NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U06672-1
Contig ID Contig-U06672-1
Contig update 2001. 8.30
Contig sequence 
>Contig-U06672-1 (Contig-U06672-1Q) /CSM_Contig/Contig-U06672-1Q.Seq.d
AAATTTTAAAATTTGATAAAAGATGAAAGTCCATTGCCAATTACTAACAA
ATAATAATAATAATAATGAAACAATAGATTTTGAAGTAGATCAAGATAAT
ACTTTATTAGTAGATTTAAAACAAATGATATATAATAAAACTGGTACTCC
AGTAAATAGACAAGCTATTGAATTGGAAAATAAAAAGTTACCACATAGAT
ACGATAAAAAGTCAATATCAAAACTCCACATTAATGAATCATCAAATATA
AGAGTTGTTTATGTTTTGGAAGGTGGCTGTTGCGGTGTTGGTTGTGATAT
TTGTGGTTGTGGTGGAAGTTGTAGATGTTCAATTCAATAAATTTCATAAT
GAGATGTGAGATCTCACATCTTTTTTAATTTGTAAAAAGAAAACAAAATA
AATAAAAATCTTTAAAGAATTTTTTTTTT
Gap no gap
Contig length 429
Chromosome number (1..6, M) 6
Chromosome length 3595308
Start point 3423933
End point 3424362
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 1
Link to clone list U06672
List of clone(s) 

est1=VSE862E,1,430
Translated Amino Acid sequence 
nfki**KMKVHCQLLTNNNNNNETIDFEVDQDNTLLVDLKQMIYNKTGTPVNRQAIELEN
KKLPHRYDKKSISKLHINESSNIRVVYVLEGGCCGVGCDICGCGGSCRCSIQ*is**dvr
shiffnl*kenkinknl*riff
Translated Amino Acid sequence (All Frames) 
Frame A:
kf*nlikdesplpitnk******nnrf*srsr*yfisrfktndi**nwyssk*tsy*igk
*kvtt*ir*kvniktph**iikyksclcfgrwllrcwl*ylwlwwkl*mfnsinfimrce
ishlf*fvkrkqnk*kslknfff


Frame B:
nfki**KMKVHCQLLTNNNNNNETIDFEVDQDNTLLVDLKQMIYNKTGTPVNRQAIELEN
KKLPHRYDKKSISKLHINESSNIRVVYVLEGGCCGVGCDICGCGGSCRCSIQ*is**dvr
shiffnl*kenkinknl*riff


Frame C:
ilkfdkr*ksiany*qiiiiimkq*ilk*ikiily**i*nk*yiiklvlq*idkllnwki
ksyhidtiksqyqnstlmnhqi*elfmfwkvavavlvvifvvvvevvdvqfnkfhnem*d
ltsflickkktk*ikifkefff
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U06672-1 (Contig-U06672-1Q)
/CSM_Contig/Contig-U06672-1Q.Seq.d
         (429 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U06672-1 (Contig-U06672-1Q) /CSM_Contig/Conti...   624  e-179
Contig-U09281-1 (Contig-U09281-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U12457-1 (Contig-U12457-1Q) /CSM_Contig/Conti...    36  0.030
Contig-U11441-1 (Contig-U11441-1Q) /CSM_Contig/Conti...    36  0.030
Contig-U09928-1 (Contig-U09928-1Q) /CSM_Contig/Conti...    36  0.030
Contig-U09347-1 (Contig-U09347-1Q) /CSM_Contig/Conti...    36  0.030
Contig-U14339-1 (Contig-U14339-1Q) /CSM_Contig/Conti...    34  0.12
Contig-U13894-1 (Contig-U13894-1Q) /CSM_Contig/Conti...    34  0.12
Contig-U12672-1 (Contig-U12672-1Q) /CSM_Contig/Conti...    34  0.12
Contig-U12505-1 (Contig-U12505-1Q) /CSM_Contig/Conti...    34  0.12

>Contig-U06672-1 (Contig-U06672-1Q) /CSM_Contig/Contig-U06672-1Q.Seq.d
          Length = 429

 Score =  624 bits (315), Expect = e-179
 Identities = 315/315 (100%)
 Strand = Plus / Plus

                                                                       
Query: 68  gaaacaatagattttgaagtagatcaagataatactttattagtagatttaaaacaaatg 127
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 68  gaaacaatagattttgaagtagatcaagataatactttattagtagatttaaaacaaatg 127

                                                                       
Query: 128 atatataataaaactggtactccagtaaatagacaagctattgaattggaaaataaaaag 187
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 128 atatataataaaactggtactccagtaaatagacaagctattgaattggaaaataaaaag 187

                                                                       
Query: 188 ttaccacatagatacgataaaaagtcaatatcaaaactccacattaatgaatcatcaaat 247
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 188 ttaccacatagatacgataaaaagtcaatatcaaaactccacattaatgaatcatcaaat 247

                                                                       
Query: 248 ataagagttgtttatgttttggaaggtggctgttgcggtgttggttgtgatatttgtggt 307
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 248 ataagagttgtttatgttttggaaggtggctgttgcggtgttggttgtgatatttgtggt 307

                                                                       
Query: 308 tgtggtggaagttgtagatgttcaattcaataaatttcataatgagatgtgagatctcac 367
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 308 tgtggtggaagttgtagatgttcaattcaataaatttcataatgagatgtgagatctcac 367

                          
Query: 368 atcttttttaatttg 382
           |||||||||||||||
Sbjct: 368 atcttttttaatttg 382


 Score = 97.6 bits (49), Expect = 9e-21
 Identities = 49/49 (100%)
 Strand = Plus / Plus

                                                           
Query: 1  aaattttaaaatttgataaaagatgaaagtccattgccaattactaaca 49
          |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1  aaattttaaaatttgataaaagatgaaagtccattgccaattactaaca 49


 Score = 40.1 bits (20), Expect = 0.002
 Identities = 20/20 (100%)
 Strand = Plus / Minus

                               
Query: 352 agatgtgagatctcacatct 371
           ||||||||||||||||||||
Sbjct: 371 agatgtgagatctcacatct 352


 Score = 28.2 bits (14), Expect = 7.2
 Identities = 14/14 (100%)
 Strand = Plus / Minus

                        
Query: 1  aaattttaaaattt 14
          ||||||||||||||
Sbjct: 14 aaattttaaaattt 1


>Contig-U09281-1 (Contig-U09281-1Q) /CSM_Contig/Contig-U09281-1Q.Seq.d
          Length = 907

 Score = 38.2 bits (19), Expect = 0.007
 Identities = 25/27 (92%)
 Strand = Plus / Minus

                                      
Query: 231 ttaatgaatcatcaaatataagagttg 257
           ||||||||||||||||| ||| |||||
Sbjct: 774 ttaatgaatcatcaaatttaatagttg 748


>Contig-U12457-1 (Contig-U12457-1Q) /CSM_Contig/Contig-U12457-1Q.Seq.d
          Length = 1740

 Score = 36.2 bits (18), Expect = 0.030
 Identities = 18/18 (100%)
 Strand = Plus / Plus

                             
Query: 232 taatgaatcatcaaatat 249
           ||||||||||||||||||
Sbjct: 699 taatgaatcatcaaatat 716


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 8296
Number of Sequences: 6905
Number of extensions: 8296
Number of successful extensions: 892
Number of sequences better than 10.0: 247
length of query: 429
length of database: 5,674,871
effective HSP length: 16
effective length of query: 413
effective length of database: 5,564,391
effective search space: 2298093483
effective search space used: 2298093483
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11. 9
Homology vs DNA 
Query= Contig-U06672-1 (Contig-U06672-1Q) /CSM_Contig/Contig-U06672-1Q.Seq.d
         (429 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU263438) Dictyostelium discoideum vegetative cDNA clone:VS...   601   0.0    2
(AJ010592) Guillardia theta DNA for complete sequence of nuc...    40   0.099  5
(ER392321) 1095333028385 Global-Ocean-Sampling_GS-34-01-01-1...    38   0.11   2
(CV565678) taj74g02.x1 Hydra EST UCI 6 Hydra magnipapillata ...    42   0.36   2
(AC168462) Strongylocentrotus purpuratus clone R3-35H4, WORK...    36   0.57   2
(EU168191) Heterosigma akashiwo strain CCMP 452 chloroplast,...    36   0.68   5
(CU024869) M.truncatula DNA sequence from clone MTH2-94B15 o...    42   0.73   2
(AC115789) Mus musculus chromosome 18, clone RP23-398N2, com...    46   1.0    1
(AC184804) Canis familiaris chromosome 14, clone XX-54L5, co...    46   1.0    1
(AC090445) Canis familiaris clone RP81-55A4, complete sequence.    46   1.0    1
(AC172347) Bos taurus clone CH240-164E16, WORKING DRAFT SEQU...    46   1.0    1
(DH051520) Oryzias latipes Fosmid clone:GOLWFno100_i07, forw...    46   1.0    1
(DN952724) G10-SC-P1 Adult salivary gland cDNA library XWJRA...    46   1.0    1
(AC215437) Solanum lycopersicum chromosome 2 clone C02HBa032...    44   2.0    5
(AC182740) Gasterosteus aculeatus clone VMRC26-91C14, comple...    36   2.1    5
(CT583629) Zebrafish DNA sequence *** SEQUENCING CANCELLED *...    42   2.6    3
(AC078831) Staphylococcus aureus clone sabac-124, complete s...    36   2.7    4
(EF486306) Ictalurus punctatus matrix metalloproteinase-9 ge...    44   4.0    1
(DQ516066) Ictalurus punctatus tissue-type liver matrix meta...    44   4.0    1
(BV674705) S216P60597RD5.T0 Masuku Pan troglodytes troglodyt...    44   4.0    1
(AL137018) Human DNA sequence from clone RP11-133M9 on chrom...    44   4.0    1
(AC127803) Rattus norvegicus clone CH230-16L12, *** SEQUENCI...    44   4.0    1
(EJ930868) 1093018805105 Global-Ocean-Sampling_GS-30-02-01-1...    44   4.0    1
(EJ840360) 1093017826776 Global-Ocean-Sampling_GS-30-02-01-1...    44   4.0    1
(DH023715) Oryzias latipes Fosmid clone:GOLWFno36_n17, forwa...    44   4.0    1
(EB213465) PEG002-C-012291-501 Normalized Pedal-Pleural Gang...    44   4.0    1
(DV384619) NADC590TR Aedes aegypti infected with Dengue viru...    44   4.0    1
(DV384617) NADC590TF Aedes aegypti infected with Dengue viru...    44   4.0    1
(CR743003) RZPD Homo sapiens cDNA clone IMAGp998L245819 = IM...    44   4.0    1
(CK413011) AUF_IpGil_04_d05 Ictalurus punctatus gill cDNA li...    44   4.0    1
(CK412988) AUF_IpGil_04_c05 Ictalurus punctatus gill cDNA li...    44   4.0    1
(CK410458) AUF_IpHdk_43_b05 Head kidney cDNA library Ictalur...    44   4.0    1
(CK404169) AUF_IfHdk_244_j13 Ictalurus furcatus head kidney ...    44   4.0    1
(CK403483) AUF_IfHdk_242_g19 Ictalurus furcatus head kidney ...    44   4.0    1
(BW687109) Solanum lycopersicum cDNA, clone: FC08AH01, 5' en...    44   4.0    1
(BP880848) Solanum lycopersicum cDNA, clone: FA18CD06, 5' en...    44   4.0    1
(BE431448) EST336262 tomato breaker fruit, TIGR Solanum lyco...    44   4.0    1
(AW399708) EST310208 L. pennellii trichome, Cornell Universi...    44   4.0    1
(AC194990) Pan troglodytes BAC clone CH251-551K5 from chromo...    36   4.1    5
(AC183460) Atelerix albiventris clone LB4-43N23, WORKING DRA...    40   4.6    4
(AC069256) Homo sapiens 3 BAC RP11-445G6 (Roswell Park Cance...    36   5.2    6
(AP004714) Homo sapiens genomic DNA, chromosome 8q23, clone:...    34   5.7    5
(CV847739) ID0AEE3CF09RM1 ID0AEE Acyrthosiphon pisum cDNA cl...    34   5.8    2
(EU168190) Heterosigma akashiwo strain NIES 293 chloroplast,...    36   6.5    5
(EK412398) 1095505203690 Global-Ocean-Sampling_GS-31-01-01-1...    38   6.5    2
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067...    36   8.4    6
(EF175764) Romanomermis iyengari mitochondrion, complete gen...    32   8.4    2
(CG745438) P038-2-D10.za Ppa EcoRI BAC Library Pristionchus ...    30   9.2    3
(CW938560) TcB18.3_F07_SP6 Tribolium BAC library Tribolium c...    32   9.8    2

>(AU263438) Dictyostelium discoideum vegetative cDNA clone:VSE862,
           3' end single read.
          Length = 430

 Score =  601 bits (303), Expect(2) = 0.0
 Identities = 303/303 (100%)
 Strand = Plus / Plus


Query: 68  gaaacaatagattttgaagtagatcaagataatactttattagtagatttaaaacaaatg 127
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 68  gaaacaatagattttgaagtagatcaagataatactttattagtagatttaaaacaaatg 127


Query: 128 atatataataaaactggtactccagtaaatagacaagctattgaattggaaaataaaaag 187
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 128 atatataataaaactggtactccagtaaatagacaagctattgaattggaaaataaaaag 187


Query: 188 ttaccacatagatacgataaaaagtcaatatcaaaactccacattaatgaatcatcaaat 247
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 188 ttaccacatagatacgataaaaagtcaatatcaaaactccacattaatgaatcatcaaat 247


Query: 248 ataagagttgtttatgttttggaaggtggctgttgcggtgttggttgtgatatttgtggt 307
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 248 ataagagttgtttatgttttggaaggtggctgttgcggtgttggttgtgatatttgtggt 307


Query: 308 tgtggtggaagttgtagatgttcaattcaataaatttcataatgagatgtgagatctcac 367
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 308 tgtggtggaagttgtagatgttcaattcaataaatttcataatgagatgtgagatctcac 367


Query: 368 atc 370
           |||
Sbjct: 368 atc 370

 Score = 97.6 bits (49), Expect(2) = 0.0
 Identities = 49/49 (100%)
 Strand = Plus / Plus


Query: 1  aaattttaaaatttgataaaagatgaaagtccattgccaattactaaca 49
          |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1  aaattttaaaatttgataaaagatgaaagtccattgccaattactaaca 49

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 485,076,886
Number of extensions: 31876455
Number of successful extensions: 2722077
Number of sequences better than 10.0: 50
Length of query: 429
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 406
Effective length of database: 93,106,754,628
Effective search space: 37801342378968
Effective search space used: 37801342378968
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 6.22
Homology vs Protein 
Query= Contig-U06672-1 (Contig-U06672-1Q) /CSM_Contig/Contig-U06672-1Q.Seq.d
         (429 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M30305_1(M30305|pid:none) A.californica nuclear polyhedrosis vir...    35   0.63
AC146866_19(AC146866|pid:none) Medicago truncatula clone mth2-19...    34   1.4
AE014298_202(AE014298|pid:none) Drosophila melanogaster chromoso...    33   2.4
DQ837165_21(DQ837165|pid:none) Ecotropis obliqua NPV strain A1, ...    33   2.4
AE014298_203(AE014298|pid:none) Drosophila melanogaster chromoso...    33   2.4
FJ227128_48(FJ227128|pid:none) Euproctis pseudoconspersa nucleop...    32   5.3
DQ325038_1(DQ325038|pid:none) Apis dorsata complementary sex det...    32   6.9
AF270937_43(AF270937|pid:none) Plutella xylostella granulovirus ...    32   6.9
AF063866_144(AF063866|pid:none) Melanoplus sanguinipes entomopox...    32   9.1

>M30305_1(M30305|pid:none) A.californica nuclear polyhedrosis virus
           ubiquitin-like protein gene, complete cds.
           &UQNVAC(A34813;E45355)
          Length = 77

 Score = 35.4 bits (80), Expect = 0.63
 Identities = 21/64 (32%), Positives = 37/64 (57%)
 Frame = +2

Query: 68  ETIDFEVDQDNTLLVDLKQMIYNKTGTPVNRQAIELENKKLPHRYDKKSISKLHINESSN 247
           +TI  E + + T+  DLKQ I +K G PV++Q +    K+L    D K+++  +I + S
Sbjct: 11  KTITAETEPEETV-ADLKQKIADKEGVPVDQQRLIFAGKQLE---DSKTMADYNIQKEST 66

Query: 248 IRVV 259
           + +V
Sbjct: 67  LHMV 70

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 462,583,456
Number of extensions: 6910247
Number of successful extensions: 24125
Number of sequences better than 10.0: 9
Number of HSP's gapped: 23576
Number of HSP's successfully gapped: 9
Length of query: 143
Length of database: 1,040,966,779
Length adjustment: 106
Effective length of query: 37
Effective length of database: 701,312,569
Effective search space: 25948565053
Effective search space used: 25948565053
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)
PSORT 

 psg: 0.75  gvh: 0.21  alm: 0.37  top: 0.53  tms: 0.00  mit: 0.25  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 1.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 32.0 %: nuclear
	 20.0 %: plasma membrane
	 20.0 %: cytoplasmic
	  8.0 %: extracellular, including cell wall
	  8.0 %: Golgi
	  8.0 %: vesicles of secretory system
	  4.0 %: cytoskeletal

>> prediction for Contig-U06672-1 is nuc
VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0