| Homology vs DNA |
 Query= Contig-U05994-1 (Contig-U05994-1Q) /CSM_Contig/Contig-U05994-1Q.Seq.d
(1236 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ429354) Dictyostelium discoideum cDNA clone:ddv3p01, 3' e... 1350 0.0 1
(BJ411153) Dictyostelium discoideum cDNA clone:ddv3p01, 5' e... 1023 0.0 1
(FC819155) Sr_pAMT7_013p24_T7 S. ratti mixed stage pAMP Stro... 56 3e-16 3
(AM647096) Entamoeba moshkovskii FIC GSS, clone mosh047a05.p1k. 48 8e-16 6
(AM662663) Entamoeba moshkovskii FIC GSS, clone mosh126c05.p1k. 48 2e-15 6
(AR550432) Sequence 5563 from patent US 6747137. 58 1e-14 4
(AM653148) Entamoeba moshkovskii FIC GSS, clone mosh126c05.q1k. 48 5e-12 5
(EE621442) CHWM8554.b1_D03.ab1 CHW(LMS) silverleaf sunflower... 52 9e-12 3
(FC710254) CAXY6243.fwd CAXY Lottia gigantea from male gonad... 50 9e-12 3
(AM647620) Entamoeba moshkovskii FIC GSS, clone mosh052c09.q1k. 48 2e-11 4
(EE618932) CHWM622.b1_K12.ab1 CHW(LMS) silverleaf sunflower ... 46 5e-10 3
(FC726666) CBBG3667.fwd CBBG Lottia gigantea 12,15,18h embry... 50 1e-09 3
(CU430723) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 1e-08 5
(FG847134) UCRVU05_CCNN14973_g1 Cowpea IT84S-2049 Mixed Tiss... 50 2e-08 2
(FG847133) UCRVU05_CCNN14973_b1 Cowpea IT84S-2049 Mixed Tiss... 50 2e-08 2
(EH014753) USDA-FP_187422 Lysiphlebus testaceipes adult whol... 52 2e-08 4
(EI901908) VUH2-42H20TR VUUBBa (VUH2) Vigna unguiculata geno... 50 3e-08 2
(CU426066) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 3e-08 3
(EI932920) VUH2-74L13TV VUUBBa (VUH2) Vigna unguiculata geno... 50 3e-08 2
(FF419062) G125P60000RH5.T0 Acorn worm blastula/gastrula pCM... 46 2e-07 3
(FF661297) G826P5303RC4.T0 Acorn worm normalized juvenile pE... 46 2e-07 3
(EH010056) USDA-FP_183192 Lysiphlebus testaceipes adult whol... 40 4e-07 4
(FC739654) CBBI11337.fwd CBBI Lottia gigantea 26h,37h,61h La... 56 4e-06 3
(CJ760880) Ipomoea nil cDNA clone:jmsf24e17, 3' end. 46 5e-06 2
(CJ761556) Ipomoea nil cDNA clone:jmsf26d15, 3' end. 46 5e-06 2
(FE231150) CAPG10243.fwd CAPG Naegleria gruberi amoeba stage... 58 6e-06 2
(CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 54 7e-06 22
(EF059141) Synthetic construct Saccharomyces cerevisiae clon... 44 1e-05 4
(EA396904) Sequence 45728 from patent US 7314974. 44 1e-05 4
(DJ206332) Method for identification of useful proteins deri... 44 1e-05 4
(CJ350468) Molgula tectiformis cDNA, cleaving embryo clone:m... 64 1e-05 1
(FE240428) CAPG5847.fwd CAPG Naegleria gruberi amoeba stage ... 34 2e-05 5
(EL494207) C07_PFBAMHI-M-T3-PLATE1A.AB1 Blood stage Plasmodi... 46 2e-05 2
(EJ770351) 1092966001644 Global-Ocean-Sampling_GS-30-02-01-1... 56 2e-05 2
(AM635460) Entamoeba dispar GSS, clone dispar14a02.p1k. 44 2e-05 4
(CF656062) tac63e01.x1 Hydra EST -IV Hydra magnipapillata cD... 50 4e-05 3
(EF690548) Plasmodium falciparum DEAD-box helicase 2 gene, c... 46 4e-05 2
(AM441941) Vitis vinifera contig VV78X036116.11, whole genom... 56 5e-05 4
(DN636516) ACAC-aab45m11.g1 Hydra EST UCI 7 Hydra magnipapil... 50 5e-05 2
(EX645983) 256693286 Pea aphid whole body normalized full le... 44 6e-05 3
(AZ677027) ENTHN58TF Entamoeba histolytica Sheared DNA Entam... 46 6e-05 3
(AZ678705) ENTLE08TF Entamoeba histolytica Sheared DNA Entam... 46 7e-05 3
(BH156034) ENTRR16TR Entamoeba histolytica Sheared DNA Entam... 46 8e-05 3
(AZ670960) ENTKE30TF Entamoeba histolytica Sheared DNA Entam... 40 8e-05 3
(EJ831116) 1093017581480 Global-Ocean-Sampling_GS-30-02-01-1... 48 8e-05 3
(AZ544484) ENTDN33TR Entamoeba histolytica Sheared DNA Entam... 40 8e-05 3
(AZ684590) ENTII70TF Entamoeba histolytica Sheared DNA Entam... 46 8e-05 3
(ER584165) 1093015858940 Global-Ocean-Sampling_GS-36-01-01-2... 60 2e-04 1
(EL449723) CHTM2831.b1_N11.ab1 CHT(LMS) Jerusalem artichoke ... 60 2e-04 1
(DR451101) WS00954.BR_L05 IS-B-N-A-10 Picea engelmannii x Pi... 46 2e-04 3
(EX316550) GQ02810.B7_M15 GQ028 - Cambium / phloem scrapping... 46 2e-04 3
(EY843838) CA26-C1-002-021-G03-CT.F Sour orange leaf, field ... 44 3e-04 2
(CX070743) UCRCS08_18F08_g Parent Washington Navel Orange Ca... 44 3e-04 2
(EY858370) CG32-C1-003-095-G07-CT.F Mexican lime leaf, green... 44 4e-04 2
(DR395160) USDA-FP_155095 Adult Alate Aphis gossypii (WHAGA)... 44 4e-04 3
(AE001421) Plasmodium falciparum 3D7 chromosome 2 section 58... 46 5e-04 2
(CV464189) taj37a07.y1 Hydra EST UCI 5 ALP Hydra magnipapill... 36 6e-04 3
(CU429323) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 8e-04 2
(CU429641) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 8e-04 2
(DR447511) AR1045B12 A. gomesiana hemocytes normalized libra... 42 8e-04 2
(DY951785) CHPY8059.b1_F24.ab1 CHP(XYZ) plains sunflower Hel... 58 8e-04 1
(DT577884) aam01-45ms1-p21 Aam01 Acorus americanus cDNA clon... 58 8e-04 1
(AE015927) Clostridium tetani E88, complete genome. 58 8e-04 1
(AM285305) Spiroplasma citri GII3-3X chromosome, contig Cont... 48 8e-04 9
(FF326857) 280429413 Pea aphid whole body normalized full le... 44 0.001 2
(ER491537) 1093015328595 Global-Ocean-Sampling_GS-35-01-01-1... 46 0.001 3
(EX652213) 256760528 Pea aphid whole body normalized full le... 44 0.001 2
(FC728396) CBBG4748.rev CBBG Lottia gigantea 12,15,18h embry... 56 0.001 2
(EX604961) 255344855 Pea aphid whole body normalized full le... 44 0.001 2
(EX648384) 256722203 Pea aphid whole body normalized full le... 44 0.001 2
(FE235056) CAPG3154.fwd CAPG Naegleria gruberi amoeba stage ... 46 0.001 2
(FC728397) CBBG4748.fwd CBBG Lottia gigantea 12,15,18h embry... 56 0.001 2
(FE244807) CAPG8398.fwd CAPG Naegleria gruberi amoeba stage ... 46 0.001 2
(AZ679916) ENTJR28TR Entamoeba histolytica Sheared DNA Entam... 40 0.001 3
(FE244242) CAPG8089.fwd CAPG Naegleria gruberi amoeba stage ... 46 0.001 2
(EJ456184) 1093017482150 Global-Ocean-Sampling_GS-28-01-01-1... 48 0.001 2
(AJ561352) Cryptosporidium parvum GSS, PAC clone pica_0001_h... 44 0.002 3
(DT595096) she01-22ms2-h05 She01 Saruma henryi cDNA clone sh... 44 0.003 2
(EV435154) 34459_1 Quinqueloculina sp. cDNA library Quinquel... 44 0.003 2
(AB258889) Loxodonta africana DDX47 gene, INT226 locus seque... 56 0.003 1
(EJ740214) 1092962012576 Global-Ocean-Sampling_GS-30-02-01-1... 56 0.003 1
(CT509449) A BAC library has been constructed from cultivar ... 56 0.003 1
(CB098385) ku52h01.y1 Strongyloides ratti PA female naive pA... 56 0.003 1
(FC778430) CBGC11127.fwd CBGC Lottia gigantea 15h 18h embryo... 56 0.003 1
(CP000721) Clostridium beijerinckii NCIMB 8052, complete gen... 56 0.003 1
(EK333454) 1095467032649 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.003 3
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 42 0.003 12
(ES642526) NVPPO18TR NVPP Nasonia vitripennis cDNA, mRNA seq... 44 0.004 2
(CU427368) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 40 0.004 4
(CU438461) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 40 0.004 4
(AL395240) T7 end of clone AR0AA022D05 of library AR0AA from... 52 0.005 2
(EH015427) USDA-FP_188028 Lysiphlebus testaceipes adult whol... 44 0.006 2
(AX536852) Sequence 453 from Patent WO02064766. 50 0.007 2
(AR941631) Sequence 453 from patent US 7101990. 50 0.007 2
(AR549950) Sequence 5081 from patent US 6747137. 50 0.007 2
(BP533704) Nicotiana tabacum cDNA, clone: BY31020, primer: M... 46 0.010 2
(CZ280036) cp09b07.r Candida parapsilosis Random Genomic Lib... 40 0.011 3
(BW520831) Ciona savignyi cDNA, clone:csga060g03, 5'end, sin... 42 0.012 2
(AI895038) EST264481 tomato callus, TAMU Solanum lycopersicu... 46 0.012 2
(BW535828) Ciona savignyi cDNA, clone:csma086i19, 5'end, sin... 42 0.013 2
>(BJ429354) Dictyostelium discoideum cDNA clone:ddv3p01, 3' end,
single read.
Length = 685
Score = 1350 bits (681), Expect = 0.0
Identities = 684/684 (100%)
Strand = Plus / Minus
Query: 553 aaattgctagtattttagaacatttaccaccaccagaaaaaagacaaacattattatttt 612
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 685 aaattgctagtattttagaacatttaccaccaccagaaaaaagacaaacattattatttt 626
Query: 613 cagcaacaatgacaaagaatttaacaaaattagatagtatagcattaaataaaccattta 672
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 625 cagcaacaatgacaaagaatttaacaaaattagatagtatagcattaaataaaccattta 566
Query: 673 tatttgaagataattcaaagtatgatacagttgatacattgaaacaagagtatatttata 732
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 565 tatttgaagataattcaaagtatgatacagttgatacattgaaacaagagtatatttata 506
Query: 733 tgccagcaccaacaaaagattgttatttggtatacattttaaagaaacatgaaggatcat 792
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 505 tgccagcaccaacaaaagattgttatttggtatacattttaaagaaacatgaaggatcat 446
Query: 793 cagcaattgtatttgtaaataattgttatgcagttgaagcagttaaaggaatgttaaata 852
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 445 cagcaattgtatttgtaaataattgttatgcagttgaagcagttaaaggaatgttaaata 386
Query: 853 aattggatattccatcggtttcattacattcattcctcgatcaaaagagtagattagcag 912
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 385 aattggatattccatcggtttcattacattcattcctcgatcaaaagagtagattagcag 326
Query: 913 cattgaaaacctttaaatctggaaaagtgaaagtattggtggcaactgatgttgcaagtc 972
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 325 cattgaaaacctttaaatctggaaaagtgaaagtattggtggcaactgatgttgcaagtc 266
Query: 973 gtggtttagatattcctgacgttcaaatcgttatcaattataaattatcaaactcttcaa 1032
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 265 gtggtttagatattcctgacgttcaaatcgttatcaattataaattatcaaactcttcaa 206
Query: 1033 aagattatattcatcgtgttggtagaacggctagatttggtcgttcaggtagagccattt 1092
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 205 aagattatattcatcgtgttggtagaacggctagatttggtcgttcaggtagagccattt 146
Query: 1093 cattcattacaccacangatgtatccttaattaaaggcattgaagaaatcattaaaaaac 1152
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 145 cattcattacaccacangatgtatccttaattaaaggcattgaagaaatcattaaaaaac 86
Query: 1153 aattggaactttataaaactgatgatgatgaagtatttagacatttaaaagaagcttcaa 1212
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 85 aattggaactttataaaactgatgatgatgaagtatttagacatttaaaagaagcttcaa 26
Query: 1213 cagctagaaaaaagttaaatacat 1236
||||||||||||||||||||||||
Sbjct: 25 cagctagaaaaaagttaaatacat 2
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,515,607,578
Number of extensions: 93196547
Number of successful extensions: 7849317
Number of sequences better than 10.0: 501
Length of query: 1236
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1212
Effective length of database: 97,308,875,965
Effective search space: 117938357669580
Effective search space used: 117938357669580
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U05994-1 (Contig-U05994-1Q) /CSM_Contig/Contig-U05994-1Q.Seq.d
(1236 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q55BR9) RecName: Full=Probable ATP-dependent RNA helicase ddx49... 760 0.0
BC064887_1(BC064887|pid:none) Xenopus tropicalis DEAD (Asp-Glu-A... 387 e-106
(Q9Y6V7) RecName: Full=Probable ATP-dependent RNA helicase DDX49... 387 e-106
AK291916_1(AK291916|pid:none) Homo sapiens cDNA FLJ77346 complet... 384 e-105
BC072323_1(BC072323|pid:none) Xenopus laevis DEAD (Asp-Glu-Ala-A... 384 e-105
(Q29S22) RecName: Full=Probable ATP-dependent RNA helicase DDX47... 375 e-102
(Q4FZF3) RecName: Full=Probable ATP-dependent RNA helicase DDX49... 374 e-102
BC075762_1(BC075762|pid:none) Danio rerio DEAD (Asp-Glu-Ala-Asp)... 374 e-102
BX936438_5(BX936438|pid:none) Zebrafish DNA sequence from clone ... 373 e-102
AJ276704_1(AJ276704|pid:none) Homo sapiens mRNA for DEAD box pro... 371 e-101
(Q9H0S4) RecName: Full=Probable ATP-dependent RNA helicase DDX47... 370 e-101
BC009379_1(BC009379|pid:none) Homo sapiens DEAD (Asp-Glu-Ala-Asp... 370 e-101
AE014134_3451(AE014134|pid:none) Drosophila melanogaster chromos... 369 e-100
AY121677_1(AY121677|pid:none) Drosophila melanogaster RE27528 fu... 369 e-100
(Q9SA27) RecName: Full=Putative DEAD-box ATP-dependent RNA helic... 368 e-100
AB462951_1(AB462951|pid:none) Synthetic construct DNA, clone: pF... 368 e-100
BC072214_1(BC072214|pid:none) Xenopus laevis hypothetical protei... 367 e-100
AM441941_4(AM441941|pid:none) Vitis vinifera contig VV78X036116.... 367 e-100
AJ719824_1(AJ719824|pid:none) Gallus gallus mRNA for hypothetica... 364 4e-99
AY088068_1(AY088068|pid:none) Arabidopsis thaliana clone 40850 m... 363 7e-99
BC095776_1(BC095776|pid:none) Danio rerio zgc:112350, mRNA (cDNA... 362 1e-98
(P34580) RecName: Full=Putative ATP-dependent RNA helicase T26G1... 361 3e-98
AC146793_11(AC146793|pid:none) Medicago truncatula clone mth2-10... 358 2e-97
AC174377_27(AC174377|pid:none) Medicago truncatula clone mth2-57... 358 3e-97
AB236772_1(AB236772|pid:none) Trifolium pratense RNA for putativ... 355 1e-96
(Q8L4E9) RecName: Full=DEAD-box ATP-dependent RNA helicase 36; ... 355 2e-96
(Q5KBE2) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 351 3e-95
AC138448_18(AC138448|pid:none) Medicago truncatula clone mth2-11... 350 5e-95
CP001327_185(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 350 6e-95
CP000592_69(CP000592|pid:none) Ostreococcus lucimarinus CCE9901 ... 350 8e-95
(A1D405) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 347 4e-94
(Q4WJE9) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 347 7e-94
CR954212_61(CR954212|pid:none) Ostreococcus tauri strain OTTH059... 347 7e-94
BT035159_1(BT035159|pid:none) Zea mays full-length cDNA clone ZM... 345 1e-93
EU960244_1(EU960244|pid:none) Zea mays clone 222826 ATP-dependen... 345 2e-93
AC006661_4(AC006661|pid:none) Caenorhabditis elegans fosmid H20J... 345 2e-93
(Q9P6N8) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 345 2e-93
AJ301641_2(AJ301641|pid:none) Fugu rubripes ORF1 (partial), ORF2... 345 2e-93
(A7EML8) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 343 6e-93
(A6QRQ7) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 343 6e-93
(A1CR32) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 343 7e-93
(Q1E1N5) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 342 1e-92
(A5E0U9) RecName: Full=ATP-dependent RNA helicase DBP8; ... 339 1e-91
(Q5B5E7) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 338 2e-91
BT076534_1(BT076534|pid:none) Caligus rogercresseyi clone crog-e... 338 2e-91
(A6RW56) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 337 4e-91
(Q7Y183) RecName: Full=DEAD-box ATP-dependent RNA helicase 10; ... 335 2e-90
FN392320_400(FN392320|pid:none) Pichia pastoris GS115 chromosome... 335 3e-90
CP000582_291(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 334 3e-90
(A2RB17) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 333 7e-90
(A7TK63) RecName: Full=ATP-dependent RNA helicase DBP8; ... 332 2e-89
(Q6CH58) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 332 2e-89
(Q7RY59) RecName: Full=ATP-dependent rRNA helicase rrp-3; ... 330 6e-89
(A3LP87) RecName: Full=ATP-dependent RNA helicase DBP8; ... 330 6e-89
(A5DLE0) RecName: Full=ATP-dependent RNA helicase DBP8; ... 329 1e-88
FM992695_499(FM992695|pid:none) Candida dubliniensis CD36 chromo... 329 1e-88
CU928180_21(CU928180|pid:none) Kluyveromyces thermotolerans stra... 329 1e-88
(Q6C799) RecName: Full=ATP-dependent RNA helicase DBP8; ... 328 2e-88
(Q0CIQ3) RecName: Full=ATP-dependent rRNA helicase rrp3; ... 328 2e-88
CR954202_287(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 327 4e-88
(Q2H1Q8) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 327 4e-88
(Q6FQZ0) RecName: Full=ATP-dependent RNA helicase DBP8; ... 327 7e-88
(Q59PR3) RecName: Full=ATP-dependent RNA helicase DBP8; ... 327 7e-88
(A6ZSX1) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 326 1e-87
CR940348_231(CR940348|pid:none) Theileria annulata strain Ankara... 326 1e-87
CU928175_590(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 325 2e-87
(P38712) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 325 3e-87
S46713(S46713) ATP-dependent RNA helicase YHR065c [similarity] -... 325 3e-87
(Q756G5) RecName: Full=ATP-dependent RNA helicase DBP8; ... 322 1e-86
CU638744_755(CU638744|pid:none) Podospora anserina genomic DNA c... 322 2e-86
(Q6FNK8) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 322 2e-86
CU928175_483(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 320 5e-86
(Q0UK12) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 320 7e-86
AY847069_1(AY847069|pid:none) Toxoplasma gondii DEAD box RNA hel... 320 9e-86
(A7TS37) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 320 9e-86
CU928170_296(CU928170|pid:none) Kluyveromyces thermotolerans str... 319 1e-85
(Q6CXW0) RecName: Full=ATP-dependent RNA helicase DBP8; ... 318 3e-85
CP001574_573(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 317 6e-85
(A6ZT77) RecName: Full=ATP-dependent RNA helicase DBP8; ... 317 6e-85
(Q75EW9) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 312 2e-83
AM910986_17(AM910986|pid:none) Plasmodium knowlesi strain H chro... 306 1e-81
CP000883_25(CP000883|pid:none) Hemiselmis andersenii chromosome ... 304 4e-81
(A5DQF1) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 301 2e-80
BC062498_1(BC062498|pid:none) Xenopus tropicalis DEAD (Asp-Glu-A... 301 4e-80
FM992695_847(FM992695|pid:none) Candida dubliniensis CD36 chromo... 300 7e-80
EU957757_1(EU957757|pid:none) Zea mays clone 1614342 unknown mRNA. 299 1e-79
(Q5ACU6) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 299 2e-79
(A3LS22) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 297 5e-79
(A1D6X9) RecName: Full=ATP-dependent RNA helicase dbp8; ... 296 1e-78
CU633900_898(CU633900|pid:none) Podospora anserina genomic DNA c... 296 1e-78
(Q0CNX1) RecName: Full=ATP-dependent RNA helicase dbp8; ... 295 2e-78
(A7E436) RecName: Full=ATP-dependent RNA helicase dbp8; ... 294 4e-78
(A6SFV4) RecName: Full=ATP-dependent RNA helicase dbp8; ... 294 4e-78
(Q07886) RecName: Full=Probable ATP-dependent RNA helicase Dbp45... 294 4e-78
(Q4I662) RecName: Full=ATP-dependent RNA helicase DBP8; ... 294 5e-78
(A4R8G3) RecName: Full=ATP-dependent RNA helicase DBP8; ... 287 6e-76
(Q7RYZ7) RecName: Full=ATP-dependent RNA helicase dbp-8; ... 286 8e-76
L13612_1(L13612|pid:none) Drosophila melanogaster dead-box prote... 286 1e-75
AM494972_204(AM494972|pid:none) Leishmania braziliensis chromoso... 284 5e-75
CT005272_190(CT005272|pid:none) Leishmania major strain Friedlin... 281 3e-74
AM502254_438(AM502254|pid:none) Leishmania infantum chromosome 36. 280 1e-73
AP003833_21(AP003833|pid:none) Oryza sativa Japonica Group genom... 275 2e-72
(Q8SR63) RecName: Full=ATP-dependent rRNA helicase RRP3; ... 275 2e-72
AK139073_1(AK139073|pid:none) Mus musculus 7 days neonate cerebe... 271 5e-71
FN357295_12(FN357295|pid:none) Schistosoma mansoni genome sequen... 265 2e-69
CP000139_386(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 257 7e-67
CP000885_1978(CP000885|pid:none) Clostridium phytofermentans ISD... 256 2e-66
AK319072_1(AK319072|pid:none) Arabidopsis thaliana AT4G16630 mRN... 254 6e-66
(Q0INC5) RecName: Full=DEAD-box ATP-dependent RNA helicase 28; ... 254 6e-66
(Q9ZRZ8) RecName: Full=DEAD-box ATP-dependent RNA helicase 28; ... 254 6e-66
AP008955_5641(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 254 6e-66
AK316860_1(AK316860|pid:none) Arabidopsis thaliana AT4G16630 mRN... 254 6e-66
AM114193_133(AM114193|pid:none) Uncultured methanogenic archaeon... 252 2e-65
CP000557_198(CP000557|pid:none) Geobacillus thermodenitrificans ... 251 3e-65
BC091696_1(BC091696|pid:none) Rattus norvegicus DEAD (Asp-Glu-Al... 251 5e-65
CP001097_528(CP001097|pid:none) Chlorobium limicola DSM 245, com... 250 8e-65
AM920431_1322(AM920431|pid:none) Penicillium chrysogenum Wiscons... 249 1e-64
CP000922_194(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 248 2e-64
CP001103_1486(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 248 3e-64
AC147407_28(AC147407|pid:none) Medicago truncatula clone mth2-15... 247 5e-64
AJ010592_111(AJ010592|pid:none) Guillardia theta DNA for complet... 247 7e-64
CP000529_3173(CP000529|pid:none) Polaromonas naphthalenivorans C... 246 9e-64
CP000269_1297(CP000269|pid:none) Janthinobacterium sp. Marseille... 246 9e-64
CP000117_1948(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 246 1e-63
CP000656_2207(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 246 1e-63
AE017125_1768(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 246 2e-63
CP001052_3249(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 246 2e-63
EU559167_80(EU559167|pid:none) Candidatus Nitrospira defluvii Co... 246 2e-63
AM412317_641(AM412317|pid:none) Clostridium botulinum A str. ATC... 246 2e-63
CP000438_447(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA1... 245 2e-63
AE004091_429(AE004091|pid:none) Pseudomonas aeruginosa PAO1, com... 245 2e-63
(Q54TJ4) RecName: Full=Probable ATP-dependent RNA helicase ddx27... 245 3e-63
(Q73EU1) RecName: Full=DEAD-box ATP-dependent RNA helicase cshA;... 244 3e-63
CP001186_218(CP001186|pid:none) Bacillus cereus G9842, complete ... 244 3e-63
(Q63GX5) RecName: Full=DEAD-box ATP-dependent RNA helicase cshA;... 244 3e-63
CP001083_643(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 244 3e-63
(A0R8U6) RecName: Full=DEAD-box ATP-dependent RNA helicase cshA;... 244 3e-63
(A5DKW3) RecName: Full=ATP-dependent RNA helicase DRS1; ... 244 5e-63
AF2395(AF2395) ATP-dependent RNA helicase [imported] - Nostoc sp... 243 8e-63
CP000675_2428(CP000675|pid:none) Legionella pneumophila str. Cor... 243 8e-63
CR628336_2299(CR628336|pid:none) Legionella pneumophila str. Par... 243 8e-63
CP000939_1704(CP000939|pid:none) Clostridium botulinum B1 str. O... 243 1e-62
AE017354_2299(AE017354|pid:none) Legionella pneumophila subsp. p... 243 1e-62
CP001110_1956(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 243 1e-62
CP000316_1497(CP000316|pid:none) Polaromonas sp. JS666, complete... 243 1e-62
CP000851_3481(CP000851|pid:none) Shewanella pealeana ATCC 700345... 243 1e-62
CP001100_309(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 242 2e-62
CP000094_5278(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 242 2e-62
CP001108_1508(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 242 2e-62
(A5DY34) RecName: Full=ATP-dependent RNA helicase DRS1; ... 242 2e-62
AL935253_122(AL935253|pid:none) Lactobacillus plantarum strain W... 242 2e-62
(A1D1R8) RecName: Full=ATP-dependent RNA helicase drs1; ... 242 2e-62
CP001068_410(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 242 2e-62
AP007151_1052(AP007151|pid:none) Aspergillus oryzae RIB40 genomi... 241 3e-62
CU861906_545(CU861906|pid:none) Ralstonia solanacearum strain Mo... 241 3e-62
AM412317_1765(AM412317|pid:none) Clostridium botulinum A str. AT... 241 3e-62
CP000514_3786(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 241 3e-62
CP000096_957(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 241 3e-62
CP000492_1207(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 241 4e-62
CP000529_1232(CP000529|pid:none) Polaromonas naphthalenivorans C... 241 4e-62
CP000931_3556(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 241 4e-62
AM260479_529(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 241 5e-62
CP000821_3842(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 241 5e-62
CP000497_674(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 241 5e-62
(A3LSN3) RecName: Full=ATP-dependent RNA helicase DRS1; ... 241 5e-62
EU016567_30(EU016567|pid:none) Uncultured marine microorganism H... 241 5e-62
CP000352_456(CP000352|pid:none) Ralstonia metallidurans CH34, co... 241 5e-62
CP001157_346(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 240 7e-62
CP000480_4869(CP000480|pid:none) Mycobacterium smegmatis str. MC... 240 7e-62
AE017198_273(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 240 7e-62
CP000472_1191(CP000472|pid:none) Shewanella piezotolerans WP3, c... 240 9e-62
CP000774_2471(CP000774|pid:none) Parvibaculum lavamentivorans DS... 240 9e-62
(A7TJM9) RecName: Full=ATP-dependent RNA helicase DRS1; ... 240 9e-62
CU633749_483(CU633749|pid:none) Cupriavidus taiwanensis str. LMG... 240 9e-62
CP000612_2250(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 240 9e-62
CP000680_418(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 240 9e-62
AM055942_156(AM055942|pid:none) Toxoplasma gondii RH, genomic DN... 239 1e-61
CP001013_2637(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 239 1e-61
CP000285_809(CP000285|pid:none) Chromohalobacter salexigens DSM ... 239 1e-61
CP000939_651(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 239 1e-61
CP000384_3950(CP000384|pid:none) Mycobacterium sp. MCS, complete... 239 1e-61
CP000560_443(CP000560|pid:none) Bacillus amyloliquefaciens FZB42... 239 2e-61
(P0C2N8) RecName: Full=ATP-dependent RNA helicase drs-1; ... 239 2e-61
CP000681_2480(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 239 2e-61
CP000233_346(CP000233|pid:none) Lactobacillus salivarius UCC118,... 239 2e-61
CP000774_3234(CP000774|pid:none) Parvibaculum lavamentivorans DS... 239 2e-61
(A4QYM6) RecName: Full=ATP-dependent RNA helicase DRS1; ... 239 2e-61
CP000076_5708(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 238 2e-61
BA000032_390(BA000032|pid:none) Vibrio parahaemolyticus RIMD 221... 238 2e-61
AE006470_1024(AE006470|pid:none) Chlorobium tepidum TLS, complet... 238 2e-61
CP000675_322(CP000675|pid:none) Legionella pneumophila str. Corb... 238 2e-61
(Q65N62) RecName: Full=DEAD-box ATP-dependent RNA helicase cshA;... 238 2e-61
CP001392_1178(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 238 3e-61
CP000453_1600(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 238 3e-61
CR628337_305(CR628337|pid:none) Legionella pneumophila str. Lens... 238 3e-61
CP000109_780(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 238 3e-61
CP001279_1502(CP001279|pid:none) Nautilia profundicola AmH, comp... 238 3e-61
AE015928_1885(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 238 3e-61
(Q4I830) RecName: Full=ATP-dependent RNA helicase DRS1; ... 238 3e-61
CP000539_2511(CP000539|pid:none) Acidovorax sp. JS42, complete g... 238 3e-61
CP000758_2233(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 238 3e-61
CP000282_3026(CP000282|pid:none) Saccharophagus degradans 2-40, ... 238 3e-61
FM954973_316(FM954973|pid:none) Vibrio splendidus LGP32 chromoso... 238 3e-61
CP000926_4997(CP000926|pid:none) Pseudomonas putida GB-1, comple... 238 3e-61
(A1CNV8) RecName: Full=ATP-dependent RNA helicase drs1; ... 238 3e-61
CR954246_1880(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 238 4e-61
BA000016_862(BA000016|pid:none) Clostridium perfringens str. 13 ... 238 4e-61
CP000891_2922(CP000891|pid:none) Shewanella baltica OS195, compl... 238 4e-61
(P96614) RecName: Full=DEAD-box ATP-dependent RNA helicase cshA;... 237 6e-61
CP000708_862(CP000708|pid:none) Brucella ovis ATCC 25840 chromos... 237 6e-61
CP000140_1129(CP000140|pid:none) Parabacteroides distasonis ATCC... 237 6e-61
BA000028_609(BA000028|pid:none) Oceanobacillus iheyensis HTE831 ... 237 6e-61
CP000817_4123(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 237 6e-61
CP000413_256(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 237 6e-61
CP000089_1807(CP000089|pid:none) Dechloromonas aromatica RCB, co... 237 6e-61
CP000444_1225(CP000444|pid:none) Shewanella sp. MR-7, complete g... 237 6e-61
CP000471_1621(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 237 6e-61
CP001503_2886(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 237 7e-61
CP000444_2870(CP000444|pid:none) Shewanella sp. MR-7, complete g... 237 7e-61
CP000472_4012(CP000472|pid:none) Shewanella piezotolerans WP3, c... 237 7e-61
CP000753_2779(CP000753|pid:none) Shewanella baltica OS185, compl... 237 7e-61
CP000446_1159(CP000446|pid:none) Shewanella sp. MR-4, complete g... 237 7e-61
AE014291_910(AE014291|pid:none) Brucella suis 1330 chromosome I,... 237 7e-61
AE008917_1034(AE008917|pid:none) Brucella melitensis 16M chromos... 237 7e-61
(Q6FW42) RecName: Full=ATP-dependent RNA helicase DRS1; ... 236 9e-61
CP000563_2748(CP000563|pid:none) Shewanella baltica OS155, compl... 236 9e-61
CP000712_4796(CP000712|pid:none) Pseudomonas putida F1, complete... 236 9e-61
(Q0CZS8) RecName: Full=ATP-dependent RNA helicase has1; ... 236 1e-60
CT573326_4678(CT573326|pid:none) Pseudomonas entomophila str. L4... 236 1e-60
CP001252_1519(CP001252|pid:none) Shewanella baltica OS223, compl... 236 1e-60
CP000769_3459(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 236 1e-60
(Q1E2B2) RecName: Full=ATP-dependent RNA helicase DRS1; ... 236 1e-60
FM178380_565(FM178380|pid:none) Aliivibrio salmonicida LFI1238 c... 236 1e-60
CP001615_2352(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 236 1e-60
BX640434_6(BX640434|pid:none) Bordetella parapertussis strain 12... 236 2e-60
(Q09903) RecName: Full=ATP-dependent RNA helicase drs1; ... 236 2e-60
AE005674_747(AE005674|pid:none) Shigella flexneri 2a str. 301, c... 236 2e-60
CP000542_4658(CP000542|pid:none) Verminephrobacter eiseniae EF01... 236 2e-60
CP000116_1733(CP000116|pid:none) Thiobacillus denitrificans ATCC... 236 2e-60
AE016958_2521(AE016958|pid:none) Mycobacterium avium subsp. para... 236 2e-60
CP000312_821(CP000312|pid:none) Clostridium perfringens SM101, c... 236 2e-60
CP000961_3492(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 235 2e-60
CP000086_975(CP000086|pid:none) Burkholderia thailandensis E264 ... 235 2e-60
CP000479_1340(CP000479|pid:none) Mycobacterium avium 104, comple... 235 2e-60
CP000822_2273(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 235 3e-60
CP000813_426(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 235 3e-60
CU928158_2223(CU928158|pid:none) Escherichia fergusonii ATCC 354... 234 4e-60
CP000601_104(CP000601|pid:none) Ostreococcus lucimarinus CCE9901... 234 4e-60
CP000423_2419(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 234 4e-60
CP001229_1425(CP001229|pid:none) Sulfurihydrogenibium azorense A... 234 4e-60
CP000644_3354(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 234 4e-60
AM902716_925(AM902716|pid:none) Bordetella petrii strain DSM 128... 234 4e-60
CU928164_768(CU928164|pid:none) Escherichia coli IAI39 chromosom... 234 4e-60
CP001327_343(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 234 4e-60
CP000970_783(CP000970|pid:none) Escherichia coli SMS-3-5, comple... 234 5e-60
CU633900_249(CU633900|pid:none) Podospora anserina genomic DNA c... 234 5e-60
CP000680_3701(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 234 5e-60
CP000243_774(CP000243|pid:none) Escherichia coli UTI89, complete... 234 5e-60
CP000316_3461(CP000316|pid:none) Polaromonas sp. JS666, complete... 234 5e-60
AE008919_64(AE008919|pid:none) Uncultured marine proteobacterium... 234 5e-60
AE014075_853(AE014075|pid:none) Escherichia coli CFT073, complet... 234 5e-60
CP000302_3007(CP000302|pid:none) Shewanella denitrificans OS217,... 234 5e-60
AE005174_868(AE005174|pid:none) Escherichia coli O157:H7 EDL933,... 234 5e-60
CP000058_4158(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 234 5e-60
AE008692_1417(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 234 5e-60
CP000034_749(CP000034|pid:none) Shigella dysenteriae Sd197, comp... 234 5e-60
CP000563_3032(CP000563|pid:none) Shewanella baltica OS155, compl... 234 6e-60
BX571864_63(BX571864|pid:none) Photorhabdus luminescens subsp. l... 234 6e-60
CU458896_1386(CU458896|pid:none) Mycobacterium abscessus chromos... 234 6e-60
AM181176_5603(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 234 6e-60
CP001280_793(CP001280|pid:none) Methylocella silvestris BL2, com... 234 6e-60
CP000416_486(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 234 6e-60
CP001154_2532(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 234 6e-60
CP000949_484(CP000949|pid:none) Pseudomonas putida W619, complet... 234 6e-60
AM263198_859(AM263198|pid:none) Listeria welshimeri serovar 6b s... 234 6e-60
CR555306_2076(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 234 6e-60
AP009385_2578(AP009385|pid:none) Burkholderia multivorans ATCC 1... 234 6e-60
CP001099_1052(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 233 8e-60
(Q2UUN6) RecName: Full=ATP-dependent RNA helicase has1; ... 233 8e-60
CP000038_726(CP000038|pid:none) Shigella sonnei Ss046, complete ... 233 8e-60
CP000076_5324(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 233 8e-60
AE004091_3949(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 233 8e-60
(A2QAX7) RecName: Full=ATP-dependent RNA helicase drs1; ... 233 8e-60
AP007150_203(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 233 8e-60
CP000362_2914(CP000362|pid:none) Roseobacter denitrificans OCh 1... 233 1e-59
CP000489_1723(CP000489|pid:none) Paracoccus denitrificans PD1222... 233 1e-59
CP000644_1790(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 233 1e-59
CP000790_1743(CP000790|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 233 1e-59
AE017262_874(AE017262|pid:none) Listeria monocytogenes str. 4b F... 233 1e-59
CP000563_1233(CP000563|pid:none) Shewanella baltica OS155, compl... 233 1e-59
CP000614_2745(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 233 1e-59
AC1540(AC1540) ATP-dependent RNA helicase homolog lin0859 [impor... 233 1e-59
CP000462_718(CP000462|pid:none) Aeromonas hydrophila subsp. hydr... 233 1e-59
AE016853_4945(AE016853|pid:none) Pseudomonas syringae pv. tomato... 233 1e-59
CP000075_458(CP000075|pid:none) Pseudomonas syringae pv. syringa... 233 1e-59
CP001025_2569(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 233 1e-59
AY458648_57(AY458648|pid:none) Uncultured marine bacterium 581 c... 233 1e-59
CR522870_1413(CR522870|pid:none) Desulfotalea psychrophila LSv54... 233 1e-59
CP000440_2713(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 233 1e-59
CP000802_805(CP000802|pid:none) Escherichia coli HS, complete ge... 233 1e-59
CP000058_438(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 233 1e-59
AM747720_2408(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 232 2e-59
AP007255_1428(AP007255|pid:none) Magnetospirillum magneticum AMB... 232 2e-59
CP000411_1488(CP000411|pid:none) Oenococcus oeni PSU-1, complete... 232 2e-59
AE016877_218(AE016877|pid:none) Bacillus cereus ATCC 14579, comp... 232 2e-59
CU633749_2152(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 232 2e-59
CP000891_1323(CP000891|pid:none) Shewanella baltica OS195, compl... 232 2e-59
AE016853_4555(AE016853|pid:none) Pseudomonas syringae pv. tomato... 232 2e-59
CP000151_2809(CP000151|pid:none) Burkholderia sp. 383 chromosome... 232 2e-59
CP000390_1762(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 232 2e-59
CP001089_3483(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 232 2e-59
BX897699_634(BX897699|pid:none) Bartonella henselae strain Houst... 232 2e-59
AL954747_2041(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 232 2e-59
CP000509_4546(CP000509|pid:none) Nocardioides sp. JS614, complet... 232 2e-59
CP000753_1273(CP000753|pid:none) Shewanella baltica OS185, compl... 232 2e-59
CP000377_927(CP000377|pid:none) Silicibacter sp. TM1040, complet... 232 2e-59
BA000012_173(BA000012|pid:none) Mesorhizobium loti MAFF303099 DN... 231 3e-59
CP001056_3425(CP001056|pid:none) Clostridium botulinum B str. Ek... 231 3e-59
CP000744_1148(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 231 3e-59
CP000267_2131(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 231 3e-59
CP000124_904(CP000124|pid:none) Burkholderia pseudomallei 1710b ... 231 3e-59
CP000958_2678(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 231 3e-59
AM747720_934(AM747720|pid:none) Burkholderia cenocepacia J2315 c... 231 3e-59
CP000378_2044(CP000378|pid:none) Burkholderia cenocepacia AU 105... 231 3e-59
BX571965_705(BX571965|pid:none) Burkholderia pseudomallei strain... 231 3e-59
AE014299_3299(AE014299|pid:none) Shewanella oneidensis MR-1, com... 231 3e-59
CP000036_625(CP000036|pid:none) Shigella boydii Sb227, complete ... 231 3e-59
EF206694_1(EF206694|pid:none) Fenneropenaeus chinensis PL10A mRN... 231 3e-59
CP000009_88(CP000009|pid:none) Gluconobacter oxydans 621H, compl... 231 3e-59
AB017003_1(AB017003|pid:none) Dugesia japonica mRNA for DjVLGB, ... 231 3e-59
AM711867_1243(AM711867|pid:none) Clavibacter michiganensis subsp... 231 3e-59
(Q6BTL5) RecName: Full=ATP-dependent RNA helicase DRS1; ... 231 3e-59
CP000503_833(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 231 4e-59
CP000910_906(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 231 4e-59
AE005673_832(AE005673|pid:none) Caulobacter crescentus CB15, com... 231 4e-59
CP000937_1787(CP000937|pid:none) Francisella philomiragia subsp.... 231 4e-59
CP000821_1020(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 231 4e-59
CP000903_5122(CP000903|pid:none) Bacillus weihenstephanensis KBA... 231 4e-59
CP000868_957(CP000868|pid:none) Burkholderia multivorans ATCC 17... 231 4e-59
CP000462_2641(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 231 4e-59
AE014299_3677(AE014299|pid:none) Shewanella oneidensis MR-1, com... 231 4e-59
CU928166_128(CU928166|pid:none) Kluyveromyces thermotolerans str... 231 5e-59
CP000614_2376(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 231 5e-59
AD2863(AD2863) dead-box ATP-dependent RNA helicase rhlE [importe... 231 5e-59
CP001052_1212(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 231 5e-59
CP000094_4915(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 231 5e-59
CP000678_1498(CP000678|pid:none) Methanobrevibacter smithii ATCC... 231 5e-59
CP000698_1946(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 231 5e-59
BA000038_1159(BA000038|pid:none) Vibrio vulnificus YJ016 DNA, ch... 230 7e-59
CP000781_3174(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 230 7e-59
CP000777_2668(CP000777|pid:none) Leptospira biflexa serovar Pato... 230 7e-59
BT052691_1(BT052691|pid:none) Medicago truncatula clone MTYFD_FE... 230 7e-59
CP000449_1347(CP000449|pid:none) Maricaulis maris MCS10, complet... 230 7e-59
FM954972_1079(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 230 7e-59
AP008955_4361(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 230 7e-59
AL844505_304(AL844505|pid:none) Plasmodium falciparum 3D7 chromo... 230 7e-59
CP000089_3281(CP000089|pid:none) Dechloromonas aromatica RCB, co... 230 7e-59
CP000021_374(CP000021|pid:none) Vibrio fischeri ES114 chromosome... 230 9e-59
FM954973_753(FM954973|pid:none) Vibrio splendidus LGP32 chromoso... 230 9e-59
AM889285_3225(AM889285|pid:none) Gluconacetobacter diazotrophicu... 230 9e-59
CU234118_971(CU234118|pid:none) Bradyrhizobium sp. ORS278,comple... 230 9e-59
BA000035_1257(BA000035|pid:none) Corynebacterium efficiens YS-31... 230 9e-59
CP000803_1032(CP000803|pid:none) Francisella tularensis subsp. h... 230 9e-59
CP000512_1122(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 230 9e-59
FM178379_2189(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 229 1e-58
CP000544_905(CP000544|pid:none) Halorhodospira halophila SL1, co... 229 1e-58
DQ139795_1(DQ139795|pid:none) Chironomus tentans Ded1-like DEAD-... 229 1e-58
(Q6C7D2) RecName: Full=ATP-dependent RNA helicase HAS1; ... 229 1e-58
CU207211_3071(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 229 1e-58
FN392321_754(FN392321|pid:none) Pichia pastoris GS115 chromosome... 229 1e-58
(A2Q9T6) RecName: Full=ATP-dependent RNA helicase has1; ... 229 1e-58
AM933173_784(AM933173|pid:none) Salmonella enterica subsp. enter... 229 1e-58
CP000440_2346(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 229 1e-58
CP001087_2288(CP001087|pid:none) Desulfobacterium autotrophicum ... 229 1e-58
CP001280_938(CP001280|pid:none) Methylocella silvestris BL2, com... 229 2e-58
CP001503_2521(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 229 2e-58
CP000886_2620(CP000886|pid:none) Salmonella enterica subsp. ente... 229 2e-58
AE006468_793(AE006468|pid:none) Salmonella enterica subsp. enter... 229 2e-58
CP000009_190(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 229 2e-58
CP000469_803(CP000469|pid:none) Shewanella sp. ANA-3, complete g... 229 2e-58
CP000020_1810(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 229 2e-58
CP000655_600(CP000655|pid:none) Polynucleobacter necessarius sub... 229 2e-58
AE014613_1943(AE014613|pid:none) Salmonella enterica subsp. ente... 229 2e-58
CP000563_3406(CP000563|pid:none) Shewanella baltica OS155, compl... 229 2e-58
AM260522_1236(AM260522|pid:none) Helicobacter acinonychis str. S... 229 2e-58
CP000753_851(CP000753|pid:none) Shewanella baltica OS185, comple... 229 2e-58
CP001071_15(CP001071|pid:none) Akkermansia muciniphila ATCC BAA-... 229 2e-58
CP000090_896(CP000090|pid:none) Ralstonia eutropha JMP134 chromo... 229 2e-58
CP000884_2893(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 229 2e-58
CP001390_2718(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 229 2e-58
CP000450_1616(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 229 2e-58
CP000230_1910(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 229 2e-58
CP000116_1101(CP000116|pid:none) Thiobacillus denitrificans ATCC... 229 2e-58
AP008230_3754(AP008230|pid:none) Desulfitobacterium hafniense Y5... 229 2e-58
AE016825_2841(AE016825|pid:none) Chromobacterium violaceum ATCC ... 229 2e-58
AE017196_1113(AE017196|pid:none) Wolbachia endosymbiont of Droso... 229 2e-58
CP001016_106(CP001016|pid:none) Beijerinckia indica subsp. indic... 229 2e-58
AE017220_817(AE017220|pid:none) Salmonella enterica subsp. enter... 228 3e-58
CP000446_3118(CP000446|pid:none) Shewanella sp. MR-4, complete g... 228 3e-58
CP001013_616(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 228 3e-58
CP000388_584(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 228 3e-58
CP000546_2332(CP000546|pid:none) Burkholderia mallei NCTC 10229 ... 228 3e-58
AE008384_2556(AE008384|pid:none) Methanosarcina mazei strain Goe... 228 3e-58
(Q54S03) RecName: Full=Probable ATP-dependent RNA helicase ddx18... 228 3e-58
CP000316_2315(CP000316|pid:none) Polaromonas sp. JS666, complete... 228 3e-58
CP001132_1126(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 228 3e-58
AM942759_3393(AM942759|pid:none) Proteus mirabilis strain HI4320... 228 3e-58
CP000488_118(CP000488|pid:none) Candidatus Ruthia magnifica str.... 228 3e-58
CP001078_3210(CP001078|pid:none) Clostridium botulinum E3 str. A... 228 3e-58
CP001601_1025(CP001601|pid:none) Corynebacterium aurimucosum ATC... 228 3e-58
AE010300_3432(AE010300|pid:none) Leptospira interrogans serovar ... 228 3e-58
CP000412_279(CP000412|pid:none) Lactobacillus delbrueckii subsp.... 228 3e-58
CP001016_1747(CP001016|pid:none) Beijerinckia indica subsp. indi... 228 3e-58
CP000282_3192(CP000282|pid:none) Saccharophagus degradans 2-40, ... 228 4e-58
CP000097_442(CP000097|pid:none) Synechococcus sp. CC9902, comple... 228 4e-58
AE008692_1214(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 228 4e-58
CP000517_221(CP000517|pid:none) Lactobacillus helveticus DPC 457... 228 4e-58
AP009153_3744(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 228 4e-58
CP000851_917(CP000851|pid:none) Shewanella pealeana ATCC 700345,... 228 4e-58
(A1CIQ5) RecName: Full=ATP-dependent RNA helicase has1; ... 228 4e-58
AM260479_2644(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 227 6e-58
AM422018_155(AM422018|pid:none) Candidatus Phytoplasma australie... 227 6e-58
(Q5KMN6) RecName: Full=ATP-dependent RNA helicase HAS1; ... 227 6e-58
CP001336_1574(CP001336|pid:none) Desulfitobacterium hafniense DC... 227 6e-58
CP001133_187(CP001133|pid:none) Vibrio fischeri MJ11 chromosome ... 227 6e-58
CP000021_155(CP000021|pid:none) Vibrio fischeri ES114 chromosome... 227 6e-58
CP000378_1692(CP000378|pid:none) Burkholderia cenocepacia AU 105... 227 6e-58
BX897700_657(BX897700|pid:none) Bartonella quintana str. Toulous... 227 6e-58
(Q5ACK7) RecName: Full=ATP-dependent RNA helicase DRS1; ... 227 6e-58
CP000241_251(CP000241|pid:none) Helicobacter pylori HPAG1, compl... 227 6e-58
AC025726_24(AC025726|pid:none) Caenorhabditis elegans cosmid Y71... 227 6e-58
AB168247_1(AB168247|pid:none) Macaca fascicularis testis cDNA cl... 227 6e-58
AM286415_2746(AM286415|pid:none) Yersinia enterocolitica subsp. ... 227 8e-58
(A7F4L5) RecName: Full=ATP-dependent RNA helicase drs1; ... 227 8e-58
CP001072_242(CP001072|pid:none) Helicobacter pylori Shi470, comp... 227 8e-58
CP000851_3015(CP000851|pid:none) Shewanella pealeana ATCC 700345... 227 8e-58
AE017042_944(AE017042|pid:none) Yersinia pestis biovar Microtus ... 227 8e-58
CP000103_2635(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 227 8e-58
CP000252_1807(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 227 8e-58
AM494969_47(AM494969|pid:none) Leishmania braziliensis chromosom... 227 8e-58
BX936398_1214(BX936398|pid:none) Yersinia pseudotuberculosis IP3... 227 8e-58
AF426171_17(AF426171|pid:none) Yersinia pestis transposase (tnp)... 227 8e-58
CP000462_2340(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 227 8e-58
CP000485_4704(CP000485|pid:none) Bacillus thuringiensis str. Al ... 227 8e-58
CP000447_3044(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 227 8e-58
CP000783_2484(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 227 8e-58
AP009153_2770(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 227 8e-58
(Q4WQM4) RecName: Full=ATP-dependent RNA helicase has1; ... 227 8e-58
CP000113_2243(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 226 1e-57
CP001196_3362(CP001196|pid:none) Oligotropha carboxidovorans OM5... 226 1e-57
CR555306_2554(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 226 1e-57
(A6RUH2) RecName: Full=ATP-dependent RNA helicase drs1; ... 226 1e-57
AP006627_3931(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 226 1e-57
CP000821_4020(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 226 1e-57
AF026402_1(AF026402|pid:none) Homo sapiens U5 snRNP 100 kD prote... 226 1e-57
BC011927_1(BC011927|pid:none) Homo sapiens DEAD (Asp-Glu-Ala-Asp... 226 1e-57
EU718675_1(EU718675|pid:none) Homo sapiens DEAD box polypeptide ... 226 1e-57
CP001108_703(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 226 1e-57
CP000264_1200(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 226 1e-57
AF542976_3(AF542976|pid:none) Yersinia enterocolitica PNPase (pn... 226 1e-57
AK128428_1(AK128428|pid:none) Homo sapiens cDNA FLJ46571 fis, cl... 226 1e-57
BC147902_1(BC147902|pid:none) Bos taurus DEAD (Asp-Glu-Ala-Asp) ... 226 1e-57
CP000653_3567(CP000653|pid:none) Enterobacter sp. 638, complete ... 226 1e-57
CP000150_734(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 226 1e-57
(Q9BXF0) RecName: Full=Probable ATP-dependent RNA helicase DDX27... 226 1e-57
FM954973_775(FM954973|pid:none) Vibrio splendidus LGP32 chromoso... 226 1e-57
AK300135_1(AK300135|pid:none) Homo sapiens cDNA FLJ61659 complet... 226 1e-57
CP000020_1446(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 226 1e-57
BC169082_1(BC169082|pid:none) Rattus norvegicus DEAD (Asp-Glu-Al... 226 1e-57
AE016796_216(AE016796|pid:none) Vibrio vulnificus CMCP6 chromoso... 226 1e-57
CP000507_510(CP000507|pid:none) Shewanella amazonensis SB2B, com... 226 1e-57
CP000555_2082(CP000555|pid:none) Methylibium petroleiphilum PM1,... 226 2e-57
AE003853_202(AE003853|pid:none) Vibrio cholerae O1 biovar eltor ... 226 2e-57
CR378675_199(CR378675|pid:none) Photobacterium profundum SS9 chr... 226 2e-57
AK292921_1(AK292921|pid:none) Homo sapiens cDNA FLJ77678 complet... 226 2e-57
CP001600_447(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 226 2e-57
CP000749_973(CP000749|pid:none) Marinomonas sp. MWYL1, complete ... 226 2e-57
CP000447_3679(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 226 2e-57
CP001139_1842(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 226 2e-57
AM286690_734(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 226 2e-57
AE016828_581(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 226 2e-57
CP000854_4126(CP000854|pid:none) Mycobacterium marinum M, comple... 226 2e-57
CP000503_2227(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 226 2e-57
AJ719804_1(AJ719804|pid:none) Gallus gallus mRNA for hypothetica... 226 2e-57
CP000089_875(CP000089|pid:none) Dechloromonas aromatica RCB, com... 226 2e-57
CP000269_3469(CP000269|pid:none) Janthinobacterium sp. Marseille... 225 2e-57
CP000644_2098(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 225 2e-57
AE017355_5084(AE017355|pid:none) Bacillus thuringiensis serovar ... 225 2e-57
FN317788_1(FN317788|pid:none) Schistosoma japonicum isolate Anhu... 225 2e-57
CP000780_643(CP000780|pid:none) Candidatus Methanoregula boonei ... 225 2e-57
CP001275_1082(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 225 2e-57
CP000394_2435(CP000394|pid:none) Granulibacter bethesdensis CGDN... 225 2e-57
CP000885_1983(CP000885|pid:none) Clostridium phytofermentans ISD... 225 3e-57
AE010300_4047(AE010300|pid:none) Leptospira interrogans serovar ... 225 3e-57
CP000446_2159(CP000446|pid:none) Shewanella sp. MR-4, complete g... 225 3e-57
(Q5RC67) RecName: Full=Probable ATP-dependent RNA helicase DDX23... 225 3e-57
CP001010_1054(CP001010|pid:none) Polynucleobacter necessarius su... 225 3e-57
AE014299_3921(AE014299|pid:none) Shewanella oneidensis MR-1, com... 225 3e-57
CP001055_760(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 225 3e-57
CP000453_2053(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 225 3e-57
>(Q55BR9) RecName: Full=Probable ATP-dependent RNA helicase ddx49;
EC=3.6.1.-; AltName: Full=DEAD box protein 49;
Length = 508
Score = 760 bits (1963), Expect = 0.0
Identities = 389/390 (99%), Positives = 389/390 (99%)
Frame = +3
Query: 54 MSDKTFEELGLTTWLVANCKQLGFKAPSNIQANTIPEILKGRDIIASAKTGSGKTASFAI 233
MSDKTFEELGLTTWLVANCKQLGFKAPSNIQANTIPEILKGRDIIASAKTGSGKTASFAI
Sbjct: 1 MSDKTFEELGLTTWLVANCKQLGFKAPSNIQANTIPEILKGRDIIASAKTGSGKTASFAI 60
Query: 234 PILNQLSEDPYGVFAVILTPTRELAVQIGEQFNAIGAPMNVNCSVVIGGIDNVTQALILD 413
PILNQLSEDPYGVFAVILTPTRELAVQIGEQFNAIGAPMNVNCSVVIGGIDNVTQALILD
Sbjct: 61 PILNQLSEDPYGVFAVILTPTRELAVQIGEQFNAIGAPMNVNCSVVIGGIDNVTQALILD 120
Query: 414 KRPHIIVATPGRLASHLNNGLKIALKFCKFLVLDEADRLLGEDFELEIASILEHLPPPEK 593
KRPHIIVATPGRLASHLNNGLKIALKFCKFLVLDEADRLLGEDFELEIASILEHLPPPEK
Sbjct: 121 KRPHIIVATPGRLASHLNNGLKIALKFCKFLVLDEADRLLGEDFELEIASILEHLPPPEK 180
Query: 594 RQTLLFSATMTKNLTKLDSIALNKPFIFEDNSKYDTVDTLKQEYIYMPAPTKDCYLVYIL 773
RQTLLFSATMTKNLTKLDSIALNKPFIFEDNSKYDTVDTLKQEYIYMPAPTKDCYLVYIL
Sbjct: 181 RQTLLFSATMTKNLTKLDSIALNKPFIFEDNSKYDTVDTLKQEYIYMPAPTKDCYLVYIL 240
Query: 774 KKHEGSSAIVFVNNCYAVEAVKGMLNKLDIPSVSLHSFLDQKSRLAALKTFKSGKVKVLV 953
KKHEGSSAIVFVNNCYAVEAVKGMLNKLDIPSVSLHSFLDQKSRLAALKTFKSGKVKVLV
Sbjct: 241 KKHEGSSAIVFVNNCYAVEAVKGMLNKLDIPSVSLHSFLDQKSRLAALKTFKSGKVKVLV 300
Query: 954 ATDVASRGLDIPDVQIVINYKLSNSSKDYIHRVGRTARFGRSGRAISFITPXDVSLIKGI 1133
ATDVASRGLDIPDVQIVINYKLSNSSKDYIHRVGRTARFGRSGRAISFITP DVSLIKGI
Sbjct: 301 ATDVASRGLDIPDVQIVINYKLSNSSKDYIHRVGRTARFGRSGRAISFITPHDVSLIKGI 360
Query: 1134 EEIIKKQLELYKTDDDEVFRHLKEASTARK 1223
EEIIKKQLELYKTDDDEVFRHLKEASTARK
Sbjct: 361 EEIIKKQLELYKTDDDEVFRHLKEASTARK 390
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,744,186,777
Number of extensions: 32517034
Number of successful extensions: 102292
Number of sequences better than 10.0: 5755
Number of HSP's gapped: 91392
Number of HSP's successfully gapped: 6190
Length of query: 412
Length of database: 1,040,966,779
Length adjustment: 131
Effective length of query: 281
Effective length of database: 621,205,444
Effective search space: 174558729764
Effective search space used: 174558729764
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|