NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U06293-1
Contig ID Contig-U06293-1
Contig update 2002. 9.13
Contig sequence 
>Contig-U06293-1 (Contig-U06293-1Q) /CSM_Contig/Contig-U06293-1Q.Seq.d
CGAACTTTGGTGGAAAATTGGTGGAATTAGCGCTTGTAGTGCTATTATTT
CAGGTGCTTATGGTGGACATGGATTAAAGAAAAAAGTTACTGATGTAGCA
CGTCAAGATATTTGGAAAACTGCACAACAATACCATCTTTATCATTCATT
TGCCTTATTCCTTGTTCCATTCTCAACACAACAAAATATTGTTGGTCCAA
TGTTTTTAACTGGAATTTTATTATTTAGTGGATCATTATATAATTTATCA
CTTACAAATAGAAAAATAGGTGTTTCTCCAATTGGTGGATTCTTGTTTAT
GGCAGGTTGGGTAATTTTAGGAATGACATTAGATAAATCATTATTTTTAA
GAAATTAATTTTAAATTTTTTTATCTTTTTTAAAAAACAATAATAATAAC
AAATAAATATTAAACTTTTTTAAATCTTTTTTTTTTTTTTTTTAATTTAA
AAAAAA
Gap no gap
Contig length 456
Chromosome number (1..6, M) 1
Chromosome length 4919822
Start point 3513139
End point 3512691
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 1
Link to clone list U06293
List of clone(s) 

est1=VSA644E,1,457
Translated Amino Acid sequence 
ELWWKIGGISACSAIISGAYGGHGLKKKVTDVARQDIWKTAQQYHLYHSFALFLVPFSTQ
QNIVGPMFLTGILLFSGSLYNLSLTNRKIGVSPIGGFLFMAGWVILGMTLDKSLFLRN*f
*iflsflknnnnnk*ilnffksfffff*fkk
Translated Amino Acid sequence (All Frames) 
Frame A:
rtlvenwwn*rl*cyyfrclwwtwikeksy*cstsrylencttipslsficlipcsilnt
tkycwsnvfnwnfii*wiii*fityk*knrcfsnwwilvygrlgnfrndir*iiifkkli
lnffiffkkq***qiniklf*ifffffli*kk


Frame B:
ELWWKIGGISACSAIISGAYGGHGLKKKVTDVARQDIWKTAQQYHLYHSFALFLVPFSTQ
QNIVGPMFLTGILLFSGSLYNLSLTNRKIGVSPIGGFLFMAGWVILGMTLDKSLFLRN*f
*iflsflknnnnnk*ilnffksfffff*fkk


Frame C:
nfggklvelalvvllfqvlmvdmd*rkkllm*hvkifgklhnntifiihlpyslfhsqhn
killvqcf*lefyylvdhyiiyhlqiek*vflqlvdsclwqvg*f*e*h*inhyf*einf
kffylf*ktiiitnky*tflnlfffffnlkk
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U06293-1 (Contig-U06293-1Q)
/CSM_Contig/Contig-U06293-1Q.Seq.d
         (456 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U06293-1 (Contig-U06293-1Q) /CSM_Contig/Conti...   672  0.0
Contig-U11702-1 (Contig-U11702-1Q) /CSM_Contig/Conti...    36  0.032
Contig-U13893-1 (Contig-U13893-1Q) /CSM_Contig/Conti...    34  0.12
Contig-U12461-1 (Contig-U12461-1Q) /CSM_Contig/Conti...    34  0.12
Contig-U10907-1 (Contig-U10907-1Q) /CSM_Contig/Conti...    34  0.12
Contig-U04335-1 (Contig-U04335-1Q) /CSM_Contig/Conti...    34  0.12
Contig-U14597-1 (Contig-U14597-1Q) /CSM_Contig/Conti...    32  0.49
Contig-U13021-1 (Contig-U13021-1Q) /CSM_Contig/Conti...    32  0.49
Contig-U12490-1 (Contig-U12490-1Q) /CSM_Contig/Conti...    32  0.49
Contig-U12447-1 (Contig-U12447-1Q) /CSM_Contig/Conti...    32  0.49

>Contig-U06293-1 (Contig-U06293-1Q) /CSM_Contig/Contig-U06293-1Q.Seq.d
          Length = 456

 Score =  672 bits (339), Expect = 0.0
 Identities = 339/339 (100%)
 Strand = Plus / Plus

                                                                       
Query: 1   cgaactttggtggaaaattggtggaattagcgcttgtagtgctattatttcaggtgctta 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   cgaactttggtggaaaattggtggaattagcgcttgtagtgctattatttcaggtgctta 60

                                                                       
Query: 61  tggtggacatggattaaagaaaaaagttactgatgtagcacgtcaagatatttggaaaac 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  tggtggacatggattaaagaaaaaagttactgatgtagcacgtcaagatatttggaaaac 120

                                                                       
Query: 121 tgcacaacaataccatctttatcattcatttgccttattccttgttccattctcaacaca 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tgcacaacaataccatctttatcattcatttgccttattccttgttccattctcaacaca 180

                                                                       
Query: 181 acaaaatattgttggtccaatgtttttaactggaattttattatttagtggatcattata 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 acaaaatattgttggtccaatgtttttaactggaattttattatttagtggatcattata 240

                                                                       
Query: 241 taatttatcacttacaaatagaaaaataggtgtttctccaattggtggattcttgtttat 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 taatttatcacttacaaatagaaaaataggtgtttctccaattggtggattcttgtttat 300

                                                  
Query: 301 ggcaggttgggtaattttaggaatgacattagataaatc 339
           |||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ggcaggttgggtaattttaggaatgacattagataaatc 339


>Contig-U11702-1 (Contig-U11702-1Q) /CSM_Contig/Contig-U11702-1Q.Seq.d
          Length = 1606

 Score = 36.2 bits (18), Expect = 0.032
 Identities = 18/18 (100%)
 Strand = Plus / Plus

                             
Query: 218 ttattatttagtggatca 235
           ||||||||||||||||||
Sbjct: 260 ttattatttagtggatca 277


>Contig-U13893-1 (Contig-U13893-1Q) /CSM_Contig/Contig-U13893-1Q.Seq.d
          Length = 1750

 Score = 34.2 bits (17), Expect = 0.12
 Identities = 17/17 (100%)
 Strand = Plus / Plus

                            
Query: 209 actggaattttattatt 225
           |||||||||||||||||
Sbjct: 13  actggaattttattatt 29


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 5908
Number of Sequences: 6905
Number of extensions: 5908
Number of successful extensions: 523
Number of sequences better than 10.0: 154
length of query: 456
length of database: 5,674,871
effective HSP length: 16
effective length of query: 440
effective length of database: 5,564,391
effective search space: 2448332040
effective search space used: 2448332040
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11. 8
Homology vs DNA 
Query= Contig-U06293-1 (Contig-U06293-1Q) /CSM_Contig/Contig-U06293-1Q.Seq.d
         (456 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU261627) Dictyostelium discoideum vegetative cDNA clone:VS...   617   e-172  1
(EA008994) Sequence 7 from patent US 7122727.                      38   0.44   2
(AX058819) Sequence 7 from Patent WO0077229.                       38   0.44   2
(AR236164) Sequence 7 from patent US 6462256.                      38   0.44   2
(EA008995) Sequence 9 from patent US 7122727.                      38   0.47   2
(AX058821) Sequence 9 from Patent WO0077229.                       38   0.47   2
(AR236165) Sequence 9 from patent US 6462256.                      38   0.47   2
(CU100755) Equus caballus GSS, BAC clone CH241-205F14, T7 en...    46   1.1    1
(AC116522) Mus musculus clone RP24-343M23, WORKING DRAFT SEQ...    44   1.3    5
(AC166176) Mus musculus 6 BAC RP24-325F2 (Roswell Park Cance...    44   4.3    1
(CU695270) Brassica rapa subsp. pekinensis clone KBrB082G02,...    44   4.3    1
(AZ670708) ENTKJ31TF Entamoeba histolytica Sheared DNA Entam...    44   4.3    1
(ED997782) MUGQ_CH252P110P03T7_CN57_002 CHORI-252 Vervet Mon...    44   4.3    1
(AC108666) Rattus norvegicus clone CH230-236D9, *** SEQUENCI...    40   4.6    6
(AC174340) Medicago truncatula clone mth2-161g1, complete se...    38   5.5    3
(EJ412328) 1093012157352 Global-Ocean-Sampling_GS-28-01-01-1...    34   5.7    2
(BX538350) Cryptosporidium parvum chromosome 6, complete seq...    32   7.5    2

>(AU261627) Dictyostelium discoideum vegetative cDNA clone:VSA644,
           3' end single read.
          Length = 457

 Score =  617 bits (311), Expect = e-172
 Identities = 311/311 (100%)
 Strand = Plus / Plus


Query: 1   cgaactttggtggaaaattggtggaattagcgcttgtagtgctattatttcaggtgctta 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   cgaactttggtggaaaattggtggaattagcgcttgtagtgctattatttcaggtgctta 60


Query: 61  tggtggacatggattaaagaaaaaagttactgatgtagcacgtcaagatatttggaaaac 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  tggtggacatggattaaagaaaaaagttactgatgtagcacgtcaagatatttggaaaac 120


Query: 121 tgcacaacaataccatctttatcattcatttgccttattccttgttccattctcaacaca 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tgcacaacaataccatctttatcattcatttgccttattccttgttccattctcaacaca 180


Query: 181 acaaaatattgttggtccaatgtttttaactggaattttattatttagtggatcattata 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 acaaaatattgttggtccaatgtttttaactggaattttattatttagtggatcattata 240


Query: 241 taatttatcacttacaaatagaaaaataggtgtttctccaattggtggattcttgtttat 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 taatttatcacttacaaatagaaaaataggtgtttctccaattggtggattcttgtttat 300


Query: 301 ggcaggttggg 311
           |||||||||||
Sbjct: 301 ggcaggttggg 311

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 419,017,790
Number of extensions: 27330453
Number of successful extensions: 2181419
Number of sequences better than 10.0: 17
Length of query: 456
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 433
Effective length of database: 93,106,754,628
Effective search space: 40315224753924
Effective search space used: 40315224753924
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 6.21
Homology vs Protein 
Query= Contig-U06293-1 (Contig-U06293-1Q) /CSM_Contig/Contig-U06293-1Q.Seq.d
         (456 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CP000951_1984(CP000951|pid:none) Synechococcus sp. PCC 7002, com...    71   1e-11
AL009126_3916(AL009126|pid:none) Bacillus subtilis subsp. subtil...    69   5e-11
CP000560_3399(CP000560|pid:none) Bacillus amyloliquefaciens FZB4...    69   5e-11
CP000813_3391(CP000813|pid:none) Bacillus pumilus SAFR-032, comp...    68   1e-10
CP000764_3721(CP000764|pid:none) Bacillus cereus subsp. cytotoxi...    67   1e-10
CP000383_2622(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334...    67   1e-10
CP001291_4797(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    67   3e-10
(Q2FJ60) RecName: Full=UPF0382 membrane protein SAUSA300_0565;  ...    66   3e-10
AE017333_3830(AE017333|pid:none) Bacillus licheniformis DSM 13, ...    66   3e-10
AE017340_859(AE017340|pid:none) Idiomarina loihiensis L2TR, comp...    66   3e-10
CP000002_3823(CP000002|pid:none) Bacillus licheniformis ATCC 145...    66   3e-10
CP001037_1456(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    66   4e-10
(Q4L3Q9) RecName: Full=UPF0382 membrane protein SH2409;                66   4e-10
CP000817_907(CP000817|pid:none) Lysinibacillus sphaericus C3-41,...    66   4e-10
AP006716_2409(AP006716|pid:none) Staphylococcus haemolyticus JCS...    66   4e-10
(Q2YS64) RecName: Full=UPF0382 membrane protein SAB0533;  &AJ938...    65   6e-10
CR954246_1027(CR954246|pid:none) Pseudoalteromonas haloplanktis ...    65   7e-10
AP009484_1843(AP009484|pid:none) Macrococcus caseolyticus JCSC54...    65   7e-10
AE017355_5023(AE017355|pid:none) Bacillus thuringiensis serovar ...    65   7e-10
CP001176_5314(CP001176|pid:none) Bacillus cereus B4264, complete...    65   1e-09
AE016877_5144(AE016877|pid:none) Bacillus cereus ATCC 14579, com...    65   1e-09
AE017194_5485(AE017194|pid:none) Bacillus cereus ATCC 10987, com...    65   1e-09
CP000029_226(CP000029|pid:none) Staphylococcus epidermidis RP62A...    65   1e-09
AE016879_5219(AE016879|pid:none) Bacillus anthracis str. Ames, c...    65   1e-09
CP000304_3900(CP000304|pid:none) Pseudomonas stutzeri A1501, com...    64   2e-09
CP000469_2874(CP000469|pid:none) Shewanella sp. ANA-3, complete ...    64   2e-09
BT067989_1(BT067989|pid:none) Zea mays full-length cDNA clone ZM...    64   2e-09
BA000043_3419(BA000043|pid:none) Geobacillus kaustophilus HTA426...    63   3e-09
CP000563_1347(CP000563|pid:none) Shewanella baltica OS155, compl...    63   3e-09
EU969194_1(EU969194|pid:none) Zea mays clone 326744 hypothetical...    63   3e-09
AC137995_21(AC137995|pid:none) Medicago truncatula clone mth2-11...    63   4e-09
CP000774_2485(CP000774|pid:none) Parvibaculum lavamentivorans DS...    63   4e-09
(Q49VD3) RecName: Full=UPF0382 membrane protein SSP2132;               62   5e-09
CP000828_729(CP000828|pid:none) Acaryochloris marina MBIC11017, ...    62   5e-09
CP000444_2772(CP000444|pid:none) Shewanella sp. MR-7, complete g...    62   5e-09
CP000302_2545(CP000302|pid:none) Shewanella denitrificans OS217,...    62   5e-09
CP000744_477(CP000744|pid:none) Pseudomonas aeruginosa PA7, comp...    62   6e-09
CP000975_107(CP000975|pid:none) Methylacidiphilum infernorum V4,...    62   6e-09
BA000004_3828(BA000004|pid:none) Bacillus halodurans C-125 DNA, ...    62   8e-09
CP000446_2711(CP000446|pid:none) Shewanella sp. MR-4, complete g...    62   8e-09
CP000934_3426(CP000934|pid:none) Cellvibrio japonicus Ueda107, c...    62   8e-09
AE014299_1508(AE014299|pid:none) Shewanella oneidensis MR-1, com...    62   8e-09
AY657409_1(AY657409|pid:none) Synthetic construct Peudomonas aer...    62   8e-09
AE2206(AE2206) hypothetical protein alr3204 [imported] - Nostoc ...    61   1e-08
CP000681_1276(CP000681|pid:none) Shewanella putrefaciens CN-32, ...    61   1e-08
AP006627_3910(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c...    60   2e-08
AL954747_1174(AL954747|pid:none) Nitrosomonas europaea ATCC 1971...    60   2e-08
AC006955_3(AC006955|pid:none) Arabidopsis thaliana chromosome 2 ...    60   2e-08
BA000028_3027(BA000028|pid:none) Oceanobacillus iheyensis HTE831...    60   2e-08
H84462(H84462)hypothetical protein At2g04900 [imported] - Arabid...    60   2e-08
AY062806_1(AY062806|pid:none) Arabidopsis thaliana Unknown prote...    60   2e-08
CP000159_2489(CP000159|pid:none) Salinibacter ruber DSM 13855, c...    60   3e-08
CP000606_2755(CP000606|pid:none) Shewanella loihica PV-4, comple...    60   3e-08
EF083425_1(EF083425|pid:none) Picea sitchensis clone WS02719_J10...    60   3e-08
CP000393_3925(CP000393|pid:none) Trichodesmium erythraeum IMS101...    60   3e-08
BT082541_1(BT082541|pid:none) Anoplopoma fimbria clone afim-evh-...    59   5e-08
AM902716_2346(AM902716|pid:none) Bordetella petrii strain DSM 12...    59   5e-08
(Q9P7G8) RecName: Full=UPF0382 membrane protein C1782.12c; Flags...    59   5e-08
CP000507_2419(CP000507|pid:none) Shewanella amazonensis SB2B, co...    59   5e-08
CP000680_4141(CP000680|pid:none) Pseudomonas mendocina ymp, comp...    59   5e-08
CP000113_2311(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    59   7e-08
CP000926_5124(CP000926|pid:none) Pseudomonas putida GB-1, comple...    59   7e-08
CP001219_146(CP001219|pid:none) Acidithiobacillus ferrooxidans A...    58   9e-08
(P39619) RecName: Full=UPF0382 membrane protein ywdK;  &S39716(S...    58   9e-08
CP000076_5759(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c...    58   9e-08
CP001132_323(CP001132|pid:none) Acidithiobacillus ferrooxidans A...    58   9e-08
FN357882_8(FN357882|pid:none) Schistosoma mansoni genome sequenc...    58   1e-07
AE015451_5037(AE015451|pid:none) Pseudomonas putida KT2440 compl...    57   2e-07
(Q568J8) RecName: Full=UPF0451 protein C17orf61 homolog; Flags: ...    57   2e-07
CP000117_3881(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    57   2e-07
CP000020_585(CP000020|pid:none) Vibrio fischeri ES114 chromosome...    57   2e-07
CP001615_1448(CP001615|pid:none) Exiguobacterium sp. AT1b, compl...    57   2e-07
CP000472_3451(CP000472|pid:none) Shewanella piezotolerans WP3, c...    57   2e-07
CP000961_3434(CP000961|pid:none) Shewanella woodyi ATCC 51908, c...    57   3e-07
AE016853_418(AE016853|pid:none) Pseudomonas syringae pv. tomato ...    56   3e-07
CP000103_1025(CP000103|pid:none) Nitrosospira multiformis ATCC 2...    56   3e-07
CR378672_240(CR378672|pid:none) Photobacterium profundum SS9; se...    56   3e-07
CU207366_1058(CU207366|pid:none) Gramella forsetii KT0803 comple...    56   3e-07
CP000931_3043(CP000931|pid:none) Shewanella halifaxensis HAW-EB4...    56   3e-07
CP000094_5327(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ...    56   4e-07
CP001131_4099(CP001131|pid:none) Anaeromyxobacter sp. K, complet...    56   4e-07
CP000821_3311(CP000821|pid:none) Shewanella sediminis HAW-EB3, c...    55   6e-07
BX908798_1044(BX908798|pid:none) Parachlamydia-related symbiont ...    55   8e-07
CT573326_270(CT573326|pid:none) Pseudomonas entomophila str. L48...    55   8e-07
CP000851_2970(CP000851|pid:none) Shewanella pealeana ATCC 700345...    55   1e-06
CP000450_1463(CP000450|pid:none) Nitrosomonas eutropha C91, comp...    55   1e-06
A87402(A87402) conserved hypothetical protein CC1231 [imported] ...    55   1e-06
CP000473_5429(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    54   1e-06
CP000569_678(CP000569|pid:none) Actinobacillus pleuropneumoniae ...    54   2e-06
CP001175_1937(CP001175|pid:none) Listeria monocytogenes HCC23, c...    54   2e-06
FN315391_1(FN315391|pid:none) Schistosoma japonicum isolate Anhu...    54   2e-06
CP000777_3145(CP000777|pid:none) Leptospira biflexa serovar Pato...    54   2e-06
AM286415_3148(AM286415|pid:none) Yersinia enterocolitica subsp. ...    54   2e-06
AY222975_1(AY222975|pid:none) Schistosoma japonicum clone ZZZ67 ...    54   2e-06
FN320757_1(FN320757|pid:none) Schistosoma japonicum isolate Anhu...    54   2e-06
FN315393_1(FN315393|pid:none) Schistosoma japonicum isolate Anhu...    54   2e-06
AM286690_2570(AM286690|pid:none) Alcanivorax borkumensis SK2, co...    54   2e-06
CP000388_2186(CP000388|pid:none) Pseudoalteromonas atlantica T6c...    54   2e-06
CP000075_4741(CP000075|pid:none) Pseudomonas syringae pv. syring...    54   2e-06
AB1158(AB1158) hypothetical protein lmo0666 [imported] - Listeri...    54   2e-06
CP001157_288(CP001157|pid:none) Azotobacter vinelandii DJ, compl...    53   3e-06
AM263198_634(AM263198|pid:none) Listeria welshimeri serovar 6b s...    53   3e-06
CP000685_1359(CP000685|pid:none) Flavobacterium johnsoniae UW101...    53   4e-06
AY094648_1(AY094648|pid:none) Drosophila melanogaster AT09463 fu...    53   4e-06
AE014297_2818(AE014297|pid:none) Drosophila melanogaster chromos...    53   4e-06
AG1516(AG1516) hypothetical protein homolog lin0671 [imported] -...    52   5e-06
AE014298_1396(AE014298|pid:none) Drosophila melanogaster chromos...    52   5e-06
AF241510_1(AF241510|pid:none) Haynaldia villosa 5V CDO504 unknow...    52   6e-06
CP000361_841(CP000361|pid:none) Arcobacter butzleri RM4018, comp...    52   8e-06
CP001114_944(CP001114|pid:none) Deinococcus deserti VCD115, comp...    52   8e-06
AE017282_2281(AE017282|pid:none) Methylococcus capsulatus str. B...    52   8e-06
CP000323_226(CP000323|pid:none) Psychrobacter cryohalolentis K5,...    52   8e-06
CP000822_4056(CP000822|pid:none) Citrobacter koseri ATCC BAA-895...    51   1e-05
CP000613_1883(CP000613|pid:none) Rhodospirillum centenum SW, com...    51   1e-05
AY190957_2(AY190957|pid:none) Drosophila willistoni clone DWIF01...    51   1e-05
AE0126(AE0126) conserved hypothetical protein YPO1030 [imported]...    51   1e-05
AF241509_1(AF241509|pid:none) Psathyrostachys juncea 5N CDO504 u...    51   1e-05
CP000057_1080(CP000057|pid:none) Haemophilus influenzae 86-028NP...    51   1e-05
AE009952_3107(AE009952|pid:none) Yersinia pestis KIM, complete g...    51   1e-05
(P45019) RecName: Full=UPF0382 membrane protein HI1073;  &CP0006...    51   1e-05
AF236870_1(AF236870|pid:none) Hordeum vulgare Morex 7 (5H) CDO50...    50   2e-05
CP000359_760(CP000359|pid:none) Deinococcus geothermalis DSM 113...    50   2e-05
CP000348_72(CP000348|pid:none) Leptospira borgpetersenii serovar...    50   2e-05
CP001032_695(CP001032|pid:none) Opitutus terrae PB90-1, complete...    50   2e-05
AE008692_592(AE008692|pid:none) Zymomonas mobilis subsp. mobilis...    50   3e-05
AP006725_4025(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204...    50   3e-05
BX950851_1003(BX950851|pid:none) Erwinia carotovora subsp. atros...    49   4e-05
CP000521_2508(CP000521|pid:none) Acinetobacter baumannii ATCC 17...    49   5e-05
CP000510_1538(CP000510|pid:none) Psychromonas ingrahamii 37, com...    49   5e-05
CP000350_2612(CP000350|pid:none) Leptospira borgpetersenii serov...    49   5e-05
CR543861_1193(CR543861|pid:none) Acinetobacter sp. ADP1 complete...    49   5e-05
CP000857_2933(CP000857|pid:none) Salmonella enterica subsp. ente...    49   7e-05
CP000644_2962(CP000644|pid:none) Aeromonas salmonicida subsp. sa...    49   7e-05
AM933173_2787(AM933173|pid:none) Salmonella enterica subsp. ente...    49   7e-05
CP000783_487(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-...    49   7e-05
CP000713_350(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple...    48   9e-05
BA000031_694(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221...    48   9e-05
AP008232_1955(AP008232|pid:none) Sodalis glossinidius str. 'mors...    48   1e-04
FM954972_2275(FM954972|pid:none) Vibrio splendidus LGP32 chromos...    48   1e-04
BA000037_880(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr...    48   1e-04
BX294146_42(BX294146|pid:none) Rhodopirellula baltica SH 1 compl...    48   1e-04
AE004439_770(AE004439|pid:none) Pasteurella multocida subsp. mul...    48   1e-04
CP000789_1113(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch...    47   2e-04
AE014075_3295(AE014075|pid:none) Escherichia coli CFT073, comple...    46   4e-04
CP000468_2740(CP000468|pid:none) Escherichia coli APEC O1, compl...    46   4e-04
AM942759_2277(AM942759|pid:none) Proteus mirabilis strain HI4320...    46   4e-04
(P0ADR2) RecName: Full=UPF0382 inner membrane protein ygdD;  &(P...    46   4e-04
CP000243_3121(CP000243|pid:none) Escherichia coli UTI89, complet...    46   4e-04
CP000927_1594(CP000927|pid:none) Caulobacter sp. K31, complete g...    45   6e-04
CP000158_2872(CP000158|pid:none) Hyphomonas neptunium ATCC 15444...    45   6e-04
EU958045_1(EU958045|pid:none) Zea mays clone 1669998 unknown mRNA.     45   6e-04
FP236842_2854(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9...    44   0.002
CP000155_5829(CP000155|pid:none) Hahella chejuensis KCTC 2396, c...    44   0.002
(Q2KI29) RecName: Full=UPF0451 protein C17orf61 homolog; Flags: ...    42   0.009
AM743169_1192(AM743169|pid:none) Stenotrophomonas maltophilia K2...    41   0.015
AX588157_1(AX588157|pid:none) Sequence 32 from Patent WO02083898...    40   0.019
(Q5F285) RecName: Full=UPF0451 protein C17orf61 homolog; Flags: ...    40   0.025
CU459003_1130(CU459003|pid:none) Magnetospirillum gryphiswaldens...    40   0.033
AE008923_1211(AE008923|pid:none) Xanthomonas axonopodis pv. citr...    40   0.033
AE013598_3455(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K...    39   0.043
CP000967_1281(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P...    39   0.043
AE008922_1110(AE008922|pid:none) Xanthomonas campestris pv. camp...    39   0.056
CP000230_3197(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117...    39   0.056
AM494965_165(AM494965|pid:none) Leishmania braziliensis chromoso...    39   0.073
AM039952_1263(AM039952|pid:none) Xanthomonas campestris pv. vesi...    39   0.073
CP001154_1591(CP001154|pid:none) Laribacter hongkongensis HLHK9,...    38   0.13
CP000699_4(CP000699|pid:none) Sphingomonas wittichii RW1, comple...    38   0.13
CP001029_2272(CP001029|pid:none) Methylobacterium populi BJ001, ...    37   0.16
CP000708_574(CP000708|pid:none) Brucella ovis ATCC 25840 chromos...    37   0.21
AE014291_609(AE014291|pid:none) Brucella suis 1330 chromosome I,...    36   0.36
CP001488_612(CP001488|pid:none) Brucella melitensis ATCC 23457 c...    36   0.36
CP001001_3451(CP001001|pid:none) Methylobacterium radiotolerans ...    36   0.36
AM502246_156(AM502246|pid:none) Leishmania infantum chromosome 28.     36   0.36
CP000471_1675(CP000471|pid:none) Magnetococcus sp. MC-1, complet...    36   0.48
CP000301_2735(CP000301|pid:none) Rhodopseudomonas palustris BisB...    35   0.81
AE017282_2041(AE017282|pid:none) Methylococcus capsulatus str. B...    33   2.4
AP007155_652(AP007155|pid:none) Aspergillus oryzae RIB40 genomic...    33   4.0
CP001344_1184(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    33   4.0
AY966972_1(AY966972|pid:none) Synthetic construct isolate FTT085...    32   6.9
DQ463747_7(DQ463747|pid:none) Priapulus caudatus mitochondrion, ...    32   6.9
AJ749949_854(AJ749949|pid:none) Francisella tularensis subsp. tu...    32   6.9
CP000473_6802(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    32   9.0

>CP000951_1984(CP000951|pid:none) Synechococcus sp. PCC 7002,
           complete genome.
          Length = 126

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 41/96 (42%), Positives = 57/96 (59%), Gaps = 10/96 (10%)
 Frame = +2

Query: 68  HGLKKKVTDVARQDIWKTAQQYHLYHSFALFLVPFSTQQ--------NIVGPMFLTGILL 223
           HGLK+ + D    DIW+TA +Y +Y + AL LV   + Q        N  G  F+ GI+L
Sbjct: 25  HGLKETL-DANALDIWETAAKYQMYQAIALLLVGLFSVQGSFPQSWLNGAGIAFIVGIVL 83

Query: 224 FSGSLYNLSLTNRKI--GVSPIGGFLFMAGWVILGM 325
           FSGSLY LSL+  KI   ++P+GG  F+ GW+ L +
Sbjct: 84  FSGSLYALSLSGVKILGAITPLGGAAFIVGWICLAI 119

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 622,924,810
Number of extensions: 11298269
Number of successful extensions: 26557
Number of sequences better than 10.0: 182
Number of HSP's gapped: 26334
Number of HSP's successfully gapped: 182
Length of query: 152
Length of database: 1,040,966,779
Length adjustment: 114
Effective length of query: 38
Effective length of database: 675,678,289
Effective search space: 25675774982
Effective search space used: 25675774982
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)
PSORT 

 psg: 0.92  gvh: 0.61  alm: 0.30  top: 0.53  tms: 0.13  mit: 0.16  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 1.00  m3b: 0.00  m_ : 0.00 

	 32.0 %: endoplasmic reticulum
	 20.0 %: mitochondrial
	 20.0 %: plasma membrane
	  8.0 %: extracellular, including cell wall
	  4.0 %: Golgi
	  4.0 %: vacuolar
	  4.0 %: nuclear
	  4.0 %: vesicles of secretory system
	  4.0 %: cytoplasmic

>> prediction for Contig-U06293-1 is end
VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0