>Contig-U06252-1 (Contig-U06252-1Q) /CSM_Contig/Contig-U06252-1Q.Seq.d
CCCGCGTCCGATTTTTTTTATTTATTAATTAAATAAAAAAAAAAATAAAA
AAAGAATGAGACACGTATCTGCTTTCAAAAAATTGTGCAGATTCTGCCAA
ACTATTAGAAGAGGAAAGAATGTTTTTGTATTTTGTAAAGCAAATGCCAG
ACATAAGCAAAAGCAAGGTTGGATCATTTAAGATAACCAAATAAATATGT
ATATAAAATTCAAATAATTCAAATAAATATATACATAAAGGAATTTCCAA
ATATATATTTAAAAAAAAAAAAAAAAAAAAACACCCAAAAATCATAAATA
AATTCCTAAATTAGAAACAATTTCATTTAAATAAAAAAAAAAAAAAAAAA
AAAGATTTATTTCAAAAAAAAAAAAAAAAAAAAAAAAAA

est1=VSG849F,1,270
est2=VSA441E,11,390
est3=VSD753F,11,270
est4=VSD753Z,11,199

prpiffiy*LNKKKNKKRMRHVSAFKKLCRFCQTIRRGKNVFVFCKANARHKQKQGWII*
dnqinmyikfk*fk*iyt*rnfqiyi*kkkkkktpknhk*ipkletisfk*kkkkkkrfi
skkkkkkkk

Frame A:
pasdffyllik*kkk*kknetricfqkivqilpny*krkecfcil*skcqt*akarldhl
r*pnkyvykiqiiqiniyikefpniylkkkkkkntqks*ins*irnnfi*ikkkkkkkiy
fkkkkkkkk


Frame B:
prpiffiy*LNKKKNKKRMRHVSAFKKLCRFCQTIRRGKNVFVFCKANARHKQKQGWII*
dnqinmyikfk*fk*iyt*rnfqiyi*kkkkkktpknhk*ipkletisfk*kkkkkkrfi
skkkkkkkk


Frame C:
rvrfflfin*ikkkikke*dtyllskncadsaklleeermflyfvkqmpdiskskvgsfk
itk*ici*nsnnsnkyihkgiskyifkkkkkkkhpkiinkfln*kqfhlnkkkkkkkdlf
qkkkkkkkk

Query= Contig-U06252-1 (Contig-U06252-1Q)
/CSM_Contig/Contig-U06252-1Q.Seq.d
         (389 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U06252-1 (Contig-U06252-1Q) /CSM_Contig/Conti...   256  2e-68
Contig-U09432-1 (Contig-U09432-1Q) /CSM_Contig/Conti...    40  0.002
Contig-U12101-1 (Contig-U12101-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U09755-1 (Contig-U09755-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U07510-1 (Contig-U07510-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U05851-1 (Contig-U05851-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U05674-1 (Contig-U05674-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U05471-1 (Contig-U05471-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U05005-1 (Contig-U05005-1Q) /CSM_Contig/Conti...    38  0.007
Contig-U02000-1 (Contig-U02000-1Q) /CSM_Contig/Conti...    38  0.007

>Contig-U06252-1 (Contig-U06252-1Q) /CSM_Contig/Contig-U06252-1Q.Seq.d
          Length = 389

 Score =  256 bits (129), Expect = 2e-68
 Identities = 129/129 (100%)
 Strand = Plus / Plus

                                                                       
Query: 54  gaatgagacacgtatctgctttcaaaaaattgtgcagattctgccaaactattagaagag 113
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 54  gaatgagacacgtatctgctttcaaaaaattgtgcagattctgccaaactattagaagag 113

                                                                       
Query: 114 gaaagaatgtttttgtattttgtaaagcaaatgccagacataagcaaaagcaaggttgga 173
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 114 gaaagaatgtttttgtattttgtaaagcaaatgccagacataagcaaaagcaaggttgga 173

                    
Query: 174 tcatttaag 182
           |||||||||
Sbjct: 174 tcatttaag 182


 Score =  101 bits (51), Expect = 5e-22
 Identities = 51/51 (100%)
 Strand = Plus / Plus

                                                              
Query: 282 cacccaaaaatcataaataaattcctaaattagaaacaatttcatttaaat 332
           |||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 282 cacccaaaaatcataaataaattcctaaattagaaacaatttcatttaaat 332


 Score = 67.9 bits (34), Expect = 8e-12
 Identities = 34/34 (100%)
 Strand = Plus / Plus

                                            
Query: 1  cccgcgtccgattttttttatttattaattaaat 34
          ||||||||||||||||||||||||||||||||||
Sbjct: 1  cccgcgtccgattttttttatttattaattaaat 34


 Score = 42.1 bits (21), Expect = 4e-04
 Identities = 21/21 (100%)
 Strand = Plus / Plus

                                
Query: 240 ggaatttccaaatatatattt 260
           |||||||||||||||||||||
Sbjct: 240 ggaatttccaaatatatattt 260


>Contig-U09432-1 (Contig-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d
          Length = 1003

 Score = 40.1 bits (20), Expect = 0.002
 Identities = 23/24 (95%)
 Strand = Plus / Plus

                                  
Query: 11 attttttttatttattaattaaat 34
          ||||||||||||||||||| ||||
Sbjct: 30 attttttttatttattaatcaaat 53


>Contig-U12101-1 (Contig-U12101-1Q) /CSM_Contig/Contig-U12101-1Q.Seq.d
          Length = 1915

 Score = 38.2 bits (19), Expect = 0.007
 Identities = 19/19 (100%)
 Strand = Plus / Plus

                             
Query: 16 ttttatttattaattaaat 34
          |||||||||||||||||||
Sbjct: 13 ttttatttattaattaaat 31


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 9705
Number of Sequences: 6905
Number of extensions: 9705
Number of successful extensions: 1877
Number of sequences better than 10.0: 706
length of query: 389
length of database: 5,674,871
effective HSP length: 16
effective length of query: 373
effective length of database: 5,564,391
effective search space: 2075517843
effective search space used: 2075517843
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)

Query= Contig-U06252-1 (Contig-U06252-1Q) /CSM_Contig/Contig-U06252-1Q.Seq.d
         (389 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU261477) Dictyostelium discoideum vegetative cDNA clone:VS...   256   3e-72  2
(AU266865) Dictyostelium discoideum vegetative cDNA clone:VS...   230   2e-70  2
(AU264520) Dictyostelium discoideum vegetative cDNA clone:VS...   248   8e-70  2
(AU264519) Dictyostelium discoideum vegetative cDNA clone:VS...   236   3e-66  2
(AB136998) Homo sapiens DNA, STS on chromosome 7, D7S0759i, ...    50   0.058  1
(DJ459686) Method for analysing genome using microsatellite ...    50   0.058  1
(AC004844) Homo sapiens PAC clone RP4-613I23 from 7p11-p13, ...    50   0.058  1
(DC222185) Plasmodium berghei strain ANKA cDNA clone:MZ00545...    34   0.18   2
(BX005383) Zebrafish DNA sequence from clone DKEYP-19E1 in l...    48   0.23   1
(AC129158) Rattus norvegicus clone CH230-220P5, *** SEQUENCI...    48   0.23   1
(DC230918) Plasmodium berghei strain ANKA cDNA clone:SG02023...    48   0.23   1
(AX345878) Sequence 949 from Patent WO0200928.                     40   0.40   2
(AE017245) Mycoplasma synoviae 53, complete genome.                46   0.43   4
(AG533484) Mus musculus molossinus DNA, clone:MSMg01-444E11....    34   0.65   2
(CR318585) Zebrafish DNA sequence from clone CH211-153H7 in ...    46   0.91   1
(BX927275) Zebrafish DNA sequence from clone DKEY-108P14 in ...    46   0.91   1
(BX664604) Zebrafish DNA sequence from clone CH211-253F20 in...    46   0.91   1
(AC136505) Medicago truncatula clone mth2-24f15, complete se...    46   0.91   1
(AC105841) Rattus norvegicus clone CH230-36A21, *** SEQUENCI...    46   0.91   1
(CR293519) Zebrafish DNA sequence *** SEQUENCING CANCELLED *...    46   0.91   1
(BH447287) BOHPW45TF BOHP Brassica oleracea genomic clone BO...    46   0.91   1
(AG405311) Mus musculus molossinus DNA, clone:MSMg01-263I04....    46   0.91   1
(DN698158) CLJ15-H12.y1d-s SHGC-CLJ Gasterosteus aculeatus c...    46   0.91   1
(BU917745) kb33g06.y1 Brugia malayi 2D L3 pAMP1 v2 Brugia ma...    46   0.91   1
(AI087706) SWAMCAC14B01SK Brugia malayi adult male cDNA (SAW...    46   0.91   1
(BM656129) 17000687387403 A.Gam.ad.cDNA1 Anopheles gambiae c...    46   0.91   1
(BM648008) 17000687324655 A.Gam.ad.cDNA1 Anopheles gambiae c...    46   0.91   1
(BM581863) 17000687274883 A.Gam.ad.cDNA.blood1 Anopheles gam...    46   0.91   1
(BB899238) Macaca fascicularis cDNA clone: Qlv-U271A-E12, 3'...    46   0.91   1
(AA406752) MBAFCZ3B12T3A Brugia malayi adult female cDNA (SA...    46   0.91   1
(AA257433) MBAFCZ3B12T3 Brugia malayi adult female cDNA (SAW...    46   0.91   1
(AC212970) Zea mays chromosome 2 clone CH201-148B2; ZMMBBc01...    32   1.8    2
(AF080121) Arabidopsis thaliana BAC T25C13.                        42   2.1    2
(BX927412) Zebrafish DNA sequence from clone CH211-143A8 in ...    40   2.9    2
(CU137644) Zebrafish DNA sequence from clone CH73-223J14.          44   3.6    1
(CT573318) Zebrafish DNA sequence from clone DKEY-206P7 in l...    44   3.6    1
(CR450843) Zebrafish DNA sequence from clone CH211-246B11 in...    44   3.6    1
(BX255896) Zebrafish DNA sequence from clone CH211-249O11 in...    44   3.6    1
(BX248394) Zebrafish DNA sequence from clone CH211-205P19 in...    44   3.6    1
(BX005221) Zebrafish DNA sequence from clone DKEY-63H22 in l...    44   3.6    1
(BX004988) Zebrafish DNA sequence from clone CH211-79C4 in l...    44   3.6    1
(AL772144) Zebrafish DNA sequence from clone CH211-164J3 in ...    44   3.6    1
(BX000989) Mouse DNA sequence from clone RP23-33D17 on chrom...    44   3.6    1
(AM468316) Vitis vinifera, whole genome shotgun sequence, co...    44   3.6    1
(AM459921) Vitis vinifera contig VV78X043722.10, whole genom...    44   3.6    1
(AC115594) Dictyostelium discoideum chromosome 2 map 4071862...    44   3.6    1
(AC140611) Macaca mulatta clone CH250-288D23, *** SEQUENCING...    44   3.6    1
(CU914431) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    44   3.6    1
(CU896637) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS...    44   3.6    1
(CU611044) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS...    44   3.6    1
(AC222647) Bos taurus clone CH240-443A1, WORKING DRAFT SEQUE...    44   3.6    1
(AZ911298) RPCI-24-193I17.TJ RPCI-24 Mus musculus genomic cl...    44   3.6    1
(FH996658) CHO_OF6882xh06f1.ab1 CHO_OF6 Nicotiana tabacum ge...    44   3.6    1
(FH556687) CHO_OF4838xh13f1.ab1 CHO_OF4 Nicotiana tabacum ge...    44   3.6    1
(CG721555) 1119067H07.x1 1119 - RescueMu Grid AA Zea mays ge...    44   3.6    1
(EL914667) INIT2_80_F09.g2_A006 G5 trophont cDNA (INIT2) Ich...    44   3.6    1
(EB498873) 1099435222916 12-DrosW-norm-1P5Kb Drosophila will...    44   3.6    1
(DY300239) IC0AAA9CD05RM1 CitNFL Citrus clementina cDNA 5', ...    44   3.6    1
(BE037727) AA03D01 AA Arabidopsis thaliana cDNA 5', mRNA seq...    44   3.6    1
(BB973976) Plasmodium berghei strain ANKA cDNA clone:OK00376...    44   3.6    1
(BB973510) Plasmodium berghei strain ANKA cDNA clone:OK00329...    44   3.6    1
(BB973509) Plasmodium berghei strain ANKA cDNA clone:OK00329...    44   3.6    1
(FE347383) CBIB7185.rev CBIB_Daphnia_pulex_Chosen_One_Librar...    44   3.6    1
(AM443414) Vitis vinifera contig VV78X194363.22, whole genom...    36   3.7    2
(AC116293) Rattus norvegicus clone CH230-228D20, WORKING DRA...    38   4.0    2
(EJ151209) 1092343763413 Global-Ocean-Sampling_GS-27-01-01-1...    40   4.2    2
(EJ083178) 1095460068286 Global-Ocean-Sampling_GS-26-01-01-1...    34   4.8    2
(EY859916) CM30-C1-401-020-F06-CT.F Sweet lime leaf, infecte...    40   5.2    2
(DJ387383) Diagnosis of Diseases Associated with Apoptosis.        40   5.5    2
(AX345214) Sequence 285 from Patent WO0200928.                     40   5.5    2
(AX281291) Sequence 33 from Patent WO0177164.                      40   5.5    2
(AC198696) Zea mays chromosome 9 clone CH201-233K16; ZMMBBc0...    32   6.6    2
(AC207736) Zea mays chromosome 7 clone CH201-247F18; ZMMBBc0...    32   6.7    2
(AC191031) Zea mays chromosome unknown clone CH201-68E14; ZM...    32   6.7    2
(CO328978) EK291764.5prime Exelixis FlyTag CK01 pCDNA-SK+ Dr...    36   8.3    2

>(AU261477) Dictyostelium discoideum vegetative cDNA clone:VSA441,
           3' end single read.
          Length = 379

 Score =  256 bits (129), Expect(2) = 3e-72
 Identities = 129/129 (100%)
 Strand = Plus / Plus


Query: 54  gaatgagacacgtatctgctttcaaaaaattgtgcagattctgccaaactattagaagag 113
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 43  gaatgagacacgtatctgctttcaaaaaattgtgcagattctgccaaactattagaagag 102


Query: 114 gaaagaatgtttttgtattttgtaaagcaaatgccagacataagcaaaagcaaggttgga 173
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 103 gaaagaatgtttttgtattttgtaaagcaaatgccagacataagcaaaagcaaggttgga 162


Query: 174 tcatttaag 182
           |||||||||
Sbjct: 163 tcatttaag 171

 Score = 48.1 bits (24), Expect(2) = 3e-72
 Identities = 24/24 (100%)
 Strand = Plus / Plus


Query: 11 attttttttatttattaattaaat 34
          ||||||||||||||||||||||||
Sbjct: 1  attttttttatttattaattaaat 24

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 331,183,312
Number of extensions: 24222816
Number of successful extensions: 2516649
Number of sequences better than 10.0: 77
Length of query: 389
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 366
Effective length of database: 93,106,754,628
Effective search space: 34077072193848
Effective search space used: 34077072193848
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)

Query= Contig-U06252-1 (Contig-U06252-1Q) /CSM_Contig/Contig-U06252-1Q.Seq.d
         (389 letters)

Database: nrp_A
           3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EU959061_1(EU959061|pid:none) Zea mays clone 209887 ribosomal pr...    49   4e-05
AK317333_1(AK317333|pid:none) Arabidopsis thaliana AT5G20180 mRN...    48   9e-05
AM438758_1(AM438758|pid:none) Vitis vinifera contig VV78X225009....    47   2e-04
EF144283_1(EF144283|pid:none) Populus trichocarpa clone PX0015_F...    47   2e-04
AP009568_29(AP009568|pid:none) Welwitschia mirabilis chloroplast...    47   2e-04
AC137507_14(AC137507|pid:none) Oryza sativa chromosome 3 BAC OSJ...    47   3e-04
BX571830_3(BX571830|pid:none) Zebrafish DNA sequence from clone ...    47   3e-04
EF576323_1(EF576323|pid:none) Oryza sativa (indica cultivar-grou...    47   3e-04
EF081500_1(EF081500|pid:none) Picea sitchensis clone WS02724_H15...    46   4e-04
(A5IMA7) RecName: Full=50S ribosomal protein L36;  &(Q9X1I6) Rec...    45   6e-04
(B5YDW6) RecName: Full=50S ribosomal protein L36;  &(B8E1F6) Rec...    45   8e-04
CR382133_144(CR382133|pid:none) Debaryomyces hansenii strain CBS...    44   0.001
(A8F4T5) RecName: Full=50S ribosomal protein L36;  &CP000812_596...    44   0.001
CU928180_213(CU928180|pid:none) Kluyveromyces thermotolerans str...    44   0.001
CR380949_46(CR380949|pid:none) Candida glabrata strain CBS138 ch...    44   0.002
CR382125_820(CR382125|pid:none) Kluyveromyces lactis strain NRRL...    44   0.002
BT050195_1(BT050195|pid:none) Salmo salar clone ssal-evd-551-357...    43   0.003
AE016819_177(AE016819|pid:none) Ashbya gossypii (= Eremothecium ...    43   0.003
BT046813_1(BT046813|pid:none) Salmo salar clone ssal-evf-543-307...    43   0.003
AP010819_51(AP010819|pid:none) Ephedra equisetina chloroplast DN...    43   0.004
(Q493I8) RecName: Full=50S ribosomal protein L36;  &CP000016_203...    43   0.004
(O14464) RecName: Full=54S ribosomal protein YPL183W-A, mitochon...    42   0.005
CP000581_24(CP000581|pid:none) Ostreococcus lucimarinus CCE9901 ...    42   0.005
(P73300) RecName: Full=50S ribosomal protein L36;  &BA000022_750...    42   0.007
AY658326_1(AY658326|pid:none) Synthetic construct Peudomonas aer...    42   0.007
(A4VHQ1) RecName: Full=50S ribosomal protein L36;  &CP000304_794...    42   0.007
CP000712_501(CP000712|pid:none) Pseudomonas putida F1, complete ...    42   0.009
(Q1IFU5) RecName: Full=50S ribosomal protein L36;  &CT573326_460...    42   0.009
(A4XZ69) RecName: Full=50S ribosomal protein L36;  &(A5VXR8) Rec...    42   0.009
(A4SCT2) RecName: Full=50S ribosomal protein L36;  &CP000607_262...    42   0.009
(A9BFZ4) RecName: Full=50S ribosomal protein L36;  &CP000879_741...    41   0.011
(Q89A86) RecName: Full=50S ribosomal protein L36;  &AE016826_408...    41   0.011
(A2BYR6) RecName: Full=50S ribosomal protein L36 2;  &(Q7TU30) R...    41   0.015
CU468135_3142(CU468135|pid:none) Erwinia tasmaniensis strain ET1...    41   0.015
(A2RC37) RecName: Full=50S ribosomal protein L36;  &(B5XJ59) Rec...    41   0.015
FM992688_452(FM992688|pid:none) Candida dubliniensis CD36 chromo...    41   0.015
(Q8D1Z1) RecName: Full=50S ribosomal protein L36;  &BA000021_564...    40   0.019
CP001157_629(CP001157|pid:none) Azotobacter vinelandii DJ, compl...    40   0.019
CP001099_198(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ...    40   0.019
AY552545_97(AY552545|pid:none) Uncultured marine gamma proteobac...    40   0.025
(Q3APJ6) RecName: Full=50S ribosomal protein L36;  &CP000108_180...    40   0.025
(Q1QDG5) RecName: Full=50S ribosomal protein L36;  &CP000323_504...    40   0.025
(Q03ED9) RecName: Full=50S ribosomal protein L36;  &CP000422_132...    40   0.025
(Q839E1) RecName: Full=50S ribosomal protein L36;  &AE016830_213...    40   0.025
(A7HBP1) RecName: Full=50S ribosomal protein L36;  &(Q2IJ62) Rec...    40   0.025
(Q88XW3) RecName: Full=50S ribosomal protein L36;  &AL935254_268...    40   0.025
AM942759_3246(AM942759|pid:none) Proteus mirabilis strain HI4320...    40   0.033
FJ493497_16(FJ493497|pid:none) Monomastix sp. OKE-1 chloroplast,...    40   0.033
CP000863_3257(CP000863|pid:none) Acinetobacter baumannii ACICU, ...    40   0.033
(Q21M37) RecName: Full=50S ribosomal protein L36;  &CP000282_978...    40   0.033
(A1JS06) RecName: Full=50S ribosomal protein L36 2;  &(B1JIY2) R...    40   0.033
(Q7NPQ7) RecName: Full=50S ribosomal protein L36;  &AE016825_416...    39   0.043
(Q8XV34) RecName: Full=50S ribosomal protein L36;  &AL646052_299...    39   0.043
AE017351_303(AE017351|pid:none) Cryptococcus neoformans var. neo...    39   0.043
(Q3J8T4) RecName: Full=50S ribosomal protein L36;  &CP000127_220...    39   0.043
CP001503_270(CP001503|pid:none) Burkholderia glumae BGR1 chromos...    39   0.043
(Q2JQL3) RecName: Full=50S ribosomal protein L36;  &CP000239_137...    39   0.043
(Q04BZ2) RecName: Full=50S ribosomal protein L36;  &(Q1GBJ5) Rec...    39   0.056
CP001103_953(CP001103|pid:none) Alteromonas macleodii 'Deep ecot...    39   0.056
(A7MPF5) RecName: Full=50S ribosomal protein L36 1;  &(A7ZSI8) R...    39   0.056
(B0YPQ9) RecName: Full=Plastid 50S ribosomal protein L36;  &EU04...    39   0.056
CP000934_705(CP000934|pid:none) Cellvibrio japonicus Ueda107, co...    39   0.074
(Q0S3F1) RecName: Full=50S ribosomal protein L36;  &AP008957_187...    39   0.074
(A0L5Z4) RecName: Full=50S ribosomal protein L36;  &CP000471_858...    39   0.074
(Q04G63) RecName: Full=50S ribosomal protein L36;  &CP000411_554...    39   0.074
(A4WFA7) RecName: Full=50S ribosomal protein L36 1;  &CP000653_3...    39   0.074
(Q8M9V5) RecName: Full=50S ribosomal protein L36, chloroplastic;...    39   0.074
(P41631) RecName: Full=50S ribosomal protein L36, chloroplastic;...    39   0.074
(Q38UT4) RecName: Full=50S ribosomal protein L36;  &CR936503_174...    39   0.074
(Q3AMQ0) RecName: Full=50S ribosomal protein L36;  &CP000110_350...    39   0.074
(Q1D752) RecName: Full=50S ribosomal protein L36;  &CP000113_323...    38   0.096
(B1VKC9) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.096
(A1KRJ5) RecName: Full=50S ribosomal protein L36 1;  &(A9M3U4) R...    38   0.096
(Q057C5) RecName: Full=50S ribosomal protein L36;  &AY744382_9(A...    38   0.096
(Q06J37) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.096
(Q85AL7) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.13
FJ565681_4(FJ565681|pid:none) Caulerpa filiformis ribosomal prot...    38   0.13
(Q6YXJ7) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.13
CP001230_1195(CP001230|pid:none) Persephonella marina EX-H1, com...    38   0.13
(A1TYL8) RecName: Full=50S ribosomal protein L36;  &CP000514_729...    38   0.13
(A6MMF6) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.13
(Q20F04) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.13
(A7M930) RecName: Full=Plastid 50S ribosomal protein L36;  &(A8W...    38   0.13
(Q8WHY9) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.13
(Q9MUU8) RecName: Full=50S ribosomal protein L36, chloroplastic;...    38   0.13
(P21532) RecName: Full=50S ribosomal protein L36, chloroplastic;...    37   0.16
AE014184_531(AE014184|pid:none) Tropheryma whipplei str. Twist, ...    37   0.16
AB094662_2(AB094662|pid:none) Coprinopsis cinerea dhfr, mtrpl36 ...    37   0.16
(Q5WLN8) RecName: Full=50S ribosomal protein L36;  &AP006627_174...    37   0.16
(Q06SJ4) RecName: Full=50S ribosomal protein L36, chloroplastic;...    37   0.21
(P59774) RecName: Full=50S ribosomal protein L36, chloroplastic;...    37   0.21
(A0LRP4) RecName: Full=50S ribosomal protein L36;  &CP000481_328...    37   0.21
(B7K227) RecName: Full=50S ribosomal protein L36;  &AP009552_525...    37   0.21
(A2CC48) RecName: Full=50S ribosomal protein L36;  &CP000554_230...    37   0.21
(P57570) RecName: Full=50S ribosomal protein L36;  &BA000003_468...    37   0.21
EF587362_1(EF587362|pid:none) Oedogonium cardiacum strain SAG 57...    37   0.21
(Q1KVS0) RecName: Full=50S ribosomal protein L36, chloroplastic;...    37   0.21
(Q5Z1L3) RecName: Full=50S ribosomal protein L36;  &AP006618_840...    37   0.21
(A0JZ52) RecName: Full=50S ribosomal protein L36 1;  &CP000454_2...    37   0.21
(A1VJ36) RecName: Full=50S ribosomal protein L36;  &(Q12G81) Rec...    37   0.28
(A6W5W2) RecName: Full=50S ribosomal protein L36 2;  &CP000750_7...    37   0.28
(A6W371) RecName: Full=50S ribosomal protein L36;  &CP000749_420...    37   0.28
(A1W329) RecName: Full=50S ribosomal protein L36;  &CP000539_398...    37   0.28
(A6H5L5) RecName: Full=50S ribosomal protein L36, chloroplastic;...    37   0.28
(A0Q4K4) RecName: Full=50S ribosomal protein L36;  &(A4IZR3) Rec...    37   0.28
(Q110C8) RecName: Full=50S ribosomal protein L36;  &CP000393_261...    37   0.28
CP001281_3144(CP001281|pid:none) Thauera sp. MZ1T, complete geno...    37   0.28
(A8MLG5) RecName: Full=50S ribosomal protein L36;  &CP000853_509...    37   0.28
(Q33BZ8) RecName: Full=50S ribosomal protein L36, chloroplastic;...    37   0.28
(A4FPJ6) RecName: Full=50S ribosomal protein L36 2;  &AM420293_6...    37   0.28
FJ546412_10(FJ546412|pid:none) Syntrichia ruralis chloroplast, c...    37   0.28
(A1TJT8) RecName: Full=50S ribosomal protein L36;  &CP000512_608...    37   0.28
(P80256) RecName: Full=50S ribosomal protein L36; AltName: Full=...    36   0.37
(A5GIS5) RecName: Full=50S ribosomal protein L36;  &CT971583_414...    36   0.37
AX588201_1(AX588201|pid:none) Sequence 76 from Patent WO02083898.      36   0.37
(A1R8R8) RecName: Full=50S ribosomal protein L36 2;  &(A9WSR4) R...    36   0.37
(A6MMP1) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.37
(Q8K970) RecName: Full=50S ribosomal protein L36;  &AE013218_455...    36   0.37
(Q3BAK3) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.37
EU016914_1(EU016914|pid:none) Elaeis oleifera ribosomal protein ...    36   0.37
(Q9P0J6) RecName: Full=39S ribosomal protein L36, mitochondrial;...    36   0.37
(B2GJ17) RecName: Full=50S ribosomal protein L36 1;  &AP009152_6...    36   0.37
(Q0ABF4) RecName: Full=50S ribosomal protein L36;  &CP000453_474...    36   0.37
(A4QJE9) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.37
(Q0P3P7) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.37
(Q1ACG5) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.37
AY198133_42(AY198133|pid:none) Spiroplasma kunkelii strain CR2-3...    36   0.37
(P66301) RecName: Full=50S ribosomal protein L36 1;  &(P66302) R...    36   0.37
(Q0RRP7) RecName: Full=50S ribosomal protein L36;  &(Q2JFF2) Rec...    36   0.37
(P51296) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.48
(Q6F1X0) RecName: Full=50S ribosomal protein L36;  &AE017263_147...    36   0.48
EF587424_1(EF587424|pid:none) Floydiella terrestris strain UTEX ...    36   0.48
(Q1IS98) RecName: Full=50S ribosomal protein L36;                      36   0.48
(O94690) RecName: Full=54S ribosomal protein c83.06c, mitochondr...    36   0.48
(B0Z4R0) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.48
CP001339_2278(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ...    36   0.48
(Q8R7X8) RecName: Full=50S ribosomal protein L36;  &AE008691_209...    36   0.48
CP001277_1660(CP001277|pid:none) Candidatus Hamiltonella defensa...    36   0.48
(Q99N90) RecName: Full=39S ribosomal protein L36, mitochondrial;...    36   0.48
(Q21QP5) RecName: Full=50S ribosomal protein L36;                      36   0.48
(Q3AW73) RecName: Full=50S ribosomal protein L36;  &(Q7U4I0) Rec...    36   0.48
AP006715_109(AP006715|pid:none) Porphyra yezoensis chloroplast D...    36   0.48
CP001344_1097(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    36   0.48
(Q06GM6) RecName: Full=50S ribosomal protein L36, chloroplastic;...    36   0.48
AM285304_124(AM285304|pid:none) Spiroplasma citri GII3-3X chromo...    36   0.48
(Q1XDJ2) RecName: Full=50S ribosomal protein L36, chloroplastic;       36   0.48
(Q3ZJ79) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   0.62
EU922075_1(EU922075|pid:none) Erodium chrysanthum ribosomal prot...    35   0.62
(Q1R0F4) RecName: Full=50S ribosomal protein L36;                      35   0.62
EU922290_1(EU922290|pid:none) Geranium macrorrhizum ribosomal pr...    35   0.62
(Q1LTB7) RecName: Full=50S ribosomal protein L36;  &CP000238_318...    35   0.62
(Q4MYA8) RecName: Full=50S ribosomal protein L36, apicoplast;          35   0.62
(A6MMX8) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   0.62
(B4U768) RecName: Full=50S ribosomal protein L36;  &CP001130_287...    35   0.62
(A0A369) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   0.62
FP312982_26(FP312982|pid:none) uncultured bacterial clone mtbs45...    35   0.62
CP001013_3905(CP001013|pid:none) Leptothrix cholodnii SP-6, comp...    35   0.62
(A6YGD2) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   0.62
EF587486_1(EF587486|pid:none) Chlamydomonas moewusii strain UTEX...    35   0.62
(P07815) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   0.62
(Q5P311) RecName: Full=50S ribosomal protein L36;  &CR555306_217...    35   0.62
(Q9RDV9) RecName: Full=50S ribosomal protein L36;  &AE015450_631...    35   0.81
CP000860_241(CP000860|pid:none) Candidatus Desulforudis audaxvia...    35   0.81
(A7GK44) RecName: Full=50S ribosomal protein L36;  &(B7GJ91) Rec...    35   0.81
(P49568) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   0.81
(A0PXX1) RecName: Full=50S ribosomal protein L36;  &(A5I7I1) Rec...    35   0.81
(A4QKM6) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   0.81
(Q250K8) RecName: Full=50S ribosomal protein L36;  &AP008230_495...    35   0.81
(B2V7I9) RecName: Full=50S ribosomal protein L36;  &CP001080_260...    35   0.81
(P30069) RecName: Full=50S ribosomal protein L36, plastid;  &M81...    35   0.81
(Q5SD21) RecName: Full=50S ribosomal protein L36, chloroplastic;       35   0.81
(A0ALU5) RecName: Full=50S ribosomal protein L36;  &(P66290) Rec...    35   0.81
(A1WVA1) RecName: Full=50S ribosomal protein L36;  &CP000544_818...    35   1.1
CP000923_869(CP000923|pid:none) Thermoanaerobacter sp. X514, com...    35   1.1
(A4J135) RecName: Full=50S ribosomal protein L36;  &CP000612_236...    35   1.1
(A1SNJ2) RecName: Full=50S ribosomal protein L36;  &CP000509_382...    35   1.1
(A6TWF7) RecName: Full=50S ribosomal protein L36;  &(Q8ETW1) Rec...    35   1.1
(A5N4S1) RecName: Full=50S ribosomal protein L36;  &AP009049_207...    35   1.1
(Q7NFF1) RecName: Full=50S ribosomal protein L36;  &BA000045_357...    35   1.1
EU168190_128(EU168190|pid:none) Heterosigma akashiwo strain NIES...    35   1.1
AY660566_10(AY660566|pid:none) Huperzia lucidula chloroplast, co...    35   1.1
EU922506_1(EU922506|pid:none) Monsonia vanderietiae ribosomal pr...    35   1.1
(A0T0Z1) RecName: Full=50S ribosomal protein L36, chloroplastic;...    35   1.1
CP001618_3094(CP001618|pid:none) Beutenbergia cavernae DSM 12333...    35   1.1
(Q7VQC7) RecName: Full=50S ribosomal protein L36;  &BX248583_199...    34   1.4
(Q8DML2) RecName: Full=50S ribosomal protein L36;  &BA000039_102...    34   1.4
AY958086_30(AY958086|pid:none) Zygnema circumcarinatum chloropla...    34   1.4
(B2A4G1) RecName: Full=50S ribosomal protein L36;                      34   1.4
(Q32RN0) RecName: Full=50S ribosomal protein L36, chloroplastic;       34   1.4
(Q67JW7) RecName: Full=50S ribosomal protein L36;  &AP006840_304...    34   1.4
CP000884_3636(CP000884|pid:none) Delftia acidovorans SPH-1, comp...    34   1.8
(Q18CI1) RecName: Full=50S ribosomal protein L36;  &(Q97EK2) Rec...    34   1.8
(Q7TUP2) RecName: Full=50S ribosomal protein L36;  &BX548175_227...    34   1.8
(A5F559) RecName: Full=50S ribosomal protein L36 2;  &(A7MWH9) R...    34   1.8
(Q3V500) RecName: Full=50S ribosomal protein L36, chloroplastic;...    34   1.8
S72299(S72299) ribosomal protein L36 - Plasmodium falciparum pla...    34   1.8
(A3N378) RecName: Full=50S ribosomal protein L36 1;  &CP000569_1...    34   1.8
(P07841) RecName: Full=50S ribosomal protein L36; AltName: Full=...    34   1.8
(B0BSV2) RecName: Full=50S ribosomal protein L36 1;  &CP000687_1...    34   1.8
(Q06FN0) RecName: Full=50S ribosomal protein L36, chloroplastic;...    34   1.8
CP001348_773(CP001348|pid:none) Clostridium cellulolyticum H10, ...    34   1.8
(Q7VKF4) RecName: Full=50S ribosomal protein L36 1;  &AE017143_1...    33   2.4
(Q5L3R5) RecName: Full=50S ribosomal protein L36;  &BA000043_130...    33   2.4
(A1AVM1) RecName: Full=50S ribosomal protein L36;  &CP000488_174...    33   2.4
(Q9X7A2) RecName: Full=50S ribosomal protein L36;  &AL049491_31(...    33   2.4
DQ417669_2(DQ417669|pid:none) Elymus dahuricus strain PI574531 I...    33   2.4
DQ417687_2(DQ417687|pid:none) Thinopyrum intermedium strain PI40...    33   2.4
(A1E9M4) RecName: Full=50S ribosomal protein L36, chloroplastic;...    33   2.4
(A5CU83) RecName: Full=50S ribosomal protein L36 1;  &AM711867_2...    33   2.4
(P57942) RecName: Full=50S ribosomal protein L36;  &AE004439_139...    33   2.4
(A6T3I2) RecName: Full=50S ribosomal protein L36;  &CP000269_338...    33   2.4
CP001358_670(CP001358|pid:none) Desulfovibrio desulfuricans subs...    33   3.1
(A9WH89) RecName: Full=50S ribosomal protein L36;  &CP000909_234...    33   3.1
FP236842_2597(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9...    33   3.1
(A3DJJ7) RecName: Full=50S ribosomal protein L36;  &CP000568_288...    33   3.1
(A1VE94) RecName: Full=50S ribosomal protein L36;  &(Q72CF8) Rec...    33   3.1
(P24355) RecName: Full=50S ribosomal protein L36, plastid;  &AJ2...    33   3.1
CU468135_2483(CU468135|pid:none) Erwinia tasmaniensis strain ET1...    33   3.1
(B5ZB63) RecName: Full=50S ribosomal protein L36;  &CP001184_240...    33   3.1
(Q46501) RecName: Full=50S ribosomal protein L36;  &CP000112_223...    33   4.0
CP000679_2176(CP000679|pid:none) Caldicellulosiruptor saccharoly...    33   4.0
(Q9TL26) RecName: Full=50S ribosomal protein L36, chloroplastic;...    33   4.0
CP000302_191(CP000302|pid:none) Shewanella denitrificans OS217, ...    33   4.0
(Q85FU5) RecName: Full=50S ribosomal protein L36, chloroplastic;...    33   4.0
(A1SXW4) RecName: Full=50S ribosomal protein L36;  &CP000510_245...    33   4.0
(Q6LV95) RecName: Full=50S ribosomal protein L36;  &CR378663_325...    33   4.0
CP000930_1355(CP000930|pid:none) Heliobacterium modesticaldum Ic...    33   4.0
AM910993_105(AM910993|pid:none) Plasmodium knowlesi strain H chr...    33   4.0
(A7NR40) RecName: Full=50S ribosomal protein L36;  &CP000804_389...    33   4.0
(Q06R98) RecName: Full=50S ribosomal protein L36, chloroplastic;...    33   4.0
(A8ETK2) RecName: Full=50S ribosomal protein L36;  &CP000361_991...    33   4.0
(A5USG6) RecName: Full=50S ribosomal protein L36;  &CP000686_112...    32   5.3
(A1W1J3) RecName: Full=50S ribosomal protein L36;  &(A8FNQ3) Rec...    32   5.3
(A5CXI5) RecName: Full=50S ribosomal protein L36;  &AP009247_181...    32   5.3
(Q5F860) RecName: Full=50S ribosomal protein L36;  &AE004969_854...    32   5.3
(Q089N3) RecName: Full=50S ribosomal protein L36;  &CP000447_169...    32   5.3
CU458896_3745(CU458896|pid:none) Mycobacterium abscessus chromos...    32   5.3
(Q3A6M4) RecName: Full=50S ribosomal protein L36;  &CP000142_798...    32   5.3
(O66487) RecName: Full=50S ribosomal protein L36;                      32   5.3
(A0PMB3) RecName: Full=50S ribosomal protein L36;  &(A0QKU9) Rec...    32   5.3
(Q30TS7) RecName: Full=50S ribosomal protein L36;  &CP000153_323...    32   6.9
(Q488Z2) RecName: Full=50S ribosomal protein L36;  &CP000083_590...    32   6.9
CP000806_4032(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    32   6.9
(A9M4E0) RecName: Full=50S ribosomal protein L36 2;  &CP000381_8...    32   6.9
(A1KTL0) RecName: Full=50S ribosomal protein L36 2;  &(P66294) R...    32   6.9
CP001098_139(CP001098|pid:none) Halothermothrix orenii H 168, co...    32   6.9
(A1KPE7) RecName: Full=50S ribosomal protein L36;  &(A5U8D7) Rec...    32   6.9
(A6Q1K0) RecName: Full=50S ribosomal protein L36;  &AP009178_245...    32   6.9
(A4XLQ6) RecName: Full=50S ribosomal protein L36;  &CP001393_164...    32   6.9
(A5D5E4) RecName: Full=50S ribosomal protein L36;  &AP009389_344...    32   6.9
(Q01WB6) RecName: Full=50S ribosomal protein L36;  &CP000473_503...    32   9.0
(A7M997) RecName: Full=Plastid 50S ribosomal protein L36;  &AM71...    32   9.0
AJ749949_499(AJ749949|pid:none) Francisella tularensis subsp. tu...    32   9.0
CP000608_1261(CP000608|pid:none) Francisella tularensis subsp. t...    32   9.0
AM233362_1557(AM233362|pid:none) Francisella tularensis subsp. h...    32   9.0
CP001275_920(CP001275|pid:none) Thermomicrobium roseum DSM 5159,...    32   9.0
AP009510_105(AP009510|pid:none) Uncultured Termite group 1 bacte...    32   9.0
(Q4G350) RecName: Full=50S ribosomal protein L36, chloroplastic;...    32   9.0
(Q9PAQ5) RecName: Full=50S ribosomal protein L36;  &AE003849_242...    32   9.0
CP000915_1121(CP000915|pid:none) Francisella tularensis subsp. m...    32   9.0
(Q04PW1) RecName: Full=50S ribosomal protein L36;  &(Q055C1) Rec...    32   9.0
CP000803_1641(CP000803|pid:none) Francisella tularensis subsp. h...    32   9.0
(Q9XD13) RecName: Full=50S ribosomal protein L36;  &AF115283_28(...    32   9.0

>EU959061_1(EU959061|pid:none) Zea mays clone 209887 ribosomal
           protein L36 containing protein mRNA, complete cds.
          Length = 98

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 21/39 (53%), Positives = 30/39 (76%)
 Frame = +2

Query: 56  MRHVSAFKKLCRFCQTIRRGKNVFVFCKANARHKQKQGW 172
           M+  +A K+LCRFC+ ++R   VFV C ANA+HKQ+QG+
Sbjct: 1   MKVRAAVKRLCRFCKVVKRRGIVFVQCTANAKHKQRQGF 39

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 353,034,795
Number of extensions: 4935153
Number of successful extensions: 11541
Number of sequences better than 10.0: 263
Number of HSP's gapped: 11431
Number of HSP's successfully gapped: 263
Length of query: 129
Length of database: 1,040,966,779
Length adjustment: 94
Effective length of query: 35
Effective length of database: 739,763,989
Effective search space: 25891739615
Effective search space used: 25891739615
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)

 psg: 0.66  gvh: 0.42  alm: 0.56  top: 0.53  tms: 0.00  mit: 0.60  mip: 0.00
 nuc: 0.24  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.50  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 80.0 %: cytoplasmic
	 16.0 %: mitochondrial
	  4.0 %: nuclear

>> prediction for Contig-U06252-1 is cyt