Contig-U05966-1 |
Contig ID |
Contig-U05966-1 |
Contig update |
2001. 8.30 |
Contig sequence |
|
Gap |
no gap |
Contig length |
1348 |
Chromosome number (1..6, M) |
4 |
Chromosome length |
5430582 |
Start point |
3462395 |
End point |
3461098 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
2 |
Number of EST |
4 |
Link to clone list |
U05966 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.10 |
Homology vs CSM-cDNA |
|
dna update |
2008.11. 6 |
Homology vs DNA |
Query= Contig-U05966-1 (Contig-U05966-1Q) /CSM_Contig/Contig-U05966-1Q.Seq.d (1348 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(AU268222) Dictyostelium discoideum vegetative cDNA clone:VS... 1168 0.0 1 (BJ429067) Dictyostelium discoideum cDNA clone:ddv2b11, 3' e... 874 0.0 4 (AU268221) Dictyostelium discoideum vegetative cDNA clone:VS... 450 0.0 5 (BJ410896) Dictyostelium discoideum cDNA clone:ddv2b11, 5' e... 54 9e-11 2 (CP000246) Clostridium perfringens ATCC 13124, complete genome. 46 6e-05 18 (AC116982) Dictyostelium discoideum chromosome 2 map 3622643... 32 3e-04 15 (AE009951) Fusobacterium nucleatum subsp. nucleatum ATCC 255... 38 0.001 23 (CR382398) Plasmodium falciparum chromosome 6, complete sequ... 38 0.005 17 (AC116960) Dictyostelium discoideum chromosome 2 map complem... 34 0.005 12 (CP000312) Clostridium perfringens SM101, complete genome. 42 0.006 19 (BA000021) Wigglesworthia glossinidia endosymbiont of Glossi... 36 0.010 17 (AP005746) Oryza sativa Japonica Group genomic DNA, chromoso... 44 0.021 6 (AC226511) Solanum lycopersicum chromosome 2 clone C02HBa017... 32 0.029 10 (AC114263) Dictyostelium discoideum chromosome 2 map 215673-... 38 0.033 11 (AC115598) Dictyostelium discoideum chromosome 2 map 581427-... 38 0.037 11 (CP000551) Prochlorococcus marinus str. AS9601, complete gen... 38 0.039 19 (AC217787) Solanum lycopersicum chromosome 9 clone C09HBa011... 40 0.054 7 (CP000485) Bacillus thuringiensis str. Al Hakam, complete ge... 36 0.058 21 (AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 38 0.077 17 (BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 34 0.12 21 (AL844509) Plasmodium falciparum chromosome 13. 38 0.12 18 (CP000743) Methanococcus aeolicus Nankai-3, complete genome. 34 0.13 24 (AE017308) Mycoplasma mobile 163K complete genome. 34 0.13 20 (AC006279) Plasmodium falciparum chromosome 12 clone 3D7, **... 36 0.15 12 (CU633829) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 42 0.16 4 (AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 34 0.18 15 (AM180355) Clostridium difficile 630 complete genome. 38 0.18 22 (CP000102) Methanosphaera stadtmanae DSM 3091, complete genome. 34 0.19 19 (AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 40 0.20 16 (BS000060) Pan troglodytes chromosome 22 clone:RP43-086L15, ... 36 0.21 7 (CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 34 0.22 20 (AC133078) Mus musculus BAC clone RP24-444O21 from chromosom... 50 0.22 1 (AC127593) Mus musculus BAC clone RP23-390G15 from chromosom... 50 0.22 1 (AG583328) Mus musculus molossinus DNA, clone:MSMg01-509L11.... 50 0.22 1 (CP000792) Campylobacter concisus 13826, complete genome. 50 0.22 1 (AC004688) Plasmodium falciparum chromosome 12 clone 3D7, **... 34 0.23 10 (CP000361) Arcobacter butzleri RM4018, complete genome. 36 0.23 21 (CP000111) Prochlorococcus marinus str. MIT 9312, complete g... 36 0.24 16 (BA000016) Clostridium perfringens str. 13 DNA, complete gen... 46 0.25 16 (BX323806) Zebrafish DNA sequence from clone DKEYP-123A9 in ... 36 0.36 8 (AP009180) Candidatus Carsonella ruddii PV DNA, complete gen... 34 0.37 11 (AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 32 0.42 17 (AC211087) Solanum lycopersicum chromosome 6 clone C06SLm013... 38 0.42 8 (EF568108) Glossina pallidipes salivary gland hypertrophy vi... 36 0.47 11 (AC091602) Homo sapiens BAC clone RP11-655M19 from 4, comple... 44 0.58 6 (CR626939) Zebrafish DNA sequence from clone DKEY-73E3 in li... 46 0.60 5 (CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 40 0.62 21 (AF250284) Amsacta moorei entomopoxvirus, complete genome. 30 0.63 13 (AF410153) Swinepox virus isolate 17077-99, complete genome. 40 0.68 10 (AE017243) Mycoplasma hyopneumoniae J, complete genome. 32 0.68 19 (AL929353) Plasmodium falciparum strain 3D7, chromosome 5, s... 34 0.84 14 (AC181956) Strongylocentrotus purpuratus clone R3-1004N13, W... 36 0.86 6 (CQ602804) Sequence 30562 from Patent WO0171042. 48 0.87 1 (AY113493) Drosophila melanogaster RE51076 full insert cDNA. 48 0.87 1 (AE014298) Drosophila melanogaster chromosome X, complete se... 48 0.87 1 (AC104515) Drosophila melanogaster, chromosome X, region 20B... 48 0.87 1 (AC013173) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 48 0.87 1 (AY068901) Schmidtea mediterranea clone H.23.2d unknown mRNA... 48 0.87 1 (EC249472) 375428 CK01 Drosophila melanogaster cDNA clone 14... 48 0.87 1 (DN808213) 76963347 Sea Urchin primary mesenchyme cell cDNA ... 48 0.87 1 (DN308464) PL05016B2A01 cDNA from sexually mature hermaphodi... 48 0.87 1 (DN301786) PL04023B1H02 cDNA from sexually mature hermaphodi... 48 0.87 1 (CK134109) RE51076.3prime RE Drosophila melanogaster normali... 48 0.87 1 (DX427605) BE1071_A09_F IASMA L1 HindIII BAC library Vitis v... 44 0.89 2 (AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 34 0.92 11 (CP000001) Bacillus cereus E33L, complete genome. 36 0.97 21 (EK101219) 1092963018156 Global-Ocean-Sampling_GS-31-01-01-1... 36 1.0 2 (AF238235) Entamoeba histolytica diaphanous protein (dia) mR... 38 1.0 2 (EI837596) POTDX10TR Solanum tuberosum RHPOTKEY BAC ends Sol... 38 1.0 2 (AF238234) Entamoeba histolytica diaphanous protein (dia) ge... 38 1.1 2 (AC141815) Apis mellifera clone CH224-61C4, WORKING DRAFT SE... 44 1.1 10 (BZ432849) BONKR71TF BO_1.6_2_KB_tot Brassica oleracea genom... 34 1.1 3 (AC087710) Homo sapiens chromosome 8, clone RP11-11A18, comp... 36 1.2 8 (CP001056) Clostridium botulinum B str. Eklund 17B, complete... 36 1.2 21 (AE014818) Plasmodium falciparum 3D7 chromosome 14 section 3... 32 1.3 13 (CP000721) Clostridium beijerinckii NCIMB 8052, complete gen... 36 1.3 20 (X95276) Plasmodium falciparum complete gene map of plastid-... 34 1.3 5 (AE014846) Plasmodium falciparum 3D7 chromosome 12, section ... 36 1.4 12 (BX957315) Zebrafish DNA sequence from clone CH211-254E15 in... 42 1.4 10 (AC169387) Macaca mulatta clone CH250-7N4, WORKING DRAFT SEQ... 38 1.5 8 (AL161531) Arabidopsis thaliana DNA chromosome 4, contig fra... 34 1.5 9 (CU469464) Candidatus Phytoplasma mali strain AT complete ch... 32 1.5 16 (DD010736) Diagnosis of known genetic Parameters within the ... 40 1.5 14 (AL034557) Plasmodium falciparum MAL4P1. 34 1.6 11 (BK006340) TPA_exp: Drosophila virilis mitochondrion, comple... 38 1.6 5 (CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 36 1.6 16 (AE001424) Plasmodium falciparum 3D7 chromosome 2 section 61... 34 1.6 4 (BX005070) Zebrafish DNA sequence from clone DKEY-13B19 in l... 34 1.7 2 (CU076047) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 1.7 2 (CU372900) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 1.7 2 (AL929356) Plasmodium falciparum strain 3D7, chromosome 9; s... 32 1.8 14 (AC209587) Solanum lycopersicum DNA sequence from clone LE_H... 34 1.8 2 (AC194348) Gossypium hirsutum chromosome UNKNOWN clone ZMMBB... 36 1.8 2 (AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 32 2.1 13 (AE016821) Ashbya gossypii (= Eremothecium gossypii) ATCC 10... 34 2.2 5 (CL864163) TM1-GSS000256r BAC and BIBAC libraries from Uplan... 36 2.3 2 (CL244527) ZMMBBb0391O03.f ZMMBBb Zea mays subsp. mays genom... 36 2.4 2 (EK242633) 1095460239671 Global-Ocean-Sampling_GS-31-01-01-1... 36 2.4 2 (AC225662) Nomascus leucogenys leucogenys clone CH271-163B6,... 38 2.5 6 (AE014821) Plasmodium falciparum 3D7 chromosome 14 section 6... 34 2.5 14
>(AU268222) Dictyostelium discoideum vegetative cDNA clone:VSI145, 3' end single read. Length = 590
Score = 1168 bits (589), Expect = 0.0 Identities = 589/589 (100%) Strand = Plus / Plus
Query: 760 agaaatttttgcaccaaaattcaaatcagttgaagtttgttgcattttatcaccttcaaa 819 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1 agaaatttttgcaccaaaattcaaatcagttgaagtttgttgcattttatcaccttcaaa 60
Query: 820 tgttacaattggtggtgataaagttgaattggagcaaatcgttgagcaatgtaaacttga 879 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 61 tgttacaattggtggtgataaagttgaattggagcaaatcgttgagcaatgtaaacttga 120
Query: 880 atcaatcaacacaaaagttttatcaattccaactgcatttcatcattcttgtcaagattg 939 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 121 atcaatcaacacaaaagttttatcaattccaactgcatttcatcattcttgtcaagattg 180
Query: 940 tctctatgatgatatgatgaaattacaatttaaatcatatccaccaaaagcagatattca 999 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 181 tctctatgatgatatgatgaaattacaatttaaatcatatccaccaaaagcagatattca 240
Query: 1000 ccatatttcaacagtaaagggtactttatttaataaagatttttacattaacaaagaata 1059 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 241 ccatatttcaacagtaaagggtactttatttaataaagatttttacattaacaaagaata 300
Query: 1060 tgtatttgaaaatttacgtgatcaagcaagattagcattgggtataaaaaatgtattcca 1119 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 301 tgtatttgaaaatttacgtgatcaagcaagattagcattgggtataaaaaatgtattcca 360
Query: 1120 acatattgaaaactctaatcttggtagaaatgtttgtttcattgaaattggaccaagaca 1179 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 361 acatattgaaaactctaatcttggtagaaatgtttgtttcattgaaattggaccaagaca 420
Query: 1180 atcattattaaattatataattaaacaaactccacctttaaataaatctgaaaatggcaa 1239 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 421 atcattattaaattatataattaaacaaactccacctttaaataaatctgaaaatggcaa 480
Query: 1240 taattattttaaatctgtaaaaacctttgcttcattaacaagagataaaggtaatgaagg 1299 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 481 taattattttaaatctgtaaaaacctttgcttcattaacaagagataaaggtaatgaagg 540
Query: 1300 tattcatgaaactttaattcaatgttttaaacaaggttataaaaattta 1348 ||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 541 tattcatgaaactttaattcaatgttttaaacaaggttataaaaattta 589
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,795,173,634 Number of extensions: 115593006 Number of successful extensions: 9991341 Number of sequences better than 10.0: 223 Length of query: 1348 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1324 Effective length of database: 97,308,875,965 Effective search space: 128836951777660 Effective search space used: 128836951777660 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 6.20 |
Homology vs Protein |
Query= Contig-U05966-1 (Contig-U05966-1Q) /CSM_Contig/Contig-U05966-1Q.Seq.d (1348 letters)
Database: nrp_A 3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q54ED6) RecName: Full=Probable polyketide synthase 41; ... 131 6e-51 AC116982_23(AC116982|pid:none) Dictyostelium discoideum chromoso... 118 9e-50 (Q54QD1) RecName: Full=Probable polyketide synthase 23; ... 123 2e-48 (Q54KU5) RecName: Full=Probable polyketide synthase 24; ... 120 5e-48 AC116982_20(AC116982|pid:none) Dictyostelium discoideum chromoso... 118 2e-47 (Q54KU3) RecName: Full=Probable polyketide synthase 25; ... 119 2e-47 (Q54TW0) RecName: Full=Probable polyketide synthase 18; ... 115 1e-46 AC116963_16(AC116963|pid:none) Dictyostelium discoideum chromoso... 111 3e-46 (Q55DM7) RecName: Full=Probable polyketide synthase 2; ... 108 5e-45 AC117176_58(AC117176|pid:none) Dictyostelium discoideum chromoso... 113 1e-43 (Q54B49) RecName: Full=Probable polyketide synthase 45; ... 111 3e-43 AC117075_22(AC117075|pid:none) Dictyostelium discoideum chromoso... 109 1e-41 AC116982_72(AC116982|pid:none) Dictyostelium discoideum chromoso... 112 5e-39 (Q869W9) RecName: Full=Probable polyketide synthase 16; ... 91 6e-31 (Q869X2) RecName: Full=Probable polyketide synthase 17; ... 87 9e-30 (Q54FC8) RecName: Full=Probable polyketide synthase 39; ... 112 3e-23 (Q54FQ3) RecName: Full=Probable polyketide synthase 29; ... 110 2e-22 (Q54FN7) RecName: Full=Probable polyketide synthase 33; ... 109 3e-22 (Q54FD2) RecName: Full=Probable polyketide synthase 38; ... 107 7e-22 CP001040_62(CP001040|pid:none) Nostoc punctiforme PCC 73102 plas... 75 4e-20 AF188287_4(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 67 5e-20 AL935186_8(AL935186|pid:none) Zebrafish DNA sequence from clone ... 71 5e-20 AF188287_6(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 67 5e-20 BX005238_11(BX005238|pid:none) Zebrafish DNA sequence from clone... 71 8e-20 AJ639921_1(AJ639921|pid:none) Uncultured bacterium partial pks4 ... 70 7e-19 AJ557546_12(AJ557546|pid:none) Melittangium lichenicola melithia... 70 1e-18 AH2140(AH2140) polyketide synthase [imported] - Nostoc sp. (stra... 61 2e-18 CP000875_2400(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 69 2e-18 AP009552_2780(AP009552|pid:none) Microcystis aeruginosa NIES-843... 66 7e-18 AJ557546_14(AJ557546|pid:none) Melittangium lichenicola melithia... 67 9e-18 CU458896_2190(CU458896|pid:none) Mycobacterium abscessus chromos... 68 3e-17 AF469045_1(AF469045|pid:none) Hypocrea virens nonribosomal pepti... 69 3e-17 AY217789_1(AY217789|pid:none) Phoma sp. C2932 type I polyketide ... 80 3e-17 AC116982_28(AC116982|pid:none) Dictyostelium discoideum chromoso... 92 4e-17 CP001291_2672(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 64 1e-16 AP007171_14(AP007171|pid:none) Aspergillus oryzae RIB40 genomic ... 67 2e-16 AL939129_116(AL939129|pid:none) Streptomyces coelicolor A3(2) co... 72 2e-16 AB2012(AB2012) hypothetical protein all1648 [imported] - Nostoc ... 65 2e-16 AJ421825_16(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 70 2e-16 AP009552_2781(AP009552|pid:none) Microcystis aeruginosa NIES-843... 67 3e-16 CP000117_3964(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 66 4e-16 CP001037_2984(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 67 4e-16 AF395828_1(AF395828|pid:none) Aphanizomenon ovalisporum aoa gene... 59 5e-16 CP001287_2900(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 68 1e-15 AJ441056_4(AJ441056|pid:none) Planktothrix agardhii microcystin ... 68 2e-15 AM946600_12(AM946600|pid:none) Chondromyces crocatus ajudazol bi... 64 2e-15 CP000117_4716(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 65 5e-15 FM173265_16(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 63 6e-15 AB449340_13(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 63 6e-15 CP001001_935(CP001001|pid:none) Methylobacterium radiotolerans J... 66 6e-15 CP000113_4181(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 65 6e-15 AM270193_47(AM270193|pid:none) Aspergillus niger contig An09c004... 63 1e-14 AY974560_4(AY974560|pid:none) Lyngbya majuscula hectochlorin bio... 55 1e-14 AY495615_1(AY495615|pid:none) Botryotinia fuckeliana polyketide ... 58 1e-14 BA000045_2829(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 60 1e-14 AF183408_8(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 71 2e-14 EU603720_5(EU603720|pid:none) Planktothrix rubescens genomic seq... 64 2e-14 EF125796_1(EF125796|pid:none) Ophiostoma piceae polyketide synth... 55 2e-14 FJ477836_8(FJ477836|pid:none) Oscillatoria sp. PCC 6506 anatoxin... 60 2e-14 AY495593_1(AY495593|pid:none) Gibberella moniliformis polyketide... 54 2e-14 CP000112_1605(CP000112|pid:none) Desulfovibrio desulfuricans G20... 61 3e-14 AJ421825_14(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 66 3e-14 AP009552_3857(AP009552|pid:none) Microcystis aeruginosa NIES-843... 72 4e-14 AY899214_2(AY899214|pid:none) Streptomyces aizunensis strain NRR... 61 5e-14 CP001037_2726(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 59 5e-14 AJ421825_17(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 56 7e-14 CP001016_1096(CP001016|pid:none) Beijerinckia indica subsp. indi... 59 9e-14 CP000113_4409(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 76 1e-13 AB449340_17(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 63 1e-13 AM420293_2531(AM420293|pid:none) Saccharopolyspora erythraea NRR... 57 1e-13 CP001037_3033(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 59 1e-13 AM179409_3(AM179409|pid:none) Chondromyces crocatus chondramide ... 71 1e-13 BX571865_129(BX571865|pid:none) Photorhabdus luminescens subsp. ... 54 1e-13 AM920436_393(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 63 1e-13 AM920436_484(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 62 1e-13 AY495620_1(AY495620|pid:none) Botryotinia fuckeliana polyketide ... 54 1e-13 AP009493_814(AP009493|pid:none) Streptomyces griseus subsp. gris... 57 2e-13 AY553235_2(AY553235|pid:none) Leptosphaeria maculans HDX1 (HDX1)... 57 3e-13 FM173265_22(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 62 3e-13 AF357202_5(AF357202|pid:none) Streptomyces nodosus amphotericin ... 60 4e-13 CP000282_3715(CP000282|pid:none) Saccharophagus degradans 2-40, ... 59 4e-13 CP000875_1864(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 68 5e-13 AY495652_1(AY495652|pid:none) Cochliobolus heterostrophus polyke... 53 7e-13 EU520418_8(EU520418|pid:none) Hypomyces subiculosus strain DSM11... 58 7e-13 EU520417_8(EU520417|pid:none) Hypomyces subiculosus strain DSM11... 58 7e-13 AY150178_1(AY150178|pid:none) Exophiala lecanii-corni polyketide... 60 7e-13 CP000480_6552(CP000480|pid:none) Mycobacterium smegmatis str. MC... 60 7e-13 CP001287_2899(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 78 8e-13 AP007167_158(AP007167|pid:none) Aspergillus oryzae RIB40 genomic... 57 9e-13 CP001349_1882(CP001349|pid:none) Methylobacterium nodulans ORS 2... 59 9e-13 AM946600_9(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 55 9e-13 AF319998_6(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 77 1e-12 CP000908_1917(CP000908|pid:none) Methylobacterium extorquens PA1... 60 1e-12 CP001037_1207(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 50 1e-12 CP001037_2819(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 66 1e-12 AB089954_11(AB089954|pid:none) Micromonospora griseorubida gene ... 66 1e-12 BX649209_40(BX649209|pid:none) Mycobacterium ulcerans plasmid pM... 63 1e-12 EU271968_43(EU271968|pid:none) Mycobacterium liflandii 128FXT pl... 63 1e-12 BX649209_39(BX649209|pid:none) Mycobacterium ulcerans plasmid pM... 63 2e-12 DQ149987_8(DQ149987|pid:none) Streptomyces neyagawaensis concana... 50 2e-12 CP000113_4188(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 54 2e-12 AY495642_1(AY495642|pid:none) Mycosphaerella zeae-maydis polyket... 53 2e-12 AY495613_1(AY495613|pid:none) Botryotinia fuckeliana polyketide ... 54 2e-12 FJ872525_4(FJ872525|pid:none) Streptomyces sp. MP39-85 putative ... 60 3e-12 AM946600_8(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 60 3e-12 DQ149987_4(DQ149987|pid:none) Streptomyces neyagawaensis concana... 66 3e-12 AY495645_1(AY495645|pid:none) Cochliobolus heterostrophus polyke... 48 3e-12 U68040_1(U68040|pid:none) Cochliobolus heterostrophus polyketide... 54 3e-12 BX294154_97(BX294154|pid:none) Rhodopirellula baltica SH 1 compl... 59 3e-12 CP001029_1805(CP001029|pid:none) Methylobacterium populi BJ001, ... 59 3e-12 DQ897667_18(DQ897667|pid:none) Polyangium cellulosum strain So c... 60 3e-12 CP000934_3129(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 76 3e-12 AB241068_3(AB241068|pid:none) Streptomyces halstedii halstoctaco... 54 3e-12 AM270024_5(AM270024|pid:none) Aspergillus niger contig An02c0290... 50 3e-12 AM270278_16(AM270278|pid:none) Aspergillus niger contig An12c022... 56 3e-12 AB241068_7(AB241068|pid:none) Streptomyces halstedii halstoctaco... 53 3e-12 EU569687_1(EU569687|pid:none) Pseudoalteromonas sp. NJ632 polyke... 60 4e-12 AB158460_2(AB158460|pid:none) Streptomyces halstedii hlsA, hlsB,... 52 6e-12 AB241068_6(AB241068|pid:none) Streptomyces halstedii halstoctaco... 53 6e-12 AX089458_1(AX089458|pid:none) Sequence 43 from Patent WO0116303.... 59 6e-12 AE001437_3300(AE001437|pid:none) Clostridium acetobutylicum ATCC... 49 6e-12 EU047579_1(EU047579|pid:none) Dothiorella aegiceri putative poly... 57 6e-12 EU151883_1(EU151883|pid:none) Nostoc sp. IO-102-I polyketide syn... 75 7e-12 BX294144_103(BX294144|pid:none) Rhodopirellula baltica SH 1 comp... 57 7e-12 DQ630728_2(DQ630728|pid:none) Streptomyces albus strain CCM4719 ... 50 7e-12 CU640366_51(CU640366|pid:none) Podospora anserina genomic DNA ch... 52 7e-12 DQ174320_1(DQ174320|pid:none) Streptomyces rimosus rimocidin syn... 48 8e-12 AM270302_11(AM270302|pid:none) Aspergillus niger contig An13c008... 59 1e-11 AJ421825_15(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 62 1e-11 AY505295_1(AY505295|pid:none) Mycobacterium ulcerans clone 112 m... 50 1e-11 AM920427_1153(AM920427|pid:none) Penicillium chrysogenum Wiscons... 59 1e-11 CP000117_4082(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 60 1e-11 CP001037_3040(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 56 1e-11 AF079138_3(AF079138|pid:none) Streptomyces venezuelae methymycin... 55 2e-11 AF155773_7(AF155773|pid:none) Gibberella moniliformis fumonisin ... 48 2e-11 BA000045_1954(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 65 2e-11 AF015823_1(AF015823|pid:none) Streptomyces venezuelae venA gene,... 54 2e-11 AY495661_1(AY495661|pid:none) Cochliobolus heterostrophus polyke... 57 2e-11 FJ872523_5(FJ872523|pid:none) Streptomyces sp. DSM 21069 putativ... 62 3e-11 EU151882_1(EU151882|pid:none) Nostoc sp. 152 polyketide synthase... 72 3e-11 EU151880_1(EU151880|pid:none) Anabaena sp. 18B6 polyketide synth... 72 3e-11 AY007564_20(AY007564|pid:none) Saccharopolyspora spinosa probabl... 55 3e-11 (Q12053) RecName: Full=Aflatoxin biosynthesis polyketide synthas... 53 4e-11 CP000628_1378(CP000628|pid:none) Agrobacterium radiobacter K84 c... 47 4e-11 AB097904_5(AB097904|pid:none) Streptomyces carzinostaticus DNA, ... 72 5e-11 AY373435_7(AY373435|pid:none) Streptomyces nanchangensis strain ... 58 5e-11 DQ897667_14(DQ897667|pid:none) Polyangium cellulosum strain So c... 65 5e-11 AF188287_5(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 64 5e-11 AY310323_20(AY310323|pid:none) Streptomyces sp. FR-008 heptaene ... 57 6e-11 AF516145_6(AF516145|pid:none) Lyngbya majuscula barbamide biosyn... 72 6e-11 AB032549_1(AB032549|pid:none) Microcystis aeruginosa mcyD, mcyE,... 72 6e-11 AM238664_270(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 56 6e-11 AF319998_9(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 60 6e-11 AJ421825_10(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 52 6e-11 CP000813_629(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 55 6e-11 AF357202_4(AF357202|pid:none) Streptomyces nodosus amphotericin ... 55 7e-11 AB435553_3(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 55 8e-11 AF357202_16(AF357202|pid:none) Streptomyces nodosus amphotericin... 48 8e-11 (Q03133) RecName: Full=Erythronolide synthase, modules 5 and 6; ... 51 8e-11 AY495665_1(AY495665|pid:none) Cochliobolus heterostrophus polyke... 59 8e-11 AY495654_1(AY495654|pid:none) Cochliobolus heterostrophus polyke... 52 8e-11 AF217189_8(AF217189|pid:none) Sorangium cellulosum putative tran... 50 8e-11 AY495601_1(AY495601|pid:none) Gibberella moniliformis polyketide... 48 8e-11 AY466441_31(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 53 1e-10 AM420293_2559(AM420293|pid:none) Saccharopolyspora erythraea NRR... 54 1e-10 AF188287_2(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 69 1e-10 AP007151_688(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 55 1e-10 AB076803_2(AB076803|pid:none) Aspergillus oryzae aflT, pksL1, no... 51 1e-10 AB196490_2(AB196490|pid:none) Aspergillus oryzae DNA, aflatoxin ... 51 1e-10 EU151879_1(EU151879|pid:none) Hapalosiphon hibernicus BZ-3-1 pol... 71 1e-10 AY652953_7(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 71 1e-10 AJ132222_1(AJ132222|pid:none) Streptomyces natalensis pimS1 gene... 58 1e-10 DQ149987_5(DQ149987|pid:none) Streptomyces neyagawaensis concana... 58 1e-10 AF220951_2(AF220951|pid:none) Streptomyces antibioticus 8,8a-deo... 47 1e-10 CU633870_146(CU633870|pid:none) Podospora anserina genomic DNA c... 57 1e-10 AY649543_1(AY649543|pid:none) Cercospora nicotianae polyketide s... 50 1e-10 AF405554_3(AF405554|pid:none) Cryptosporidium parvum hypothetica... 63 2e-10 AY179507_10(AY179507|pid:none) Streptomyces hygroscopicus strain... 53 2e-10 DQ249341_3(DQ249341|pid:none) Streptomyces hygroscopicus subsp. ... 53 2e-10 U78289_3(U78289|pid:none) Streptomyces fradiae tylactone synthas... 53 2e-10 AE016958_2230(AE016958|pid:none) Mycobacterium avium subsp. para... 54 2e-10 M63677_2(M63677|pid:none) S.erythraea second and third ORF's of ... 51 2e-10 AP009493_6373(AP009493|pid:none) Streptomyces griseus subsp. gri... 47 2e-10 AM270194_18(AM270194|pid:none) Aspergillus niger contig An09c005... 60 2e-10 AY899214_9(AY899214|pid:none) Streptomyces aizunensis strain NRR... 57 2e-10 U24241_7(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 62 2e-10 AB070940_12(AB070940|pid:none) Streptomyces avermitilis oligomyc... 51 2e-10 AY495646_1(AY495646|pid:none) Cochliobolus heterostrophus polyke... 49 2e-10 EU443633_23(EU443633|pid:none) Micromonospora chalcea tetrocarci... 57 3e-10 AB070940_8(AB070940|pid:none) Streptomyces avermitilis oligomyci... 52 3e-10 AB032367_5(AB032367|pid:none) Streptomyces avermitilis polyketid... 47 3e-10 AB070949_7(AB070949|pid:none) Streptomyces avermitilis polyene m... 52 3e-10 EU520418_3(EU520418|pid:none) Hypomyces subiculosus strain DSM11... 53 3e-10 AY834753_10(AY834753|pid:none) Cystobacter fuscus cystothiazole ... 69 3e-10 DQ272520_6(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 59 4e-10 AM270061_16(AM270061|pid:none) Aspergillus niger contig An03c020... 45 4e-10 CP000738_196(CP000738|pid:none) Sinorhizobium medicae WSM419, co... 49 4e-10 AB070940_14(AB070940|pid:none) Streptomyces avermitilis oligomyc... 50 4e-10 AY652953_1(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 69 4e-10 AP009493_6180(AP009493|pid:none) Streptomyces griseus subsp. gri... 47 5e-10 AM920436_399(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 62 5e-10 AM946600_2(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 46 5e-10 AY510452_4(AY510452|pid:none) Aspergillus flavus isolate BN008 a... 49 5e-10 AM778955_67(AM778955|pid:none) Microcystis aeruginosa PCC 7806 g... 69 5e-10 S18954(S18954) fix23-2 protein - Rhizobium meliloti &X64131_2(X... 48 5e-10 AY505299_1(AY505299|pid:none) Mycobacterium ulcerans clone 122 m... 44 5e-10 AB193609_7(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetron... 57 6e-10 AF521085_12(AF521085|pid:none) Streptomyces nanchangensis NS3226... 55 6e-10 AY623658_22(AY623658|pid:none) Aeromicrobium erythreum putative ... 49 6e-10 AY971512_1(AY971512|pid:none) Xylaria sp. BCC 1067 polyketide sy... 54 6e-10 AP007169_168(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 46 6e-10 CP001389_205(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 49 6e-10 AY522504_17(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 68 7e-10 AM420293_4055(AM420293|pid:none) Saccharopolyspora erythraea NRR... 53 8e-10 AM902716_2323(AM902716|pid:none) Bordetella petrii strain DSM 12... 51 8e-10 EU301739_24(EU301739|pid:none) Actinomadura kijaniata fructokina... 57 8e-10 U24241_8(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 58 1e-09 AF040570_25(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 59 1e-09 EU449979_2(EU449979|pid:none) Fusarium oxysporum strain FRC O-18... 44 1e-09 AY495606_1(AY495606|pid:none) Botryotinia fuckeliana polyketide ... 51 1e-09 AF016585_6(AF016585|pid:none) Streptomyces caelestis cytochrome ... 60 1e-09 DQ116941_32(DQ116941|pid:none) Streptomyces antibioticus acetylt... 59 1e-09 AP007166_610(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 54 1e-09 AM746336_30(AM746336|pid:none) Streptomyces collinus kirromycin ... 57 1e-09 CP000850_3025(CP000850|pid:none) Salinispora arenicola CNS-205, ... 67 1e-09 CP000511_990(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1,... 50 1e-09 AF016585_4(AF016585|pid:none) Streptomyces caelestis cytochrome ... 52 1e-09 AF263912_14(AF263912|pid:none) Streptomyces noursei ATCC 11455 n... 45 1e-09 AF521085_8(AF521085|pid:none) Streptomyces nanchangensis NS3226 ... 55 1e-09 AY834753_9(AY834753|pid:none) Cystobacter fuscus cystothiazole A... 67 1e-09 CP001037_3038(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 67 1e-09 AC2012(AC2012) hypothetical protein all1649 [imported] - Nostoc ... 67 1e-09 CP000820_3406(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 49 2e-09 AF453501_14(AF453501|pid:none) Actinosynnema pretiosum subsp. au... 53 2e-09 AP007164_716(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 51 2e-09 AM269971_60(AM269971|pid:none) Aspergillus niger contig An01c024... 47 2e-09 AM270233_15(AM270233|pid:none) Aspergillus niger contig An11c016... 44 2e-09 AB072497_1(AB072497|pid:none) Aspergillus terreus at5 mRNA for p... 54 2e-09 T28678(T28678) polyketide synthase - Streptomyces ambofaciens (f... 53 2e-09 AJ698723_1(AJ698723|pid:none) Stigmatella aurantiaca myxochromid... 67 2e-09 AB376425_1(AB376425|pid:none) Cystobacter fuscus gene for polyke... 67 2e-09 FJ393328_1(FJ393328|pid:none) Microcystis sp. CYN10 microcystin ... 67 2e-09 AM778952_15(AM778952|pid:none) Microcystis aeruginosa PCC 7806 g... 67 2e-09 AF183408_7(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 67 2e-09 AM850130_10(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 67 2e-09 AM238664_478(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 54 2e-09 AL939127_18(AL939127|pid:none) Streptomyces coelicolor A3(2) com... 47 2e-09 AY623658_24(AY623658|pid:none) Aeromicrobium erythreum putative ... 47 2e-09 CU458896_177(CU458896|pid:none) Mycobacterium abscessus chromoso... 50 2e-09 FJ393327_1(FJ393327|pid:none) Microcystis sp. CYN06 microcystin ... 66 2e-09 AJ557546_13(AJ557546|pid:none) Melittangium lichenicola melithia... 66 2e-09 AB435553_2(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 54 3e-09 AY899214_10(AY899214|pid:none) Streptomyces aizunensis strain NR... 55 3e-09 AM889285_2396(AM889285|pid:none) Gluconacetobacter diazotrophicu... 58 3e-09 EF451568_1(EF451568|pid:none) Micromonospora sp. 1G62 type I ket... 61 3e-09 AY652953_13(AY652953|pid:none) Lyngbya majuscula strain 19L cura... 66 3e-09 FJ477836_6(FJ477836|pid:none) Oscillatoria sp. PCC 6506 anatoxin... 66 3e-09 AJ441056_3(AJ441056|pid:none) Planktothrix agardhii microcystin ... 66 3e-09 AY466441_29(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 56 4e-09 AM238664_468(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 52 4e-09 DQ116941_29(DQ116941|pid:none) Streptomyces antibioticus acetylt... 56 4e-09 AY495602_1(AY495602|pid:none) Gibberella moniliformis polyketide... 55 4e-09 CP000113_4412(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 60 4e-09 AY510454_4(AY510454|pid:none) Aspergillus nomius isolate AN13137... 47 4e-09 (P22367) RecName: Full=6-methylsalicylic acid synthase; ... 55 4e-09 (Q12397) RecName: Full=Putative sterigmatocystin biosynthesis po... 65 4e-09 L39121_1(L39121|pid:none) Emericella nidulans polyketide synthas... 65 4e-09 AJ548826_5(AJ548826|pid:none) Pseudomonas syringae slyABCDE gene... 52 5e-09 CP000075_1704(CP000075|pid:none) Pseudomonas syringae pv. syring... 52 5e-09 AE016853_4575(AE016853|pid:none) Pseudomonas syringae pv. tomato... 55 5e-09 DQ019316_7(DQ019316|pid:none) Gibberella zeae aldehyde dehydroge... 45 5e-09 CR628337_2116(CR628337|pid:none) Legionella pneumophila str. Len... 44 5e-09 AM270324_23(AM270324|pid:none) Aspergillus niger contig An14c017... 49 5e-09 AY354515_6(AY354515|pid:none) Streptomyces sp. HK803 PlmR5 (plmR... 52 5e-09 CP000117_4718(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 48 5e-09 CP000393_3333(CP000393|pid:none) Trichodesmium erythraeum IMS101... 65 6e-09 AJ536156_6(AJ536156|pid:none) Anabaena sp. 90 microcystin synthe... 65 6e-09 DQ885223_4(DQ885223|pid:none) Streptomyces violaceusniger merida... 55 6e-09 AF210843_9(AF210843|pid:none) Sorangium cellulosum strain So ce9... 59 6e-09 AF040570_21(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 56 6e-09 EU220288_3(EU220288|pid:none) Streptomyces eurythermus strain AT... 50 6e-09 AM778535_10(AM778535|pid:none) Streptomyces orinoci neoaureothin... 44 6e-09 DQ019316_6(DQ019316|pid:none) Gibberella zeae aldehyde dehydroge... 52 7e-09 AY652953_8(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 65 7e-09 CP000117_4713(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 65 7e-09 CP001037_2824(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 65 7e-09 FJ545274_16(FJ545274|pid:none) Streptomyces antibioticus strain ... 65 7e-09 AY899214_4(AY899214|pid:none) Streptomyces aizunensis strain NRR... 60 8e-09 AB032549_4(AB032549|pid:none) Microcystis aeruginosa mcyD, mcyE,... 57 8e-09 DQ176595_1(DQ176595|pid:none) Monascus pilosus monacolin K biosy... 50 8e-09 AE016958_3764(AE016958|pid:none) Mycobacterium avium subsp. para... 49 8e-09 CP000854_3738(CP000854|pid:none) Mycobacterium marinum M, comple... 47 8e-09 EU140798_1(EU140798|pid:none) Cylindrospermopsis raciborskii AWT... 64 9e-09 CP001037_2818(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 64 9e-09 AB435553_1(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 58 1e-08 AJ505006_2(AJ505006|pid:none) Sorangium cellulosum spiG gene (pa... 52 1e-08 AE016958_1796(AE016958|pid:none) Mycobacterium avium subsp. para... 48 1e-08 AF521085_10(AF521085|pid:none) Streptomyces nanchangensis NS3226... 48 1e-08 AM920436_508(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 52 1e-08 AM270206_1(AM270206|pid:none) Aspergillus niger contig An09c0170... 53 1e-08 CP000675_2260(CP000675|pid:none) Legionella pneumophila str. Cor... 42 1e-08 CP000820_3029(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 49 1e-08 CP001037_2811(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 64 1e-08 CP001037_1896(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 64 1e-08 AM238664_467(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 52 1e-08 AM420293_707(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 47 1e-08 AM270341_48(AM270341|pid:none) Aspergillus niger contig An15c014... 48 1e-08 AY092402_7(AY092402|pid:none) Aspergillus ochraceoroseus strain ... 53 1e-08 AM407731_7(AM407731|pid:none) Polyangium cellulosum spirangien b... 49 1e-08 AP008957_221(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 48 1e-08 AM270120_20(AM270120|pid:none) Aspergillus niger contig An07c002... 47 1e-08 CP000820_3405(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 44 2e-08 CP000302_3510(CP000302|pid:none) Shewanella denitrificans OS217,... 49 2e-08 AP009385_628(AP009385|pid:none) Burkholderia multivorans ATCC 17... 46 2e-08 CP000656_3375(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 48 2e-08 CP001020_587(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 50 2e-08 AE016828_686(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 50 2e-08 CP000733_770(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1... 50 2e-08 CP000890_1010(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 50 2e-08 AB376517_1(AB376517|pid:none) Plesiocystis sp. SIS-2 gene for po... 53 2e-08 AB279593_12(AB279593|pid:none) Microcystis aeruginosa new nonrib... 63 2e-08 AJ871581_7(AJ871581|pid:none) Streptomyces achromogenes subsp. r... 53 2e-08 CU633457_309(CU633457|pid:none) Podospora anserina genomic DNA c... 42 2e-08 AM269952_38(AM269952|pid:none) Aspergillus niger contig An01c005... 43 2e-08 EU520419_5(EU520419|pid:none) Pochonia chlamydosporia strain ATC... 43 2e-08 AM270243_1(AM270243|pid:none) Aspergillus niger contig An11c0260... 44 2e-08 AL583917_101(AL583917|pid:none) Mycobacterium leprae strain TN c... 45 2e-08 AY373435_3(AY373435|pid:none) Streptomyces nanchangensis strain ... 53 3e-08 CP000511_267(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1,... 52 3e-08 AM270337_27(AM270337|pid:none) Aspergillus niger contig An15c010... 43 3e-08 AY495592_1(AY495592|pid:none) Gibberella moniliformis polyketide... 43 3e-08 DQ190053_2(DQ190053|pid:none) Cystobacter fuscus MmxC (mmxC) and... 62 4e-08 DQ176871_14(DQ176871|pid:none) Streptomyces aureofaciens strain ... 62 4e-08 AX066431_1(AX066431|pid:none) Sequence 13 from Patent WO0100805.... 62 4e-08 EU595749_6(EU595749|pid:none) Pseudomonas aeruginosa strain PACS... 62 4e-08 AJ575648_7(AJ575648|pid:none) Streptomyces thioluteus aureothin ... 62 4e-08 AL646052_1805(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 54 4e-08 CP000479_1262(CP000479|pid:none) Mycobacterium avium 104, comple... 46 4e-08 AE016853_4576(AE016853|pid:none) Pseudomonas syringae pv. tomato... 45 4e-08 AY394444_1(AY394444|pid:none) Mycobacterium ulcerans clone 91 my... 49 4e-08 AD2135(AD2135) polyketide synthase type I [imported] - Nostoc sp... 62 5e-08 CP000850_2328(CP000850|pid:none) Salinispora arenicola CNS-205, ... 62 5e-08 CP000479_2340(CP000479|pid:none) Mycobacterium avium 104, comple... 48 5e-08 FJ872523_17(FJ872523|pid:none) Streptomyces sp. DSM 21069 putati... 50 5e-08 CU633895_40(CU633895|pid:none) Podospora anserina genomic DNA ch... 54 5e-08 AJ278573_4(AJ278573|pid:none) Streptomyces natalensis pimaricin ... 42 5e-08 DQ116941_6(DQ116941|pid:none) Streptomyces antibioticus acetyltr... 55 5e-08 AM270096_3(AM270096|pid:none) Aspergillus niger contig An04c0360... 49 5e-08 CP001291_1832(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 62 6e-08 DQ272520_5(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 62 6e-08 AY899214_3(AY899214|pid:none) Streptomyces aizunensis strain NRR... 62 6e-08 CP000384_243(CP000384|pid:none) Mycobacterium sp. MCS, complete ... 49 7e-08 DQ186598_2(DQ186598|pid:none) Cochliobolus heterostrophus strain... 48 7e-08 AY495643_1(AY495643|pid:none) Cochliobolus heterostrophus polyke... 48 7e-08 AP006618_191(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 52 7e-08 FJ405958_1(FJ405958|pid:none) Streptomyces griseus strain O175 c... 47 7e-08 AP009049_1419(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 61 8e-08 AM850130_13(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 61 8e-08 AM055942_139(AM055942|pid:none) Toxoplasma gondii RH, genomic DN... 61 8e-08 U78289_5(U78289|pid:none) Streptomyces fradiae tylactone synthas... 61 8e-08 AM946600_13(AM946600|pid:none) Chondromyces crocatus ajudazol bi... 61 8e-08 DQ351275_19(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 45 8e-08 CP000667_2725(CP000667|pid:none) Salinispora tropica CNB-440, co... 52 8e-08 AB363939_11(AB363939|pid:none) Streptomyces cyaneogriseus subsp.... 50 8e-08 U52151_1(U52151|pid:none) Aspergillus parasiticus polyketide syn... 54 9e-08 FJ406073_1(FJ406073|pid:none) Streptomyces griseus subsp. griseu... 49 9e-08 AY522504_20(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 61 1e-07 AM944567_1(AM944567|pid:none) Aspergillus carbonarius partial pk... 61 1e-07 CP001344_2632(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 61 1e-07 CP000838_224(CP000838|pid:none) Acaryochloris marina MBIC11017 p... 61 1e-07 AM238664_466(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 51 1e-07 AE000516_1256(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 46 1e-07 AM408590_1246(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 46 1e-07 CP000939_3611(CP000939|pid:none) Clostridium botulinum B1 str. O... 50 1e-07 AB376509_1(AB376509|pid:none) Sorangium cellulosum gene for poly... 47 1e-07 CP000875_3940(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 60 1e-07 AB363939_10(AB363939|pid:none) Streptomyces cyaneogriseus subsp.... 47 1e-07 AM778535_8(AM778535|pid:none) Streptomyces orinoci neoaureothin ... 55 1e-07 CU633866_66(CU633866|pid:none) Podospora anserina genomic DNA ch... 43 1e-07 AM270345_18(AM270345|pid:none) Aspergillus niger contig An15c018... 50 1e-07 AP007175_43(AP007175|pid:none) Aspergillus oryzae RIB40 genomic ... 43 1e-07 AL583921_77(AL583921|pid:none) Mycobacterium leprae strain TN co... 46 1e-07 CP000656_1155(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 42 1e-07 AF040570_23(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 42 1e-07 BA000035_2701(BA000035|pid:none) Corynebacterium efficiens YS-31... 60 2e-07 AM946600_3(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 60 2e-07 AM412319_8(AM412319|pid:none) [Polyangium] brachysporum glidobac... 60 2e-07 DQ897667_12(DQ897667|pid:none) Polyangium cellulosum strain So c... 52 2e-07 AY495603_1(AY495603|pid:none) Gibberella moniliformis polyketide... 49 2e-07 U31329_1(U31329|pid:none) Aspergillus terreus putative polyketid... 52 2e-07 AY117439_7(AY117439|pid:none) Streptomyces carzinostaticus subsp... 54 2e-07 FJ406004_1(FJ406004|pid:none) Streptomyces griseus strain 124 cl... 48 2e-07 FJ406015_1(FJ406015|pid:none) Streptomyces griseus strain 162 cl... 48 2e-07 FJ405954_1(FJ405954|pid:none) Streptomyces griseus strain O175 c... 47 2e-07 EU554404_1(EU554404|pid:none) Sorangium cellulosum strain 0157-1... 42 2e-07 AP009049_1606(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 60 2e-07 CP001037_3034(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 60 2e-07 T30228(T30228) polyketide synthase - Streptomyces hygroscopicus ... 60 2e-07 CU640366_785(CU640366|pid:none) Podospora anserina genomic DNA c... 60 2e-07 DQ645533_1(DQ645533|pid:none) Aphanizomenon issatschenkoi CAWBG0... 60 2e-07 AF081920_5(AF081920|pid:none) Pseudomonas fluorescens strain Pf-... 60 2e-07 AB193609_15(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetro... 49 2e-07 AY495647_1(AY495647|pid:none) Cochliobolus heterostrophus polyke... 47 2e-07 AL939125_142(AL939125|pid:none) Streptomyces coelicolor A3(2) co... 49 2e-07 FJ405949_1(FJ405949|pid:none) Streptomyces griseus strain O162 c... 48 3e-07 FJ405947_1(FJ405947|pid:none) Streptomyces griseus strain O162 c... 48 3e-07 FJ406103_1(FJ406103|pid:none) Streptomyces mediolani strain 1896... 47 3e-07 FJ405951_1(FJ405951|pid:none) Streptomyces griseus strain O175 c... 47 3e-07 FJ405944_1(FJ405944|pid:none) Streptomyces griseus strain O70 cl... 47 3e-07 FJ406038_1(FJ406038|pid:none) Streptomyces griseus strain E3 clo... 47 3e-07 DQ116941_31(DQ116941|pid:none) Streptomyces antibioticus acetylt... 59 3e-07 AY210783_11(AY210783|pid:none) Nodularia spumigena strain NSOR10... 59 3e-07 AP011115_4155(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 59 3e-07 DQ272521_9(DQ272521|pid:none) Streptomyces sp. Eco86 B gene locu... 59 3e-07 DQ289495_1(DQ289495|pid:none) Synthetic construct EpoE (epoE) ge... 59 3e-07 AC117082_1(AC117082|pid:none) Dictyostelium discoideum chromosom... 59 3e-07 CP001280_2660(CP001280|pid:none) Methylocella silvestris BL2, co... 49 3e-07 CP000511_3076(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 46 3e-07 FJ405955_1(FJ405955|pid:none) Streptomyces griseus strain O175 c... 47 3e-07 FJ405960_1(FJ405960|pid:none) Streptomyces griseus strain OE3 cl... 47 3e-07 FM204884_1588(FM204884|pid:none) Streptococcus equi subsp. zooep... 49 3e-07 AB376467_1(AB376467|pid:none) Sorangium cellulosum gene for poly... 45 3e-07 AM420293_2550(AM420293|pid:none) Saccharopolyspora erythraea NRR... 59 4e-07 EF550137_1(EF550137|pid:none) Streptomyces sp. 13 clone 13I-21 t... 59 4e-07 DQ351275_17(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 44 4e-07 AF025541_1(AF025541|pid:none) Aspergillus fumigatus polyketide s... 42 4e-07 FJ406468_1(FJ406468|pid:none) Aspergillus fumigatus strain IHEM ... 42 4e-07 FJ406463_1(FJ406463|pid:none) Aspergillus fumigatus strain CBS 1... 42 4e-07 FJ406464_1(FJ406464|pid:none) Aspergillus fumigatus strain IHEM ... 42 4e-07 FJ406467_1(FJ406467|pid:none) Aspergillus fumigatus strain IHEM ... 42 4e-07 FJ406465_1(FJ406465|pid:none) Aspergillus fumigatus strain IHEM ... 42 4e-07 U78289_2(U78289|pid:none) Streptomyces fradiae tylactone synthas... 44 4e-07 CP000431_4186(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 59 5e-07 EU443633_22(EU443633|pid:none) Micromonospora chalcea tetrocarci... 59 5e-07 AF217189_6(AF217189|pid:none) Sorangium cellulosum putative tran... 59 5e-07 AM992894_13(AM992894|pid:none) Streptomyces violaceoruber kendom... 47 5e-07 AB120221_5(AB120221|pid:none) Alternaria solani alt1, alt2, alt3... 45 5e-07 FJ406016_1(FJ406016|pid:none) Streptomyces griseus strain 175 cl... 46 6e-07 FJ405957_1(FJ405957|pid:none) Streptomyces griseus strain O175 c... 46 6e-07 CP001506_43(CP001506|pid:none) Burkholderia glumae BGR1 plasmid ... 58 7e-07 CP001506_42(CP001506|pid:none) Burkholderia glumae BGR1 plasmid ... 58 7e-07 CP000113_4410(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 58 7e-07 EU301739_27(EU301739|pid:none) Actinomadura kijaniata fructokina... 58 7e-07 AY652953_12(AY652953|pid:none) Lyngbya majuscula strain 19L cura... 58 7e-07 CP001037_1976(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 58 7e-07 EU220288_2(EU220288|pid:none) Streptomyces eurythermus strain AT... 50 7e-07 CP000479_209(CP000479|pid:none) Mycobacterium avium 104, complet... 45 7e-07 AE016958_220(AE016958|pid:none) Mycobacterium avium subsp. parat... 45 7e-07 CP000850_1215(CP000850|pid:none) Salinispora arenicola CNS-205, ... 54 9e-07 DQ272520_4(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 51 9e-07 AP009384_36(AP009384|pid:none) Azorhizobium caulinodans ORS 571 ... 58 9e-07 EU520419_1(EU520419|pid:none) Pochonia chlamydosporia strain ATC... 58 9e-07 AY495617_1(AY495617|pid:none) Botryotinia fuckeliana polyketide ... 58 9e-07 AF210843_8(AF210843|pid:none) Sorangium cellulosum strain So ce9... 58 9e-07 CP000155_2814(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 43 9e-07 DQ020252_1(DQ020252|pid:none) Streptomyces sp. UNSW 094300 type ... 40 1e-06 CP000712_3748(CP000712|pid:none) Pseudomonas putida F1, complete... 53 1e-06 CP001229_1484(CP001229|pid:none) Sulfurihydrogenibium azorense A... 56 1e-06 CP000806_3757(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 57 1e-06 AY214003_1(AY214003|pid:none) Ceratocystis resinifera polyketide... 57 1e-06 AP008955_3992(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 57 1e-06 CT573213_3367(CT573213|pid:none) Frankia alni str. ACN14A chromo... 52 1e-06 T30225(T30225) polyketide synthase - Streptomyces hygroscopicus ... 53 1e-06 T30283(T30283) polyketide synthase - Streptomyces sp. (strain MA... 53 1e-06 AE000516_4052(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 46 2e-06 AM408590_3868(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 46 2e-06 BX248347_118(BX248347|pid:none) Mycobacterium bovis subsp. bovis... 46 2e-06 CT573326_1478(CT573326|pid:none) Pseudomonas entomophila str. L4... 52 2e-06 AJ871581_38(AJ871581|pid:none) Streptomyces achromogenes subsp. ... 54 2e-06 AM270239_11(AM270239|pid:none) Aspergillus niger contig An11c022... 42 2e-06 AJ278141_1(AJ278141|pid:none) Gibberella fujikuroi pks4 gene for... 39 2e-06 AY522504_15(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 57 2e-06 AF263912_15(AF263912|pid:none) Streptomyces noursei ATCC 11455 n... 57 2e-06 EU140798_2(EU140798|pid:none) Cylindrospermopsis raciborskii AWT... 57 2e-06 AL009126_1768(AL009126|pid:none) Bacillus subtilis subsp. subtil... 57 2e-06 AF217189_5(AF217189|pid:none) Sorangium cellulosum putative tran... 57 2e-06 T28658(T28658)polyketide synthase - Sorangium cellulosum (fragme... 57 2e-06 DQ289493_1(DQ289493|pid:none) Synthetic construct EpoC (epoC) ge... 57 2e-06 CP000806_3076(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 57 2e-06 AL646053_642(AL646053|pid:none) Ralstonia solanacearum GMI1000 m... 57 2e-06 EF530035_1(EF530035|pid:none) Pseudomonas putida strain KCTC 163... 52 2e-06 AB376393_1(AB376393|pid:none) Myxococcus sp. M1017 gene for poly... 49 2e-06 CT573213_3981(CT573213|pid:none) Frankia alni str. ACN14A chromo... 50 2e-06 CP000511_5554(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 42 3e-06 DQ249342_4(DQ249342|pid:none) Streptomyces hygroscopicus subsp. ... 38 3e-06 AF360398_1(AF360398|pid:none) Byssochlamys nivea 6-methylsalicyl... 49 3e-06 CP001037_1897(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 56 3e-06 CP000117_1609(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 56 3e-06 FJ406006_1(FJ406006|pid:none) Streptomyces griseus strain 124 cl... 46 3e-06 T30226(T30226) polyketide synthase - Streptomyces hygroscopicus ... 51 3e-06 AJ223012_2(AJ223012|pid:none) Amycolatopsis mediterranei genes e... 45 3e-06 AF040570_22(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 45 3e-06 AM420293_4052(AM420293|pid:none) Saccharopolyspora erythraea NRR... 40 3e-06 AP007172_62(AP007172|pid:none) Aspergillus oryzae RIB40 genomic ... 49 3e-06 CP000712_3868(CP000712|pid:none) Pseudomonas putida F1, complete... 56 3e-06 AP009493_6371(AP009493|pid:none) Streptomyces griseus subsp. gri... 56 3e-06 FJ872525_9(FJ872525|pid:none) Streptomyces sp. MP39-85 putative ... 47 4e-06 AY495595_1(AY495595|pid:none) Gibberella moniliformis polyketide... 42 4e-06 CP000480_6182(CP000480|pid:none) Mycobacterium smegmatis str. MC... 46 4e-06 CP000384_2818(CP000384|pid:none) Mycobacterium sp. MCS, complete... 46 4e-06
>(Q54ED6) RecName: Full=Probable polyketide synthase 41; Short=dipks41; EC=2.3.1.-; Length = 2542
Score = 131 bits (329), Expect(2) = 6e-51 Identities = 92/258 (35%), Positives = 132/258 (51%), Gaps = 6/258 (2%) Frame = +3
Query: 12 ICNNLLNK-----QYLISFPKDENIKEL-IKKHKGPNEDSFKEFAKLQXXXXXXXXXXXX 173 I NN+ NK QYLI F + +IK L + K + N FKEFA+ Q Sbjct: 447 IRNNINNKSKSPKQYLIPFSTN-SIKSLDLYKSRIDNNVEFKEFAENQIKSKSKKLIQRS 505
Query: 174 XXXFISAKNWIEFEEKVEXXXXXXXXXXXXXXXXXXXXXXXXXXXPCIVFLFSGQGAQFN 353 + A NW EF K +VF+F GQGAQ++ Sbjct: 506 V---VIASNWDEFNLKSNTINTSNDKLTSNMLVSSNKKNVT------MVFVFCGQGAQYS 556
Query: 354 PLIFELYNSEPIFRETMDKIDEIMKIYLGFSTIEKVRQYKDEFDPELNTNQMITXXXXXX 533 + LY++EPIF+++MDKID + Y GFS +EK+R + +E D + +I Sbjct: 557 TMAKNLYDNEPIFKKSMDKIDSKLNEYYGFSILEKLRSF-NENDLKGIQYSIIAQPSTCM 615
Query: 534 XXXXXYKLFTEHWGLKPTIVFGHSFGEIVASYASGMIQDLETLCYVIYNRGKSQQKTFGT 713 ++L+ HWG+KP+I+ GHS GEI +SY SGMI DL+T CY+IY+R Q KT G Sbjct: 616 VQISLFELYC-HWGIKPSIIVGHSLGEISSSYCSGMI-DLDTFCYLIYHRSMVQSKTNGL 673
Query: 714 GKGMIWVDLGNEEFQEKF 767 G+ M+ + +G E+ K+ Sbjct: 674 GR-MLSISIGENEYNSKY 690
Score = 94.7 bits (234), Expect(2) = 6e-51 Identities = 58/197 (29%), Positives = 107/197 (54%), Gaps = 6/197 (3%) Frame = +2
Query: 776 KFKSVEVCCILSPSNVTIGGDKVELEQIVEQCKLESINTKVLSIPTAFHHSCQDCLYDDM 955 ++ +E+ C SPS++ I G ++ L +I+++ K + + +L PT+FH S Q + D++ Sbjct: 693 RYPELEIACYNSPSSIVIAGKELILNEIIKELKKDGVFCAILGSPTSFHTSSQLSVKDEI 752
Query: 956 MKLQFKSYPPKADIHHISTVKGTLFNKDFYINKEYVFENLRDQARLALGIKNVFQHIE-- 1129 +K+ FKS P I STV L+++ + +YV++N+ + R I N+++HIE Sbjct: 753 LKISFKSKQPTIPI--FSTVTTNLYDEMNPFDTKYVYDNIINPVRFTNTISNIYKHIELN 810
Query: 1130 --NSNLGRNVCFIEIGPRQSLLNYIIKQTPPLNKSENGNNYFKSVKTFASLTRDKGNE-- 1297 +N V FIEI P + L++ +KQ P +K + SV F+ L++ K N+ Sbjct: 811 YSVNNNSNEVIFIEIAPHPT-LSFYLKQMVPEDKKQ-------SVSIFSPLSKKKSNDLF 862
Query: 1298 GIHETLIQCFKQGYKNL 1348 I + + + + GY + Sbjct: 863 EIQKLISELYCLGYNGI 879
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3204285 Number of Hits to DB: 1,886,117,145 Number of extensions: 35962462 Number of successful extensions: 89938 Number of sequences better than 10.0: 1282 Number of HSP's gapped: 88808 Number of HSP's successfully gapped: 2407 Length of query: 449 Length of database: 1,040,966,779 Length adjustment: 132 Effective length of query: 317 Effective length of database: 618,001,159 Effective search space: 195906367403 Effective search space used: 195906367403 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
1 |
VH (FL, L) |
0 |
VF (FL, S) |
1 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
0 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |