Full=Uncharacterized protein slr1565; &BA0000... 48 1e-04
CP000514_3121(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 48 1e-04
FM992693_225(FM992693|pid:none) Candida dubliniensis CD36 chromo... 48 1e-04
AL589742_3(AL589742|pid:none) Mouse DNA sequence from clone RP23... 48 1e-04
(Q9D924) RecName: Full=Iron-sulfur cluster assembly 1 homolog, m... 48 1e-04
(Q3SZG8) RecName: Full=Iron-sulfur cluster assembly 1 homolog, m... 47 2e-04
CR382122_383(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 47 2e-04
CP000653_1749(CP000653|pid:none) Enterobacter sp. 638, complete ... 47 2e-04
CP001013_1398(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 47 2e-04
CP000880_1550(CP000880|pid:none) Salmonella enterica subsp. ariz... 47 2e-04
CP000822_1668(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 47 2e-04
CP000095_170(CP000095|pid:none) Prochlorococcus marinus str. NAT... 47 2e-04
AL834356_1(AL834356|pid:none) Homo sapiens mRNA; cDNA DKFZp547G0... 47 2e-04
CP001575_515(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 47 2e-04
AC159423_8(AC159423|pid:none) Trypanosoma brucei chromosome 8 cl... 47 2e-04
(Q80W96) RecName: Full=Iron-sulfur cluster assembly 1 homolog, m... 47 2e-04
CP001132_812(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 47 2e-04
AE014075_2017(AE014075|pid:none) Escherichia coli CFT073, comple... 47 2e-04
AE016825_1092(AE016825|pid:none) Chromobacterium violaceum ATCC ... 47 2e-04
(Q8LBM4) RecName: Full=Iron-sulfur assembly protein IscA-like 1,... 47 3e-04
CP000950_1824(CP000950|pid:none) Yersinia pseudotuberculosis YPI... 47 3e-04
BT077303_1(BT077303|pid:none) Caligus rogercresseyi clone crog-e... 47 3e-04
AE009952_1904(AE009952|pid:none) Yersinia pestis KIM, complete g... 47 3e-04

>AY086333_1(AY086333|pid:none) Arabidopsis thaliana clone 24058
mRNA, complete sequence.
Length = 158

Score = 91.7 bits (226), Expect = 7e-18
Identities = 38/84 (45%), Positives = 62/84 (73%)
Frame = +2

Query: 17 LRVMVDMGGCSGYQYIIKVENKLQDDDVLFIRNGAKVIIDKISLEMMEGSIIDYETALMR 196
LR+ V+ GGCSG+QY +++N+ DD +F +NG K+++D +S ++++G+ IDYE L+R
Sbjct: 74 LRLGVETGGCSGFQYKFELDNRTNPDDRVFEKNGVKLVVDNVSYDLVKGATIDYEEELIR 133

Query: 197 SSFVVASNPNTIKSCGCKISFELK 268
++FVVA NP+ + C CK SF +K
Sbjct: 134 AAFVVAVNPSAVGGCSCKSSFMVK 157

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 411,642,267
Number of extensions: 5980097
Number of successful extensions: 13872
Number of sequences better than 10.0: 587
Number of HSP's gapped: 13340
Number of HSP's successfully gapped: 588
Length of query: 130
Length of database: 1,040,966,779
Length adjustment: 95
Effective length of query: 35
Effective length of database: 736,559,704
Effective search space: 25779589640
Effective search space used: 25779589640
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)

PSORT

psg: 0.75 gvh: 0.49 alm: 0.44 top: 0.53 tms: 0.00 mit: 0.32 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

40.0 %: cytoplasmic
40.0 %: nuclear
16.0 %: mitochondrial
4.0 %: peroxisomal

>> prediction for Contig-U06711-1 is cyt

VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0