| Contig-U06291-1 |
| Contig ID |
Contig-U06291-1 |
| Contig update |
2001. 8.30 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
649 |
| Chromosome number (1..6, M) |
5 |
| Chromosome length |
5062330 |
| Start point |
2123569 |
| End point |
2124219 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
1 |
| Number of EST |
1 |
| Link to clone list |
U06291 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11. 8 |
| Homology vs DNA |
Query= Contig-U06291-1 (Contig-U06291-1Q) /CSM_Contig/Contig-U06291-1Q.Seq.d
(649 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AU261618) Dictyostelium discoideum vegetative cDNA clone:VS... 1118 0.0 1
(AM464949) Vitis vinifera contig VV78X208010.5, whole genome... 40 0.019 2
(EK458146) 1095468708834 Global-Ocean-Sampling_GS-32-01-01-1... 40 0.072 3
(EJ385871) 1092963811143 Global-Ocean-Sampling_GS-28-01-01-1... 42 0.26 2
(EK283006) 1095462301975 Global-Ocean-Sampling_GS-31-01-01-1... 34 0.29 2
(EJ142384) 1092343662575 Global-Ocean-Sampling_GS-27-01-01-1... 34 0.29 2
(BX510941) Zebrafish DNA sequence from clone DKEY-155D18 in ... 48 0.39 1
(AM424514) Vitis vinifera contig VV78X092748.4, whole genome... 48 0.39 1
(CZ534021) SRAA-aac88g08.b1 Strongyloides ratti whole genome... 48 0.39 1
(AC206101) MACACA MULATTA BAC clone CH250-104F6 from chromos... 42 0.40 6
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 32 0.42 12
(BX908803) Zebrafish DNA sequence from clone CH211-13C14 in ... 40 0.68 5
(AL445565) Mycoplasma pulmonis (strain UAB CTIP) complete ge... 32 0.78 11
(CG050727) PUJDL27TB ZM_0.6_1.0_KB Zea mays genomic clone ZM... 44 0.87 2
(AM451386) Vitis vinifera contig VV78X055948.13, whole genom... 34 0.92 2
(CG087642) PUFUT78TB ZM_0.6_1.0_KB Zea mays genomic clone ZM... 44 1.0 2
(AG391001) Mus musculus molossinus DNA, clone:MSMg01-207P05.... 34 1.1 2
(BH440884) BOGTX44TF BOGT Brassica oleracea genomic clone BO... 36 1.1 2
(CU024879) M.truncatula DNA sequence from clone MTH2-70F3 on... 46 1.2 3
(CR847509) Zebrafish DNA sequence from clone DKEY-29B22 in l... 46 1.6 1
(BX936358) Zebrafish DNA sequence from clone CH211-159A10 in... 46 1.6 1
(AC186389) Pan troglodytes BAC clone CH251-561B19 from chrom... 46 1.6 1
(CR956402) M.truncatula DNA sequence from clone MTH2-50J5 on... 46 1.6 1
(CR932963) Medicago truncatula chromosome 5 clone mth2-115p2... 46 1.6 1
(AC167711) Medicago truncatula chromosome 7 clone mth2-167p2... 46 1.6 1
(AC166899) Medicago truncatula chromosome 8 clone mth2-170k6... 46 1.6 1
(AC153121) Medicago truncatula chromosome 8 clone mth2-80o14... 46 1.6 1
(AC152351) Medicago truncatula chromosome 8 clone mth2-75b20... 46 1.6 1
(AC116407) Homo sapiens chromosome 17, clone CTD-2095E4, com... 46 1.6 1
(AC026620) Homo sapiens chromosome 17, clone RP11-443G13, co... 46 1.6 1
(AC007367) Homo sapiens BAC clone RP11-518G12 from 2, comple... 46 1.6 1
(AC145024) Medicago truncatula clone mth2-24p8, WORKING DRAF... 46 1.6 1
(AC130358) Homo sapiens chromosome 17 clone RP11-440C23 map ... 46 1.6 1
(CU914381) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 1.6 1
(CU633394) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 1.6 1
(AC079608) Homo sapiens chromosome 2 clone RP11-53K17, WORKI... 46 1.6 1
(CU468261) M.truncatula DNA sequence *** SEQUENCING IN PROGR... 46 1.6 1
(CR792436) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 46 1.6 1
(AC210750) Pongo abelii chromosome UNKNOWN clone CH276-180E2... 46 1.6 1
(AC202346) Medicago truncatula clone mth2-2n5, WORKING DRAFT... 46 1.6 1
(AC201329) Strongylocentrotus purpuratus clone R3-16M4, WORK... 46 1.6 1
(AC181802) Strongylocentrotus purpuratus clone R3-1027J21, W... 46 1.6 1
(AC180788) Strongylocentrotus purpuratus clone R3-3072D5, WO... 46 1.6 1
(AC172649) Bos taurus clone CH240-258C12, WORKING DRAFT SEQU... 46 1.6 1
(AC021852) Homo sapiens chromosome 17 clone RP11-474K4, WORK... 46 1.6 1
(AC015941) Homo sapiens clone RP11-55J8, WORKING DRAFT SEQUE... 46 1.6 1
(ER587287) 1093015888334 Global-Ocean-Sampling_GS-36-01-01-2... 46 1.6 1
(ER584088) 1093015858757 Global-Ocean-Sampling_GS-36-01-01-2... 46 1.6 1
(CZ858542) OC__Ba0250J15.f OC__Ba Oryza coarctata genomic cl... 46 1.6 1
(CZ703149) OC__Ba0019M18.f OC__Ba Oryza coarctata genomic cl... 46 1.6 1
(AM452611) Vitis vinifera contig VV78X222796.11, whole genom... 40 2.1 3
(AM485686) Vitis vinifera contig VV78X183807.5, whole genome... 42 2.1 2
(BX842687) Zebrafish DNA sequence from clone DKEY-97L11 in l... 40 2.1 6
(EH016281) USDA-FP_188797 Lysiphlebus testaceipes adult whol... 42 2.4 2
(AC005832) Homo sapiens 12 BAC RPCI11-500M8 (Roswell Park Ca... 44 2.4 2
(CU928835) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 36 2.7 4
(AC212565) Zea mays chromosome 8 clone CH201-189J4; ZMMBBc01... 34 3.0 2
(ED776468) GM_WBb0153K18.r GM_WBb Glycine max genomic clone ... 34 3.1 2
(AJ010592) Guillardia theta DNA for complete sequence of nuc... 32 3.4 8
(AM448912) Vitis vinifera contig VV78X215091.7, whole genome... 34 3.5 2
(AC138912) Homo sapiens chromosome 16 clone RP11-61L21, WORK... 44 3.6 2
(EK250375) 1095460277659 Global-Ocean-Sampling_GS-31-01-01-1... 38 3.6 2
(ER452901) 1092963857298 Global-Ocean-Sampling_GS-35-01-01-1... 38 3.7 2
(EK349771) 1095467841519 Global-Ocean-Sampling_GS-31-01-01-1... 38 3.9 2
(AM471597) Vitis vinifera contig VV78X134402.3, whole genome... 32 4.0 4
(BZ799029) PUFBI71TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 34 4.1 2
(DE562945) Bombyx mori genomic DNA, Fosmid clone:GBMFno204_i... 32 4.2 2
(CU463859) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 42 4.6 3
(DN790072) 90893235 Sea Urchin primary mesenchyme cell cDNA ... 32 5.0 3
(AC064838) Homo sapiens chromosome 12 clone RP11-762C22, WOR... 40 5.1 5
(AC020673) Homo sapiens chromosome 11 clone RP11-437N4 map 1... 36 5.8 5
(AL403325) T7 end of clone AT0AA008A02 of library AT0AA from... 44 6.2 1
(AM430312) Vitis vinifera contig VV78X175099.3, whole genome... 44 6.2 1
(CS605087) Sequence 4073 from Patent WO2007039234. 44 6.2 1
(CS603439) Sequence 2425 from Patent WO2007039234. 44 6.2 1
(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 44 6.2 1
(AC114954) Homo sapiens chromosome 5 clone RP11-103A10, comp... 44 6.2 1
(AC026116) Homo sapiens 12 BAC RP11-1022B3 (Roswell Park Can... 44 6.2 1
(AC010127) Homo sapiens BAC clone RP11-2I8 from 2, complete ... 44 6.2 1
(AC155873) Bos taurus clone CH240-32O22, WORKING DRAFT SEQUE... 44 6.2 1
(AC136952) Danio rerio clone ch211-31g3, WORKING DRAFT SEQUE... 44 6.2 1
(AC095441) Rattus norvegicus clone CH230-7F14, WORKING DRAFT... 44 6.2 1
(CU657929) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 6.2 1
(AP002375) Homo sapiens genomic DNA, chromosome 11q clone:RP... 44 6.2 1
(AC215204) Zea mays chromosome 6 clone CH201-120C19; ZMMBBc0... 44 6.2 1
(AC196136) Zea mays chromosome 2 clone ZMMBBb-557L4; ZMMBBb0... 44 6.2 1
(AC190767) Zea mays chromosome 10 clone CH201-218D1; ZMMBBc0... 44 6.2 1
(AC182619) Zea mays chromosome 3 clone CH201-147N14; ZMMBBc0... 44 6.2 1
(AC173327) Bos taurus clone CH240-120O16, WORKING DRAFT SEQU... 44 6.2 1
(AC025525) Homo sapiens clone RP11-715H19, WORKING DRAFT SEQ... 44 6.2 1
(AC021673) Homo sapiens clone RP11-2I10, WORKING DRAFT SEQUE... 44 6.2 1
(AC016167) Homo sapiens clone RP11-115E17, LOW-PASS SEQUENCE... 44 6.2 1
(AC015777) Homo sapiens clone RP11-2I8, LOW-PASS SEQUENCE SA... 44 6.2 1
(EK563433) 1095521028091 Global-Ocean-Sampling_GS-32-01-01-1... 44 6.2 1
(EK286800) 1095462315762 Global-Ocean-Sampling_GS-31-01-01-1... 44 6.2 1
(EI714090) 2B421005M12TF BAC library from breast tumor sampl... 44 6.2 1
(EI399051) MUGQ_CH252P214L03Sp6_CN344_006 CHORI-252 Vervet M... 44 6.2 1
(DU490032) 1098415481239 CHORI-243 Ovis aries genomic clone ... 44 6.2 1
(CZ531504) SRAA-aac73c07.b1 Strongyloides ratti whole genome... 44 6.2 1
(AG661685) Macaca fuscata fuscata DNA, clone: MSB2-081C03_R,... 44 6.2 1
>(AU261618) Dictyostelium discoideum vegetative cDNA clone:VSA633,
3' end single read.
Length = 650
Score = 1118 bits (564), Expect = 0.0
Identities = 564/564 (100%)
Strand = Plus / Plus
Query: 1 actgatttataattttaccaactccagatataatgtatccaaaggaaagtggttattcaa 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 actgatttataattttaccaactccagatataatgtatccaaaggaaagtggttattcaa 60
Query: 61 cttttgtcactgtagaatcaatggaacaagtgatggaggggaaaagcagacctggtcact 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 cttttgtcactgtagaatcaatggaacaagtgatggaggggaaaagcagacctggtcact 120
Query: 121 tccgcggcgttgcaactatcgtgactaaactattactaattacaactcccactaatttat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tccgcggcgttgcaactatcgtgactaaactattactaattacaactcccactaatttat 180
Query: 181 atatcggtcaaaaagatgctatgcaatgtatttgcattaaaagattagttgcagatttaa 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 atatcggtcaaaaagatgctatgcaatgtatttgcattaaaagattagttgcagatttaa 240
Query: 241 atattgacaccaatgtgataatatgtaacacaattcgtgaagacaccggtctagcaaagt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 atattgacaccaatgtgataatatgtaacacaattcgtgaagacaccggtctagcaaagt 300
Query: 301 catccagaaattcttatttatcaaatgaggaacaaattcaagcatcgtcaatttataaaa 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 catccagaaattcttatttatcaaatgaggaacaaattcaagcatcgtcaatttataaaa 360
Query: 361 ttttagaatcctttaaaaataatataaattcattcactgatcgtcaaagttttattaatg 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 ttttagaatcctttaaaaataatataaattcattcactgatcgtcaaagttttattaatg 420
Query: 421 aaataactaaacaacttgaacaaaatccattgttcaaagttgaatatgttagtattgctt 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aaataactaaacaacttgaacaaaatccattgttcaaagttgaatatgttagtattgctt 480
Query: 481 caaacataactggtttagaaataattgaccaatttccaccaccaaaagattcaaatttat 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 caaacataactggtttagaaataattgaccaatttccaccaccaaaagattcaaatttat 540
Query: 541 cattagcattattattttttgctg 564
||||||||||||||||||||||||
Sbjct: 541 cattagcattattattttttgctg 564
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 753,600,356
Number of extensions: 48347035
Number of successful extensions: 4270730
Number of sequences better than 10.0: 119
Length of query: 649
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 626
Effective length of database: 93,106,754,628
Effective search space: 58284828397128
Effective search space used: 58284828397128
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.21 |
| Homology vs Protein |
Query= Contig-U06291-1 (Contig-U06291-1Q) /CSM_Contig/Contig-U06291-1Q.Seq.d
(649 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54I80) RecName: Full=Pantoate--beta-alanine ligase; E... 373 e-102
FM992695_224(FM992695|pid:none) Candida dubliniensis CD36 chromo... 131 1e-29
(A8F7T6) RecName: Full=Pantothenate synthetase; Short=P... 126 5e-28
(B7IE21) RecName: Full=Pantothenate synthetase; Short=P... 124 2e-27
(A5IN99) RecName: Full=Pantothenate synthetase; Short=P... 124 3e-27
(B5YJ91) RecName: Full=Pantothenate synthetase; Short=P... 123 4e-27
(Q97F38) RecName: Full=Pantothenate synthetase; Short=P... 123 5e-27
(A3DDV6) RecName: Full=Pantothenate synthetase; Short=P... 122 7e-27
CP000612_158(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 122 1e-26
(A9WFR6) RecName: Full=Pantothenate synthetase; Short=P... 120 3e-26
CP001107_2420(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 120 3e-26
(A7HND1) RecName: Full=Pantothenate synthetase; Short=P... 120 4e-26
CP000860_100(CP000860|pid:none) Candidatus Desulforudis audaxvia... 118 1e-25
(A7GAI5) RecName: Full=Pantothenate synthetase; Short=P... 117 2e-25
(A5URA7) RecName: Full=Pantothenate synthetase; Short=P... 117 2e-25
(A4XMZ3) RecName: Full=Pantothenate synthetase; Short=P... 117 3e-25
(Q3A9L1) RecName: Full=Pantothenate synthetase; Short=P... 117 3e-25
CP001348_1748(CP001348|pid:none) Clostridium cellulolyticum H10,... 117 4e-25
(A7FR59) RecName: Full=Pantothenate synthetase; Short=P... 117 4e-25
(B1IEL5) RecName: Full=Pantothenate synthetase; Short=P... 116 5e-25
CP001078_1602(CP001078|pid:none) Clostridium botulinum E3 str. A... 116 5e-25
(Q2RM60) RecName: Full=Pantothenate synthetase; Short=P... 116 5e-25
(O86953) RecName: Full=Pantothenate synthetase; Short=P... 116 5e-25
(A6LNF3) RecName: Full=Pantothenate synthetase; Short=P... 116 6e-25
CP001100_33(CP001100|pid:none) Chloroherpeton thalassium ATCC 35... 116 6e-25
(Q18C33) RecName: Full=Pantothenate synthetase; Short=P... 115 1e-24
(Q833S6) RecName: Full=Pantothenate synthetase; Short=P... 114 2e-24
EU980631_25(EU980631|pid:none) Thermotogales bacterium TBF 19.5.... 114 3e-24
AP007159_649(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 113 4e-24
AY142936_1(AY142936|pid:none) Heliobacillus mobilis Pantoate--be... 113 4e-24
AY120853_84(AY120853|pid:none) Synechococcus sp. PCC 7942 proces... 113 4e-24
(A8FK86) RecName: Full=Pantothenate synthetase; Short=P... 113 5e-24
(Q63DJ2) RecName: Full=Pantothenate synthetase; Short=P... 112 7e-24
CP000485_1314(CP000485|pid:none) Bacillus thuringiensis str. Al ... 112 7e-24
(A8H0D3) RecName: Full=Pantothenate synthetase; Short=P... 112 1e-23
(A3QHQ2) RecName: Full=Pantothenate synthetase; Short=P... 112 1e-23
CP001130_825(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 112 1e-23
(B0C6S1) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 112 1e-23
(B7JHQ7) RecName: Full=Pantothenate synthetase; Short=P... 111 2e-23
(Q3B2E3) RecName: Full=Pantothenate synthetase; Short=P... 111 2e-23
(A8G085) RecName: Full=Pantothenate synthetase; Short=P... 111 2e-23
(Q1GLQ5) RecName: Full=Pantothenate synthetase; Short=P... 111 2e-23
CP000612_1762(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 110 3e-23
CP000930_1259(CP000930|pid:none) Heliobacterium modesticaldum Ic... 110 3e-23
(Q3ILL1) RecName: Full=Pantothenate synthetase; Short=P... 110 4e-23
(Q3Z8B3) RecName: Full=Pantothenate synthetase; Short=P... 110 4e-23
(Q0HRH5) RecName: Full=Pantothenate synthetase; Short=P... 110 5e-23
(Q81ST2) RecName: Full=Pantothenate synthetase; Short=P... 110 5e-23
(Q07XZ7) RecName: Full=Pantothenate synthetase; Short=P... 109 6e-23
(A0L0R3) RecName: Full=Pantothenate synthetase; Short=P... 109 6e-23
CR382137_382(CR382137|pid:none) Debaryomyces hansenii strain CBS... 109 8e-23
(Q5HL36) RecName: Full=Pantothenate synthetase; Short=P... 108 1e-22
(Q09673) RecName: Full=Pantoate--beta-alanine ligase; E... 108 1e-22
(Q8KBY5) RecName: Full=Pantothenate synthetase; Short=P... 108 1e-22
AM270398_24(AM270398|pid:none) Aspergillus niger contig An18c005... 108 1e-22
CP000685_821(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 108 2e-22
(A3D8A9) RecName: Full=Pantothenate synthetase; Short=P... 107 3e-22
(B7HL54) RecName: Full=Pantothenate synthetase; Short=P... 107 3e-22
(Q1J0L2) RecName: Full=Pantothenate synthetase; Short=P... 107 3e-22
CP001101_526(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 107 3e-22
(Q8DG73) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 107 4e-22
(Q3A3I7) RecName: Full=Pantothenate synthetase; Short=P... 107 4e-22
(A1VY17) RecName: Full=Pantothenate synthetase; Short=P... 107 4e-22
CP000922_1119(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 107 4e-22
(Q8EIH0) RecName: Full=Pantothenate synthetase; Short=P... 107 4e-22
CP001099_534(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 106 5e-22
CP001252_843(CP001252|pid:none) Shewanella baltica OS223, comple... 106 5e-22
(B8CTC7) RecName: Full=Pantothenate synthetase; Short=P... 106 7e-22
CP000607_1405(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 106 7e-22
(Q5WGA4) RecName: Full=Pantothenate synthetase; Short=P... 105 9e-22
CP001110_607(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 105 9e-22
CP001077_4(CP001077|pid:none) Rhizobium etli CIAT 652 plasmid pC... 105 9e-22
(B7HHU4) RecName: Full=Pantothenate synthetase; Short=P... 105 9e-22
CP000673_605(CP000673|pid:none) Clostridium kluyveri DSM 555, co... 105 9e-22
CR382128_229(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 105 9e-22
(B0TXZ9) RecName: Full=Pantothenate synthetase; Short=P... 105 1e-21
(A8FEH6) RecName: Full=Pantothenate synthetase; Short=P... 105 1e-21
(A7GN77) RecName: Full=Pantothenate synthetase; Short=P... 105 1e-21
(A9VMF0) RecName: Full=Pantothenate synthetase; Short=P... 105 1e-21
CP001615_2995(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 105 1e-21
CP000961_3761(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 104 2e-21
U44896_1(U44896|pid:none) Synechocystis sp. pantothenate synthet... 104 3e-21
(A1BDY2) RecName: Full=Pantothenate synthetase; Short=P... 103 3e-21
FM954972_2408(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 103 3e-21
(Q2JRH9) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 103 4e-21
(Q2JZU1) RecName: Full=Pantothenate synthetase; Short=P... 103 4e-21
(B1YHQ8) RecName: Full=Pantothenate synthetase; Short=P... 103 4e-21
CP001287_1047(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 103 6e-21
(Q6D1X5) RecName: Full=Pantothenate synthetase; Short=P... 103 6e-21
(A4IWW5) RecName: Full=Pantothenate synthetase; Short=P... 102 1e-20
CP001601_1871(CP001601|pid:none) Corynebacterium aurimucosum ATC... 102 1e-20
(A5F974) RecName: Full=Pantothenate synthetase; Short=P... 102 1e-20
CP001485_2(CP001485|pid:none) Vibrio cholerae MJ-1236 chromosome... 102 1e-20
(Q74CG7) RecName: Full=Pantothenate synthetase; Short=P... 102 1e-20
CP000915_502(CP000915|pid:none) Francisella tularensis subsp. me... 102 1e-20
(Q8YSZ3) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 102 1e-20
(Q47W59) RecName: Full=Pantothenate synthetase; Short=P... 102 1e-20
CP000437_561(CP000437|pid:none) Francisella tularensis subsp. ho... 102 1e-20
CP001114_830(CP001114|pid:none) Deinococcus deserti VCD115, comp... 101 2e-20
(A4SJ60) RecName: Full=Pantothenate synthetase; Short=P... 101 2e-20
(Q6LMJ5) RecName: Full=Pantothenate synthetase; Short=P... 101 2e-20
(Q9KC86) RecName: Full=Pantothenate synthetase; Short=P... 101 2e-20
CU928169_45(CU928169|pid:none) Kluyveromyces thermotolerans stra... 101 2e-20
(Q5LWR2) RecName: Full=Pantothenate synthetase; Short=P... 101 2e-20
CP001158_181(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 100 3e-20
AM747071_1(AM747071|pid:none) Bacillus cereus partial panC gene,... 100 3e-20
CP000783_3114(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 100 3e-20
AM747061_1(AM747061|pid:none) Bacillus cereus partial panC gene,... 100 4e-20
(A6GVV3) RecName: Full=Pantothenate synthetase; Short=P... 100 4e-20
(A0KP08) RecName: Full=Pantothenate synthetase; Short=P... 100 4e-20
CP000822_3134(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 100 4e-20
(A8GIZ7) RecName: Full=Pantothenate synthetase; Short=P... 100 4e-20
(Q7MHV3) RecName: Full=Pantothenate synthetase; Short=P... 100 5e-20
CR380954_277(CR380954|pid:none) Candida glabrata strain CBS138 c... 100 5e-20
(A1VBJ2) RecName: Full=Pantothenate synthetase; Short=P... 100 5e-20
CP000613_577(CP000613|pid:none) Rhodospirillum centenum SW, comp... 100 6e-20
AE016819_515(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 100 6e-20
(P52998) RecName: Full=Pantothenate synthetase; Short=P... 100 6e-20
(Q31FF6) RecName: Full=Pantothenate synthetase; Short=P... 100 6e-20
(Q5KXX3) RecName: Full=Pantothenate synthetase; Short=P... 100 6e-20
CP001111_1518(CP001111|pid:none) Stenotrophomonas maltophilia R5... 99 8e-20
AM747094_1(AM747094|pid:none) Bacillus thuringiensis partial pan... 99 1e-19
AM295250_2063(AM295250|pid:none) Staphylococcus carnosus subsp. ... 99 1e-19
CP001150_56(CP001150|pid:none) Rhodobacter sphaeroides KD131 chr... 99 1e-19
CP000789_3335(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 99 1e-19
(Q2NVR3) RecName: Full=Pantothenate synthetase; Short=P... 99 1e-19
CU468135_856(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 99 1e-19
(Q47KV5) RecName: Full=Pantothenate synthetase; Short=P... 99 1e-19
DQ301151_1(DQ301151|pid:none) Bacillus cereus strain KBCC3 PanC ... 99 1e-19
(Q8DC12) RecName: Full=Pantothenate synthetase; Short=P... 99 1e-19
EF106972_16(EF106972|pid:none) Uncultured marine Nitrospinaceae ... 99 1e-19
CP001103_3523(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 99 1e-19
(A0R580) RecName: Full=Pantothenate synthetase; Short=P... 99 1e-19
(A1JJN7) RecName: Full=Pantothenate synthetase; Short=P... 99 1e-19
AM747063_1(AM747063|pid:none) Bacillus cereus partial panC gene,... 99 1e-19
(A3PGQ3) RecName: Full=Pantothenate synthetase; Short=P... 99 1e-19
FM211055_4(FM211055|pid:none) Photorhabdus asymbiotica subsp. as... 99 1e-19
(Q8Z9D3) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
AM747084_1(AM747084|pid:none) Bacillus thuringiensis partial pan... 98 2e-19
AE014075_158(AE014075|pid:none) Escherichia coli CFT073, complet... 98 2e-19
(A7ZHM3) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
CP000975_2095(CP000975|pid:none) Methylacidiphilum infernorum V4... 98 2e-19
(Q326A4) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
(Q8FL31) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
AP009380_1492(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 98 2e-19
CP000886_221(CP000886|pid:none) Salmonella enterica subsp. enter... 98 2e-19
(Q311U9) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
(Q0TLJ9) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
(Q15NV6) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
AM942759_194(AM942759|pid:none) Proteus mirabilis strain HI4320,... 98 2e-19
(B7LW40) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
(Q8ZRR1) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
(A0M787) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
AM747044_1(AM747044|pid:none) Bacillus cereus partial panC gene,... 98 2e-19
CP000661_2471(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 98 2e-19
(Q3J5N0) RecName: Full=Pantothenate synthetase; Short=P... 98 2e-19
(B7MBB6) RecName: Full=Pantothenate synthetase; Short=P... 97 3e-19
CP000817_1929(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 97 3e-19
DQ301145_1(DQ301145|pid:none) Bacillus cereus strain KBCB1 PanC ... 97 3e-19
(A4VPM7) RecName: Full=Pantothenate synthetase; Short=P... 97 3e-19
(B8DSC4) RecName: Full=Pantothenate synthetase; Short=P... 97 4e-19
CP000946_3452(CP000946|pid:none) Escherichia coli ATCC 8739, com... 97 4e-19
(A8ERB8) RecName: Full=Pantothenate synthetase; Short=P... 97 4e-19
(Q92AA7) RecName: Full=Pantothenate synthetase; Short=P... 97 4e-19
(Q2S2P6) RecName: Full=Pantothenate synthetase; Short=P... 97 4e-19
(Q7NJM6) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 97 5e-19
AM747073_1(AM747073|pid:none) Bacillus cereus partial panC gene,... 97 5e-19
AJ298881_1(AJ298881|pid:none) Fusarium oxysporum mRNA for fusari... 97 5e-19
(A9M8B2) RecName: Full=Pantothenate synthetase; Short=P... 97 5e-19
(Q3K6Q5) RecName: Full=Pantothenate synthetase; Short=P... 97 5e-19
(Q32JW8) RecName: Full=Pantothenate synthetase; Short=P... 97 5e-19
(Q92NN0) RecName: Full=Pantothenate synthetase; Short=P... 96 7e-19
(A7FM23) RecName: Full=Pantothenate synthetase; Short=P... 96 7e-19
(Q2YWG0) RecName: Full=Pantothenate synthetase; Short=P... 96 7e-19
(Q4ZY87) RecName: Full=Pantothenate synthetase; Short=P... 96 7e-19
(Q2FV22) RecName: Full=Pantothenate synthetase; Short=P... 96 7e-19
(Q16DW6) RecName: Full=Pantothenate synthetase; Short=P... 96 7e-19
(Q6G678) RecName: Full=Pantothenate synthetase; Short=P... 96 7e-19
(A4W6N7) RecName: Full=Pantothenate synthetase; Short=P... 96 9e-19
CP001113_189(CP001113|pid:none) Salmonella enterica subsp. enter... 96 9e-19
(A5VNS0) RecName: Full=Pantothenate synthetase; Short=P... 96 9e-19
FM242711_1887(FM242711|pid:none) Listeria monocytogenes Clip8145... 96 9e-19
CP001389_2054(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 96 9e-19
AM747054_1(AM747054|pid:none) Bacillus weihenstephanensis partia... 96 9e-19
(Q7N870) RecName: Full=Pantothenate synthetase; Short=P... 96 1e-18
(A1AUV7) RecName: Full=Pantothenate synthetase; Short=P... 96 1e-18
(A7I0P8) RecName: Full=Pantothenate synthetase; Short=P... 96 1e-18
CP000230_3309(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 96 1e-18
DQ301088_1(DQ301088|pid:none) Bacillus thuringiensis strain KBAE... 96 1e-18
(Q2RP31) RecName: Full=Pantothenate synthetase; Short=P... 96 1e-18
AY210414_4(AY210414|pid:none) Pseudomonas fluorescens polynucleo... 95 2e-18
(Q5E2T1) RecName: Full=Pantothenate synthetase; Short=P... 95 2e-18
AM747051_1(AM747051|pid:none) Bacillus cereus partial panC gene,... 95 2e-18
CP001279_1334(CP001279|pid:none) Nautilia profundicola AmH, comp... 95 2e-18
(B1GZJ9) RecName: Full=Pantothenate synthetase; Short=P... 95 2e-18
(B6ELE2) RecName: Full=Pantothenate synthetase; Short=P... 95 2e-18
CP001087_468(CP001087|pid:none) Desulfobacterium autotrophicum H... 95 2e-18
AM747059_1(AM747059|pid:none) Bacillus weihenstephanensis partia... 95 2e-18
CP001349_970(CP001349|pid:none) Methylobacterium nodulans ORS 20... 94 3e-18
CP001175_644(CP001175|pid:none) Listeria monocytogenes HCC23, co... 94 3e-18
(Q2YPI2) RecName: Full=Pantothenate synthetase; Short=P... 94 3e-18
(Q1I4P1) RecName: Full=Pantothenate synthetase; Short=P... 94 3e-18
CP000934_2907(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 94 3e-18
(Q3BUL5) RecName: Full=Pantothenate synthetase; Short=P... 94 3e-18
(A6UB63) RecName: Full=Pantothenate synthetase; Short=P... 94 3e-18
CP001138_203(CP001138|pid:none) Salmonella enterica subsp. enter... 94 3e-18
AM747065_1(AM747065|pid:none) Bacillus cereus partial panC gene,... 94 4e-18
(Q48N87) RecName: Full=Pantothenate synthetase; Short=P... 94 4e-18
(A1TYE5) RecName: Full=Pantothenate synthetase; Short=P... 94 4e-18
CP000750_572(CP000750|pid:none) Kineococcus radiotolerans SRS302... 94 4e-18
AM747085_1(AM747085|pid:none) Bacillus cereus partial panC gene,... 94 4e-18
CP000859_42(CP000859|pid:none) Desulfococcus oleovorans Hxd3, co... 94 4e-18
(Q0ANX4) RecName: Full=Pantothenate synthetase; Short=P... 94 4e-18
(A1SDW7) RecName: Full=Pantothenate synthetase; Short=P... 94 4e-18
FP236842_840(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 94 4e-18
(Q9AMR9) RecName: Full=Pantothenate synthetase 1; Short... 93 6e-18
(P40459) RecName: Full=Pantoate--beta-alanine ligase; E... 93 6e-18
(Q4A0T9) RecName: Full=Pantothenate synthetase; Short=P... 93 6e-18
(Q2VZ00) RecName: Full=Pantothenate synthetase; Short=P... 93 8e-18
CP001032_4598(CP001032|pid:none) Opitutus terrae PB90-1, complet... 93 8e-18
(B6YS28) RecName: Full=Pantothenate synthetase; Short=P... 93 8e-18
CP000697_550(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 92 1e-17
(Q88DW8) RecName: Full=Pantothenate synthetase; Short=P... 92 1e-17
(A5W975) RecName: Full=Pantothenate synthetase; Short=P... 92 1e-17
(A3M294) RecName: Full=Pantothenate synthetase; Short=P... 92 1e-17
(A0L3M5) RecName: Full=Pantothenate synthetase; Short=P... 92 1e-17
(A8LKA2) RecName: Full=Pantothenate synthetase; Short=P... 92 1e-17
AM778855_7(AM778855|pid:none) Microcystis aeruginosa PCC 7806 ge... 92 1e-17
(Q11F81) RecName: Full=Pantothenate synthetase; Short=P... 92 1e-17
CP000628_2227(CP000628|pid:none) Agrobacterium radiobacter K84 c... 92 1e-17
(O24035) RecName: Full=Pantoate--beta-alanine ligase; E... 92 1e-17
(Q8K9U7) RecName: Full=Pantothenate synthetase; Short=P... 92 2e-17
(Q5ZS57) RecName: Full=Pantothenate synthetase; Short=P... 92 2e-17
(Q1AT82) RecName: Full=Pantothenate synthetase; Short=P... 91 2e-17
(Q6ALV3) RecName: Full=Pantothenate synthetase; Short=P... 91 3e-17
(Q5WTD6) RecName: Full=Pantothenate synthetase; Short=P... 91 3e-17
AY085534_1(AY085534|pid:none) Arabidopsis thaliana clone 156371 ... 91 3e-17
(Q5X1M7) RecName: Full=Pantothenate synthetase; Short=P... 91 4e-17
(Q3JCP8) RecName: Full=Pantothenate synthetase; Short=P... 91 4e-17
CP001157_4127(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 90 5e-17
(Q9FKB3) RecName: Full=Pantoate--beta-alanine ligase; E... 90 5e-17
(A0LRC5) RecName: Full=Pantothenate synthetase; Short=P... 90 6e-17
(Q0RB94) RecName: Full=Pantothenate synthetase 4; Short... 90 6e-17
(Q8XWT3) RecName: Full=Pantothenate synthetase; Short=P... 90 6e-17
EF108381_1(EF108381|pid:none) Bacillus cereus strain NVH 883/00 ... 89 8e-17
(Q7UTQ8) RecName: Full=Pantothenate synthetase; Short=P... 89 8e-17
(A6W2I4) RecName: Full=Pantothenate synthetase; Short=P... 89 8e-17
EF108388_1(EF108388|pid:none) Bacillus cereus strain INRA AF2 pa... 89 8e-17
(A5GVR3) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 89 1e-16
CP000951_335(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 89 1e-16
AE008334_6(AE008334|pid:none) Agrobacterium tumefaciens str. C58... 89 1e-16
(Q17Z21) RecName: Full=Pantothenate synthetase; Short=P... 89 1e-16
(Q743Y5) RecName: Full=Pantothenate synthetase; Short=P... 89 1e-16
(A1AW71) RecName: Full=Pantothenate synthetase; Short=P... 89 1e-16
(Q47B65) RecName: Full=Pantothenate synthetase; Short=P... 89 1e-16
(A0QA93) RecName: Full=Pantothenate synthetase; Short=P... 89 1e-16
(Q1QSZ8) RecName: Full=Pantothenate synthetase; Short=P... 89 1e-16
(Q9X844) RecName: Full=Pantothenate synthetase; Short=P... 89 1e-16
AE008692_1971(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 88 2e-16
(Q5NL15) RecName: Full=Pantothenate synthetase; Short=P... 88 2e-16
(A1KPT7) RecName: Full=Pantothenate synthetase; Short=P... 88 2e-16
CP000774_2776(CP000774|pid:none) Parvibaculum lavamentivorans DS... 88 2e-16
CP000781_4504(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 88 2e-16
(A0LF67) RecName: Full=Pantothenate synthetase; Short=P... 88 2e-16
CP000941_177(CP000941|pid:none) Xylella fastidiosa M12, complete... 88 2e-16
(Q2YAP0) RecName: Full=Pantothenate synthetase; Short=P... 87 4e-16
(Q0AB68) RecName: Full=Pantothenate synthetase; Short=P... 87 4e-16
(P57036) RecName: Full=Pantothenate synthetase; Short=P... 87 4e-16
CP001339_864(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 87 4e-16
CP001124_2981(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 87 5e-16
(B0RTU0) RecName: Full=Pantothenate synthetase; Short=P... 87 5e-16
CP000381_789(CP000381|pid:none) Neisseria meningitidis 053442, c... 87 5e-16
CP001281_2600(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 86 7e-16
(A6L4C3) RecName: Full=Pantothenate synthetase; Short=P... 86 7e-16
AE017344_554(AE017344|pid:none) Cryptococcus neoformans var. neo... 86 7e-16
CP000249_4326(CP000249|pid:none) Frankia sp. CcI3, complete geno... 86 9e-16
(Q8D2A6) RecName: Full=Pantothenate synthetase; Short=P... 86 9e-16
(P56061) RecName: Full=Pantothenate synthetase; Short=P... 86 9e-16
(B5Z6E3) RecName: Full=Pantothenate synthetase; Short=P... 86 1e-15
CP000910_3163(CP000910|pid:none) Renibacterium salmoninarum ATCC... 86 1e-15
(A9IRN9) RecName: Full=Pantothenate synthetase; Short=P... 86 1e-15
AP011115_4331(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 86 1e-15
CP000958_2427(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 86 1e-15
AF542529_33(AF542529|pid:none) Cryptococcus neoformans var. grub... 86 1e-15
(A0K9L5) RecName: Full=Pantothenate synthetase; Short=P... 86 1e-15
(A4JGX1) RecName: Full=Pantothenate synthetase; Short=P... 86 1e-15
AF542528_32(AF542528|pid:none) Cryptococcus neoformans var. grub... 86 1e-15
(A8M8F3) RecName: Full=Pantothenate synthetase; Short=P... 86 1e-15
(Q9X713) RecName: Full=Pantothenate synthetase; Short=P... 85 2e-15
(Q82EC8) RecName: Full=Pantothenate synthetase; Short=P... 85 2e-15
CP001071_395(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 85 2e-15
(Q0S8D5) RecName: Full=Pantothenate synthetase; Short=P... 85 2e-15
CP000820_198(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 85 2e-15
(A1KTB2) RecName: Full=Pantothenate synthetase; Short=P... 85 2e-15
(A1WUU4) RecName: Full=Pantothenate synthetase; Short=P... 85 2e-15
(Q6MHI2) RecName: Full=Pantothenate synthetase; Short=P... 85 2e-15
(A6Q719) RecName: Full=Pantothenate synthetase; Short=P... 85 2e-15
(Q46IM3) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 85 2e-15
AP009493_4108(AP009493|pid:none) Streptomyces griseus subsp. gri... 84 3e-15
(Q6G079) RecName: Full=Pantothenate synthetase; Short=P... 84 3e-15
(Q5LGS1) RecName: Full=Pantothenate synthetase; Short=P... 84 3e-15
(A2C536) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 84 3e-15
(Q5NXQ2) RecName: Full=Pantothenate synthetase; Short=P... 84 3e-15
(Q5Z2U3) RecName: Full=Pantothenate synthetase; Short=P... 84 4e-15
(Q89ZR8) RecName: Full=Pantothenate synthetase; Short=P... 84 4e-15
CP001357_2137(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 84 5e-15
(Q5F9F8) RecName: Full=Pantothenate synthetase; Short=P... 84 5e-15
CP001189_2204(CP001189|pid:none) Gluconacetobacter diazotrophicu... 84 5e-15
AM889285_181(AM889285|pid:none) Gluconacetobacter diazotrophicus... 84 5e-15
AY421966_2(AY421966|pid:none) Cryptococcus gattii strain ATCC 32... 84 5e-15
AM849034_106(AM849034|pid:none) Clavibacter michiganensis subsp.... 84 5e-15
CP001029_2162(CP001029|pid:none) Methylobacterium populi BJ001, ... 83 6e-15
(A1R163) RecName: Full=Pantothenate synthetase; Short=P... 83 6e-15
(Q1CVE9) RecName: Full=Pantothenate synthetase; Short=P... 83 6e-15
(Q7NXJ0) RecName: Full=Pantothenate synthetase; Short=P... 83 6e-15
(Q0K7I6) RecName: Full=Pantothenate synthetase; Short=P... 83 6e-15
CP001154_1393(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 83 6e-15
(Q82Y17) RecName: Full=Pantothenate synthetase; Short=P... 83 8e-15
AM181361_1(AM181361|pid:none) Physcomitrella patens subsp. paten... 83 8e-15
(Q04S98) RecName: Full=Pantothenate synthetase; Short=P... 83 8e-15
AY710429_32(AY710429|pid:none) Cryptococcus gattii strain E566 M... 83 8e-15
(A5CX21) RecName: Full=Pantothenate synthetase; Short=P... 83 8e-15
(A4XCQ4) RecName: Full=Pantothenate synthetase; Short=P... 83 8e-15
(B6JPA5) RecName: Full=Pantothenate synthetase; Short=P... 82 1e-14
(A9I1G8) RecName: Full=Pantothenate synthetase; Short=P... 82 1e-14
CP001503_2663(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 82 1e-14
(A1US39) RecName: Full=Pantothenate synthetase; Short=P... 82 1e-14
(A3MLN2) RecName: Full=Pantothenate synthetase; Short=P... 82 1e-14
AY280634_1(AY280634|pid:none) Uncultured bacterium cosmid pbiov ... 82 2e-14
(Q2KUK2) RecName: Full=Pantothenate synthetase; Short=P... 82 2e-14
(A5WHC9) RecName: Full=Pantothenate synthetase; Short=P... 82 2e-14
CP000908_2206(CP000908|pid:none) Methylobacterium extorquens PA1... 81 2e-14
CR954209_266(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 81 2e-14
(Q1LJM9) RecName: Full=Pantothenate synthetase; Short=P... 81 3e-14
(A4G3S0) RecName: Full=Pantothenate synthetase; Short=P... 81 3e-14
CP000777_1731(CP000777|pid:none) Leptospira biflexa serovar Pato... 81 3e-14
(Q1GNR4) RecName: Full=Pantothenate synthetase; Short=P... 81 3e-14
(Q8F394) RecName: Full=Pantothenate synthetase; Short=P... 81 3e-14
(A1TG35) RecName: Full=Pantothenate synthetase; Short=P... 80 4e-14
AP009385_2353(AP009385|pid:none) Burkholderia multivorans ATCC 1... 80 4e-14
CP001052_976(CP001052|pid:none) Burkholderia phytofirmans PsJN c... 80 4e-14
(Q7V583) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 80 7e-14
(Q0BU46) RecName: Full=Pantothenate synthetase; Short=P... 80 7e-14
(Q5P9T3) RecName: Full=Pantothenate synthetase; Short=P... 80 7e-14
(Q3SH82) RecName: Full=Pantothenate synthetase; Short=P... 79 9e-14
CP001010_1024(CP001010|pid:none) Polynucleobacter necessarius su... 79 1e-13
(Q2S8W2) RecName: Full=Pantothenate synthetase; Short=P... 79 1e-13
EU970056_1(EU970056|pid:none) Zea mays clone 339134 pantoate--be... 79 1e-13
(Q0RC35) RecName: Full=Pantothenate synthetase 3; Short... 78 2e-13
(Q4FVG7) RecName: Full=Pantothenate synthetase; Short=P... 78 3e-13
AY744396_15(AY744396|pid:none) Uncultured proteobacterium RedeBA... 78 3e-13
AP009384_1589(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 77 4e-13
AM118080_3(AM118080|pid:none) Ustilago hordei mating type region... 77 4e-13
CP001620_1571(CP001620|pid:none) Corynebacterium kroppenstedtii ... 76 7e-13
AM942444_1693(AM942444|pid:none) Corynebacterium urealyticum DSM... 76 1e-12
(A0JR91) RecName: Full=Pantothenate synthetase; Short=P... 75 1e-12
CP001096_3501(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 75 2e-12
(A5EKW3) RecName: Full=Pantothenate synthetase; Short=P... 75 2e-12
AP009152_1918(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 74 3e-12
(A5GIY5) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 74 4e-12
(Q135F0) RecName: Full=Pantothenate synthetase; Short=P... 74 4e-12
(A3PF80) RecName: Full=Bifunctional pantoate ligase/cytidylate k... 73 8e-12
DQ366723_7(DQ366723|pid:none) Uncultured Prochlorococcus marinus... 72 1e-11
(A8G795) Bifunctional pantoate ligase/cytidylate kinase [Include... 72 1e-11
(Q1QKN4) RecName: Full=Pantothenate synthetase; Short=P... 72 2e-11
CP000463_3384(CP000463|pid:none) Rhodopseudomonas palustris BisA... 71 2e-11
(Q07L39) RecName: Full=Pantothenate synthetase; Short=P... 71 2e-11
AL023093_1(AL023093|pid:none) Mycobacterium leprae cosmid B2548. 70 4e-11
T03924(T03924) probable pantoate-beta-alanine ligase (EC 6.3.2.1... 70 5e-11
CP001332_250(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 70 7e-11
(Q0RK33) RecName: Full=Pantothenate synthetase 1; Short... 68 2e-10
AM420293_5372(AM420293|pid:none) Saccharopolyspora erythraea NRR... 68 2e-10
(Q12F41) RecName: Full=Pantothenate synthetase; Short=P... 67 3e-10
(Q21U08) RecName: Full=Pantothenate synthetase; Short=P... 67 4e-10
CP001013_1170(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 67 6e-10
CP000301_3295(CP000301|pid:none) Rhodopseudomonas palustris BisB... 66 1e-09
(A1VKS2) RecName: Full=Pantothenate synthetase; Short=P... 65 2e-09
(Q0REL2) RecName: Full=Pantothenate synthetase 2; Short... 65 2e-09
CP001392_2768(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 65 2e-09
(A1TTW0) RecName: Full=Pantothenate synthetase; Short=P... 60 5e-08
(A1WDW5) RecName: Full=Pantothenate synthetase; Short=P... 57 5e-07
AF322012_139(AF322012|pid:none) Bradyrhizobium japonicum symbiot... 52 2e-05
EF191494_1(EF191494|pid:none) Bacillus subtilis strain 168 panto... 46 0.001
EF191496_1(EF191496|pid:none) Bacillus subtilis strain 23 pantot... 45 0.002
T36394(T36394)probable pantoate-amino acid ligase - Streptomyces... 44 0.004
BA000035_2530(BA000035|pid:none) Corynebacterium efficiens YS-31... 39 0.099
BA000040_1628(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 39 0.17
CP001601_2228(CP001601|pid:none) Corynebacterium aurimucosum ATC... 35 1.4
AF159564_1(AF159564|pid:none) Leishmania tarentolae ornithine de... 35 1.4
CP001357_2428(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 35 2.4
CP000077_30(CP000077|pid:none) Sulfolobus acidocaldarius DSM 639... 34 3.2
CP000246_2666(CP000246|pid:none) Clostridium perfringens ATCC 13... 34 3.2
BX897699_735(BX897699|pid:none) Bartonella henselae strain Houst... 34 3.2
(Q6BK00) RecName: Full=Peroxisomal biogenesis factor 3; AltName:... 34 4.2
AE017198_1468(AE017198|pid:none) Lactobacillus johnsonii NCC 533... 34 4.2
CP001229_1600(CP001229|pid:none) Sulfurihydrogenibium azorense A... 34 4.2
AF066865_15(AF066865|pid:none) Bacteriophage TPW22 holin, lysin,... 33 5.4
CP000790_1624(CP000790|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 33 5.4
AL844509_211(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 33 7.1
AL844509_426(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 33 7.1
AM910992_217(AM910992|pid:none) Plasmodium knowlesi strain H chr... 33 9.3
CP000771_1336(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 33 9.3
>(Q54I80) RecName: Full=Pantoate--beta-alanine ligase;
EC=6.3.2.1; AltName: Full=Pantothenate synthetase;
AltName: Full=Pantoate-activating enzyme;
Length = 300
Score = 373 bits (958), Expect = e-102
Identities = 189/191 (98%), Positives = 190/191 (99%)
Frame = +3
Query: 9 IILPTPDIMYPKESGYSTFVTVESMEQVMEGKSRPGHFRGVATIVTKLLLITTPTNLYIG 188
+ LPTPDIMYPKESGYSTFVTVESMEQVMEGKSRPGHFRGVATIVTKLLLITTPTNLYIG
Sbjct: 103 LFLPTPDIMYPKESGYSTFVTVESMEQVMEGKSRPGHFRGVATIVTKLLLITTPTNLYIG 162
Query: 189 QKDAMQCICIKRLVADLNIDTNVIICNTIREDTGLAKSSRNSYLSNEEQIQASSIYKILE 368
QKDAMQCICIKRLVADLNIDTNVIICNTIREDTGLAKSSRNSYLSNEEQIQASSIYKILE
Sbjct: 163 QKDAMQCICIKRLVADLNIDTNVIICNTIREDTGLAKSSRNSYLSNEEQIQASSIYKILE 222
Query: 369 SFKNNINSFTDRQSFINEITKQLEQNPLFKVEYVSIASNITGLEIIDQFPPPKDSNLSLA 548
SFKNNINSFTDRQSFINEITKQLEQNPLFKVEYVSIASNITGLEIIDQFPPPKDSNLSLA
Sbjct: 223 SFKNNINSFTDRQSFINEITKQLEQNPLFKVEYVSIASNITGLEIIDQFPPPKDSNLSLA 282
Query: 549 LLFFAEKRKTR 581
LLFFAEKRKTR
Sbjct: 283 LLFFAEKRKTR 293
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 930,356,406
Number of extensions: 17667773
Number of successful extensions: 48124
Number of sequences better than 10.0: 402
Number of HSP's gapped: 48078
Number of HSP's successfully gapped: 402
Length of query: 216
Length of database: 1,040,966,779
Length adjustment: 123
Effective length of query: 93
Effective length of database: 646,839,724
Effective search space: 60156094332
Effective search space used: 60156094332
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
|
| PSORT |
|
| VS (DIR, S) |
1 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |