NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U01222-1
Contig ID Contig-U01222-1
Contig update 2001. 8.29
Contig sequence 
>Contig-U01222-1 (Contig-U01222-1Q) /CSM_Contig/Contig-U01222-1Q.Seq.d
GCCAAAGCGTATGTAAGAGTGATTCATGTGGTGGTGCTGCTTCTTCAAAT
AGATATGGTGGTATTTGCGATCCAGATGGTTGTGATTACAATCCATACCG
TATGGGTAACACCAGTTTCTTTGGTCCAAACAAAATGATTGATACCAACT
CTGTAATTACTGTTGTAACTCAATTCATTACTGACGATGGTTCATCCGAT
GGCAAATTAACCTCAATCAAGAGATTGTATGTACAAGATGGTAACGTTAT
CTCTCAATCAGTATCAACCATTGATGGTGTCGAAGGTAATGAAGTCAATG
AAG----------ATGGGTGAAGCCTTAAAGGATGGTATGGTTCTTGTTC
TTAGTCTTTGGGATGATTACCAAGCCAACATGTTATGGCTCGATAGTTCA
TATCCAACAACTTCATCTCCAACAGATCCAGGTGTTGCTCGTGGATCTTG
TCCAACTACCTCTGGTGTTCCATCTAAAGTTGAACAAAATTATCCAAATG
CATACGTTGTCTACTCTAATATTAAAGTCGGTCCAATCGATTCAACATAT
AAAAAATAATTTTTTAAAAATAATATAATTTTATAAAAAATTATTAAATA
AATAAA
Gap gap included
Contig length 596
Chromosome number (1..6, M) 1
Chromosome length 4919822
Start point 1535102
End point 1535699
Strand (PLUS/MINUS) PLUS
Number of clones 2
Number of EST 4
Link to clone list U01222
List of clone(s) 

est1=SLD545F,1,249
est2=SLD587F,1,304
est3=SLD545Z,305,598
est4=SLD587Z,359,598
Translated Amino Acid sequence 
QSVCKSDSCGGAASSNRYGGICDPDGCDYNPYRMGNTSFFGPNKMIDTNSVITVVTQFIT
DDGSSDGKLTSIKRLYVQDGNVISQSVSTIDGVEGNEVNE---

---MGEALKDGMVLVLSLWDDYQANMLWLDSSYPTTSSPTDPGVARGSCPTTSGVPSKVE
QNYPNAYVVYSNIKVGPIDSTYKK*ffknniil*kiik*i
Translated Amino Acid sequence (All Frames) 
Frame A:
akayvrvihvvvlllqidmvvfaiqmvvitihtvwvtpvslvqtk*liptl*lll*lnsl
ltmvhpman*pqsrdcmykmvtlslnqyqplmvskvmksmk---

---MGEALKDGMVLVLSLWDDYQANMLWLDSSYPTTSSPTDPGVARGSCPTTSGVPSKVE
QNYPNAYVVYSNIKVGPIDSTYKK*ffknniil*kiik*i

Frame B:
pkrm*e*fmwwccffk*iwwylrsrwl*lqsipyg*hqflwskqnd*yqlcnyccnsihy
*rwfirwqinlnqeivctrw*rylsisinh*wcrr**sq*---

---wvkp*rmvwflflvfgmitkptcygsivhiqqlhlqqiqvllvdlvqlplvfhlkln
kiiqmhtlstlilksvqsiqhiknnflkii*fykkllnk*

Frame C:
QSVCKSDSCGGAASSNRYGGICDPDGCDYNPYRMGNTSFFGPNKMIDTNSVITVVTQFIT
DDGSSDGKLTSIKRLYVQDGNVISQSVSTIDGVEGNEVNE---

---g*slkgwygscs*slg*lpsqhvmar*fisnnfisnrsrccswilsnylwcsi*s*t
klskcircll*y*srsnrfni*kiif*k*ynfikny*ink
own update 2004. 6. 7
Homology vs CSM-cDNA 
Query= Contig-U01222-1 (Contig-U01222-1Q)
/CSM_Contig/Contig-U01222-1Q.Seq.d
         (606 letters)

Database: CSM
           8361 sequences; 7,895,291 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U01222-1 (Contig-U01222-1Q) /CSM_Contig/Conti...  1023  0.0
Contig-U09318-1 (Contig-U09318-1Q) /CSM_Contig/Conti...    34  0.23
Contig-U07865-1 (Contig-U07865-1Q) /CSM_Contig/Conti...    34  0.23
Contig-U12074-1 (Contig-U12074-1Q) /CSM_Contig/Conti...    32  0.92
Contig-U11901-1 (Contig-U11901-1Q) /CSM_Contig/Conti...    32  0.92
Contig-U11732-1 (Contig-U11732-1Q) /CSM_Contig/Conti...    32  0.92
Contig-U11712-1 (Contig-U11712-1Q) /CSM_Contig/Conti...    32  0.92
Contig-U11703-1 (Contig-U11703-1Q) /CSM_Contig/Conti...    32  0.92
Contig-U11466-1 (Contig-U11466-1Q) /CSM_Contig/Conti...    32  0.92
Contig-U11032-1 (Contig-U11032-1Q) /CSM_Contig/Conti...    32  0.92

>Contig-U01222-1 (Contig-U01222-1Q) /CSM_Contig/Contig-U01222-1Q.Seq.d
          Length = 606

 Score = 1023 bits (516), Expect = 0.0
 Identities = 546/546 (100%)
 Strand = Plus / Plus

                                                                       
Query: 1   gccaaagcgtatgtaagagtgattcatgtggtggtgctgcttcttcaaatagatatggtg 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   gccaaagcgtatgtaagagtgattcatgtggtggtgctgcttcttcaaatagatatggtg 60

                                                                       
Query: 61  gtatttgcgatccagatggttgtgattacaatccataccgtatgggtaacaccagtttct 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  gtatttgcgatccagatggttgtgattacaatccataccgtatgggtaacaccagtttct 120

                                                                       
Query: 121 ttggtccaaacaaaatgattgataccaactctgtaattactgttgtaactcaattcatta 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ttggtccaaacaaaatgattgataccaactctgtaattactgttgtaactcaattcatta 180

                                                                       
Query: 181 ctgacgatggttcatccgatggcaaattaacctcaatcaagagattgtatgtacaagatg 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ctgacgatggttcatccgatggcaaattaacctcaatcaagagattgtatgtacaagatg 240

                                                                       
Query: 241 gtaacgttatctctcaatcagtatcaaccattgatggtgtcgaaggtaatgaagtcaatg 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gtaacgttatctctcaatcagtatcaaccattgatggtgtcgaaggtaatgaagtcaatg 300

                                                                       
Query: 301 aagnnnnnnnnnnatgggtgaagccttaaaggatggtatggttcttgttcttagtctttg 360
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 aagnnnnnnnnnnatgggtgaagccttaaaggatggtatggttcttgttcttagtctttg 360

                                                                       
Query: 361 ggatgattaccaagccaacatgttatggctcgatagttcatatccaacaacttcatctcc 420
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 ggatgattaccaagccaacatgttatggctcgatagttcatatccaacaacttcatctcc 420

                                                                       
Query: 421 aacagatccaggtgttgctcgtggatcttgtccaactacctctggtgttccatctaaagt 480
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aacagatccaggtgttgctcgtggatcttgtccaactacctctggtgttccatctaaagt 480

                                                                       
Query: 481 tgaacaaaattatccaaatgcatacgttgtctactctaatattaaagtcggtccaatcga 540
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 tgaacaaaattatccaaatgcatacgttgtctactctaatattaaagtcggtccaatcga 540

                 
Query: 541 ttcaac 546
           ||||||
Sbjct: 541 ttcaac 546


>Contig-U09318-1 (Contig-U09318-1Q) /CSM_Contig/Contig-U09318-1Q.Seq.d
          Length = 1951

 Score = 34.2 bits (17), Expect = 0.23
 Identities = 17/17 (100%)
 Strand = Plus / Minus

                            
Query: 399 catatccaacaacttca 415
           |||||||||||||||||
Sbjct: 315 catatccaacaacttca 299


>Contig-U07865-1 (Contig-U07865-1Q) /CSM_Contig/Contig-U07865-1Q.Seq.d
          Length = 1362

 Score = 34.2 bits (17), Expect = 0.23
 Identities = 17/17 (100%)
 Strand = Plus / Minus

                            
Query: 125 tccaaacaaaatgattg 141
           |||||||||||||||||
Sbjct: 334 tccaaacaaaatgattg 318


  Database: CSM
    Posted date:  Jun 7, 2004  8:33 AM
  Number of letters in database: 7,895,291
  Number of sequences in database:  8361
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 5256
Number of Sequences: 8361
Number of extensions: 5256
Number of successful extensions: 443
Number of sequences better than 10.0: 45
length of query: 606
length of database: 7,895,291
effective HSP length: 16
effective length of query: 590
effective length of database: 7,761,515
effective search space: 4579293850
effective search space used: 4579293850
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 4.25
Homology vs DNA 
Query= Contig-U01222-1 (Contig-U01222-1Q) /CSM_Contig/Contig-U01222-1Q.Seq.d
         (606 letters)

Database: ddbj_A
           102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU061237) Dictyostelium discoideum slug cDNA, clone SLD587.      599   e-167  1
(AU061210) Dictyostelium discoideum slug cDNA, clone SLD545.      494   e-135  1
(AU052578) Dictyostelium discoideum slug cDNA, clone SLD545.      462   e-126  1
(AU052610) Dictyostelium discoideum slug cDNA, clone SLD587.      355   1e-93  1
(GC674969) Sequence 6 from patent US 7452707.                      74   7e-09  1
(GC674968) Sequence 3 from patent US 7452707.                      74   7e-09  1
(FB584138) Sequence 20 from Patent EP1867724.                      50   1e-08  2
(EA756966) Sequence 20 from patent US 7371926.                     50   1e-08  2
(AX467610) Sequence 20 from Patent WO0234926.                      50   1e-08  2
(AR882404) Sequence 20 from patent US 7049485.                     50   1e-08  2
(FJ026620) Trichoderma sp. XST1 cellubiohydrolase I mRNA, co...    66   2e-06  1
(GC674970) Sequence 9 from patent US 7452707.                      50   0.099  1
(AB274669) Uncultured symbiotic protist of Mastotermes darwi...    38   0.35   2
(AB274663) Uncultured symbiotic protist of Mastotermes darwi...    38   0.35   2
(AB274662) Uncultured symbiotic protist of Mastotermes darwi...    38   0.35   2
(AB274659) Uncultured symbiotic protist of Mastotermes darwi...    38   0.35   2
(GE484990) CCFS1825.g1_B02.ab1 CCF(STU) sunflower Helianthus...    46   1.6    1
(AX657600) Sequence 32 from Patent WO03000941.                     38   1.8    2
(AB274668) Uncultured symbiotic protist of Mastotermes darwi...    34   2.2    3
(CQ447441) Sequence 13201 from Patent WO0192523.                   30   2.4    3
(CV457596) EST911505 BEA Rhipicephalus microplus cDNA clone ...    38   3.6    2
(AX657633) Sequence 65 from Patent WO03000941.                     36   4.9    2
(AC158549) Mus musculus chromosome 19, clone RP24-216K4, com...    44   6.1    1
(AC125150) Mus musculus BAC clone RP24-354K9 from chromosome...    44   6.1    1
(AP008212) Oryza sativa (japonica cultivar-group) genomic DN...    44   6.1    1
(AP005446) Oryza sativa Japonica Group genomic DNA, chromoso...    44   6.1    1
(EA702243) Sequence 81122 from patent US 7365185.                  44   6.1    1
(DV643691) G11_02SC_1CS Sclerotinia sclerotiorum from Brassi...    44   6.1    1
(FC585626) CAXP3208.fwd CAXP Lottia gigantea from head, foot...    44   6.1    1
(FC573562) CAXP10566.fwd CAXP Lottia gigantea from head, foo...    44   6.1    1
(BX511073) Zebrafish DNA sequence from clone DKEY-245I10 in ...    38   7.9    3
(GM678823) Sequence 29 from Patent WO2008064314.                   36   8.6    2

>(AU061237) Dictyostelium discoideum slug cDNA, clone SLD587.
          Length = 304

 Score =  599 bits (302), Expect = e-167
 Identities = 302/302 (100%)
 Strand = Plus / Plus


Query: 1   gccaaagcgtatgtaagagtgattcatgtggtggtgctgcttcttcaaatagatatggtg 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   gccaaagcgtatgtaagagtgattcatgtggtggtgctgcttcttcaaatagatatggtg 60


Query: 61  gtatttgcgatccagatggttgtgattacaatccataccgtatgggtaacaccagtttct 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  gtatttgcgatccagatggttgtgattacaatccataccgtatgggtaacaccagtttct 120


Query: 121 ttggtccaaacaaaatgattgataccaactctgtaattactgttgtaactcaattcatta 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ttggtccaaacaaaatgattgataccaactctgtaattactgttgtaactcaattcatta 180


Query: 181 ctgacgatggttcatccgatggcaaattaacctcaatcaagagattgtatgtacaagatg 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ctgacgatggttcatccgatggcaaattaacctcaatcaagagattgtatgtacaagatg 240


Query: 241 gtaacgttatctctcaatcagtatcaaccattgatggtgtcgaaggtaatgaagtcaatg 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gtaacgttatctctcaatcagtatcaaccattgatggtgtcgaaggtaatgaagtcaatg 300


Query: 301 aa 302
           ||
Sbjct: 301 aa 302

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 526,697,756
Number of extensions: 27736651
Number of successful extensions: 2161209
Number of sequences better than 10.0: 32
Length of query: 606
Length of database: 101,790,757,118
Length adjustment: 23
Effective length of query: 583
Effective length of database: 99,442,330,388
Effective search space: 57974878616204
Effective search space used: 57974878616204
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
protein update 2009. 7.14
Homology vs Protein 
Query= Contig-U01222-1 (Contig-U01222-1Q) /CSM_Contig/Contig-U01222-1Q.Seq.d
         (606 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM711863_1(AM711863|pid:none) Thermoascus aurantiacus cel7A gene...   142   3e-58
AX657575_1(AX657575|pid:none) Sequence 7 from Patent WO03000941.      143   1e-57
AY790330_1(AY790330|pid:none) Penicillium chrysogenum exo-cellob...   146   9e-57
AB089436_1(AB089436|pid:none) Aspergillus oryzae celC gene for c...   138   3e-56
AF439935_1(AF439935|pid:none) Talaromyces emersonii cellobiohydr...   138   2e-55
AX657623_1(AX657623|pid:none) Sequence 55 from Patent WO03000941.     130   2e-53
(O59843) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...   124   4e-51
AJ312295_1(AJ312295|pid:none) Penicillium funiculosum xynA gene ...   132   3e-50
EF397602_1(EF397602|pid:none) Penicillium decumbens exo-cellobio...   139   4e-50
AM920433_549(AM920433|pid:none) Penicillium chrysogenum Wisconsi...   131   2e-49
(Q06886) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...   132   8e-49
(Q7SA23) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...   125   7e-48
AX657615_1(AX657615|pid:none) Sequence 47 from Patent WO03000941.     125   3e-47
AP007161_794(AP007161|pid:none) Aspergillus oryzae RIB40 genomic...   137   9e-47
AB089437_1(AB089437|pid:none) Aspergillus oryzae celD gene for c...   137   9e-47
AM270149_20(AM270149|pid:none) Aspergillus niger contig An07c032...   130   3e-46
AF156268_1(AF156268|pid:none) Aspergillus niger 1,4-beta-D-gluca...   130   3e-46
AB071864_1(AB071864|pid:none) Pseudotrichonympha grassii PgCBH-h...   118   8e-46
AB071865_1(AB071865|pid:none) Pseudotrichonympha grassii PgCBH-h...   118   8e-46
D63515_1(D63515|pid:none) Humicola grisea var. thermoidea cbh-1 ...   122   1e-45
(P15828) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...   122   1e-45
AB019377_1(AB019377|pid:none) Irpex lacteus cel3 gene for cellul...   110   2e-45
AX657569_1(AX657569|pid:none) Sequence 1 from Patent WO03000941.      117   2e-45
AX657577_1(AX657577|pid:none) Sequence 9 from Patent WO03000941.      116   1e-44
DQ490495_1(DQ490495|pid:none) Emericella nidulans putative beta-...   132   1e-44
AF420019_1(AF420019|pid:none) Aspergillus nidulans 1,4-beta-D-gl...   130   5e-44
AY559103_1(AY559103|pid:none) Volvariella volvacea cellobiohydro...   106   9e-44
AB501102_1(AB501102|pid:none) Coniophora puteana cel7B mRNA for ...   113   4e-43
(P38676) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...   120   1e-42
AM262993_1(AM262993|pid:none) Pleurotus ostreatus cbhI-1 gene fo...   106   2e-42
AB298322_1(AB298322|pid:none) Polyporus arcularius cel1 gene for...   103   6e-42
FB654427_1(FB654427|pid:none) Sequence 79 from Patent WO20071157...   105   8e-42
FB654425_1(FB654425|pid:none) Sequence 77 from Patent WO20071157...   105   8e-42
FB654389_1(FB654389|pid:none) Sequence 41 from Patent WO20071157...   105   8e-42
FJ026620_1(FJ026620|pid:none) Trichoderma sp. XST1 cellubiohydro...   103   8e-42
(Q9P8P3) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...   106   8e-42
NRL(1CELA) cellulose 1,4-beta-cellobiosidase (EC 3.2.1.91) I, ch...   105   8e-42
EU872026_1(EU872026|pid:none) Hypocrea virens strain UKM1 cellob...   102   1e-41
AX657633_1(AX657633|pid:none) Sequence 65 from Patent WO03000941.     108   1e-41
AB019376_1(AB019376|pid:none) Irpex lacteus cel2 gene for exocel...   103   1e-41
AB274543_1(AB274543|pid:none) Uncultured symbiotic protist of Re...   107   1e-41
AF176571_1(AF176571|pid:none) Alternaria alternata exoglucanase ...   110   1e-41
AM262871_1(AM262871|pid:none) Pleurotus ostreatus cbhI-3 gene fo...   104   2e-41
(P19355) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...   100   2e-41
AB177377_1(AB177377|pid:none) Irpex lacteus cex1 mRNA for cellob...   102   2e-41
S33164(S33164) cellulose 1,4-beta-cellobiosidase (EC 3.2.1.91) -...    99   2e-41
AX657619_1(AX657619|pid:none) Sequence 51 from Patent WO03000941.     106   2e-41
AB501101_1(AB501101|pid:none) Coniophora puteana cel7A mRNA for ...   105   2e-41
AY861347_1(AY861347|pid:none) Chaetomium thermophilum cellobiohy...   107   5e-41
AM262872_1(AM262872|pid:none) Pleurotus ostreatus cbhI-4 gene fo...   102   1e-40
S41942(S44714;S41942) cellulose 1,4-beta-cellobiosidase (EC 3.2....    95   2e-40
S11439(S11439) cellulose 1,4-beta-cellobiosidase (EC 3.2.1.91) -...   101   2e-40
L22656_1(L22656|pid:none) Phanerochaete chrysosporium major cell...    95   2e-40
AF240001_1(AF240001|pid:none) Leptosphaeria maculans cellulase C...    99   3e-40
Y07550_1(Y07550|pid:none) Claviceps purpurea cel1 gene for cellu...   111   4e-40
AB274706_1(AB274706|pid:none) Uncultured symbiotic protist of Cr...   102   4e-40
AB274708_1(AB274708|pid:none) Uncultured symbiotic protist of Cr...   102   7e-40
AX657617_1(AX657617|pid:none) Sequence 49 from Patent WO03000941.     106   1e-39
AB274583_1(AB274583|pid:none) Uncultured symbiotic protist of Ho...   104   1e-39
AB274705_1(AB274705|pid:none) Uncultured symbiotic protist of Cr...   103   1e-39
AF411250_1(AF411250|pid:none) Lentinula edodes cellulase CEL7A (...   106   1e-39
AY559102_1(AY559102|pid:none) Volvariella volvacea cellobiohydro...    99   1e-39
AY706932_1(AY706932|pid:none) Fusarium venenatum isolate 5 exogl...   104   1e-39
AY706934_1(AY706934|pid:none) Fusarium poae exoglucanase type C ...   103   6e-39
(P46238) RecName: Full=Putative exoglucanase type C;          EC...   104   2e-38
S44716(S44716;S33165) cellulose 1,4-beta-cellobiosidase (EC 3.2....    95   2e-38
(Q00328) RecName: Full=Exoglucanase 1;          EC=3.2.1.91; Alt...    93   1e-37
AB019375_1(AB019375|pid:none) Irpex lacteus cel1 gene for cellul...   103   1e-37
AM711861_1(AM711861|pid:none) Acremonium thermophilum cel7B gene...    91   5e-37
AB274662_1(AB274662|pid:none) Uncultured symbiotic protist of Ma...    94   2e-36
BX284752_16(BX284752|pid:none) Neurospora crassa DNA linkage gro...    89   8e-35
DQ014513_1(DQ014513|pid:none) Reticulitermes flavipes gut symbio...   100   1e-34
AB274623_1(AB274623|pid:none) Uncultured symbiotic protist of Ne...    87   2e-34
AB274668_1(AB274668|pid:none) Uncultured symbiotic protist of Ma...    96   4e-34
AX657581_1(AX657581|pid:none) Sequence 13 from Patent WO03000941.      84   1e-33
AB274664_1(AB274664|pid:none) Uncultured symbiotic protist of Ma...    92   1e-33
CU633898_31(CU633898|pid:none) Podospora anserina genomic DNA ch...    88   2e-33
AB003105_1(AB003105|pid:none) Humicola grisea var. thermoidea ex...    83   2e-33
DQ085790_1(DQ085790|pid:none) Chaetomium thermophilum cellobiohy...    87   3e-33
AX657583_1(AX657583|pid:none) Sequence 15 from Patent WO03000941.      85   4e-33
AX657609_1(AX657609|pid:none) Sequence 41 from Patent WO03000941.      86   6e-33
AB274618_1(AB274618|pid:none) Uncultured symbiotic protist of Ne...    91   1e-32
AB274554_1(AB274554|pid:none) Uncultured symbiotic protist of Re...    94   2e-32
AB274540_1(AB274540|pid:none) Uncultured symbiotic protist of Re...    93   2e-32
AB274635_1(AB274635|pid:none) Uncultured symbiotic protist of Ne...    91   6e-32
A48939(A48939) cellobiohydrolase 1-1 - basidiomycete (Phanerocha...    96   2e-31
AB274630_1(AB274630|pid:none) Uncultured symbiotic protist of Ne...    83   5e-30
AX254754_1(AX254754|pid:none) Sequence 3 from Patent WO0170998. ...    95   1e-28
B48939(B48939;S20739;S20740) cellulose 1,4-beta-cellobiosidase (...    93   3e-27
AP007175_275(AP007175|pid:none) Aspergillus oryzae RIB40 genomic...    80   3e-25
AF420021_1(AF420021|pid:none) Aspergillus nidulans endo-1,4-beta...    86   6e-25
FJ393561_1(FJ393561|pid:none) Penicillium decumbens strain L-06 ...    75   5e-24
GQ153650_1(GQ153650|pid:none) Penicillium oxalicum endoglucanase...    75   6e-24
EU339127_1(EU339127|pid:none) Penicillium decumbens endoglucanas...    75   6e-24
FB654443_1(FB654443|pid:none) Sequence 95 from Patent WO20071157...    69   2e-22
FB654447_1(FB654447|pid:none) Sequence 99 from Patent WO20071157...    69   2e-22
FB654441_1(FB654441|pid:none) Sequence 93 from Patent WO20071157...    69   2e-22
FB654409_1(FB654409|pid:none) Sequence 61 from Patent WO20071157...    69   2e-22
AY928809_1(AY928809|pid:none) Hypocrea jecorina strain PTCC 5142...    69   2e-22
FB654371_1(FB654371|pid:none) Sequence 23 from Patent WO20071157...    69   2e-22
FB654373_1(FB654373|pid:none) Sequence 25 from Patent WO20071157...    69   2e-22
(Q12714) RecName: Full=Endoglucanase EG-1;          EC=3.2.1.4; ...    69   4e-22
EF185865_1(EF185865|pid:none) Hypocrea pseudokoningii endoglucan...    68   6e-22
A03823_1(A03823|pid:none) Artificial sequence (plasmid pTT11) fo...    65   2e-21
EU935217_1(EU935217|pid:none) Trichoderma sp. SSL endoglucanase ...    68   2e-20
AF336799_1(AF336799|pid:none) Cochliobolus carbonum cellulase (C...    64   3e-20
AF490891_1(AF490891|pid:none) Fusarium sp. F1 Cbh-C (Cbh-C) gene...    71   4e-20
AF490896_1(AF490896|pid:none) Gibberella pulicaris isolate 6 Cbh...    72   9e-20
(Q12622) RecName: Full=Endoglucanase EG-1;          EC=3.2.1.4; ...    64   4e-19
AJ515704_1(AJ515704|pid:none) Melanocarpus albomyces cel7A gene ...    72   7e-19
AB274665_1(AB274665|pid:none) Uncultured symbiotic protist of Ma...    73   9e-19
(P56680) RecName: Full=Endoglucanase 1;          EC=3.2.1.4; Alt...    61   4e-18
AF292710_1(AF292710|pid:none) Fusarium oxysporum f. sp. lycopers...    57   6e-16
(P46237) RecName: Full=Endoglucanase type C;          EC=3.2.1.4...    57   6e-16
DQ014512_1(DQ014512|pid:none) Reticulitermes flavipes gut symbio...    85   1e-15
AB274536_1(AB274536|pid:none) Uncultured symbiotic protist of Re...    55   3e-15
AB274546_1(AB274546|pid:none) Uncultured symbiotic protist of Re...    60   4e-15
AB274548_1(AB274548|pid:none) Uncultured symbiotic protist of Re...    83   5e-15
AB429161_1(AB429161|pid:none) Eukaryotic synthetic construct RsS...    83   5e-15
AB274615_1(AB274615|pid:none) Uncultured symbiotic protist of Ne...    57   7e-15
AB274555_1(AB274555|pid:none) Uncultured symbiotic protist of Re...    56   7e-15
AB274634_1(AB274634|pid:none) Uncultured symbiotic protist of Ne...    61   1e-14
AB071011_1(AB071011|pid:none) Holomastigotoides mirabile HmEG1 m...    60   2e-14
AB274542_1(AB274542|pid:none) Uncultured symbiotic protist of Re...    81   2e-14
AB071012_1(AB071012|pid:none) Holomastigotoides mirabile HmEG2 m...    60   3e-14
AB274628_1(AB274628|pid:none) Uncultured symbiotic protist of Ne...    61   9e-14
AB071009_1(AB071009|pid:none) Pseudotrichonympha grassii PgEG2 m...    57   1e-13
AB071002_1(AB071002|pid:none) Pseudotrichonympha grassii PgEG1b ...    57   1e-13
AB274670_1(AB274670|pid:none) Uncultured symbiotic protist of Ma...    55   6e-13
AB089800_1(AB089800|pid:none) Coptotermes lacteus symbiont WH200...    55   6e-13
AB274667_1(AB274667|pid:none) Uncultured symbiotic protist of Ma...    52   1e-12
AB071013_1(AB071013|pid:none) Holomastigotoides mirabile HmEG3 m...    54   1e-12
AB274661_1(AB274661|pid:none) Uncultured symbiotic protist of Ma...    54   1e-12
AB274620_1(AB274620|pid:none) Uncultured symbiotic protist of Ne...    53   1e-12
AB274703_1(AB274703|pid:none) Uncultured symbiotic protist of Cr...    55   2e-12
AB274621_1(AB274621|pid:none) Uncultured symbiotic protist of Ne...    53   3e-12
AB274632_1(AB274632|pid:none) Uncultured symbiotic protist of Ne...    51   3e-12
AB274544_1(AB274544|pid:none) Uncultured symbiotic protist of Re...    61   4e-12
AB274671_1(AB274671|pid:none) Uncultured symbiotic protist of Ma...    52   4e-12
S26994(S26994;S30614)cellulose 1,4-beta-cellobiosidase (EC 3.2.1...    73   5e-12
AB089801_1(AB089801|pid:none) Coptotermes lacteus symbiont WH200...    54   6e-12
AB274619_1(AB274619|pid:none) Uncultured symbiotic protist of Ne...    56   8e-12
EU652768_1(EU652768|pid:none) Penicillium oxalicum strain F67 ex...    72   9e-12
Z11729_1(Z11729|pid:none) P.chrysosporium PBH1-6 gene 3'end for ...    70   4e-11
S26995(S26995;S30615)cellulose 1,4-beta-cellobiosidase (EC 3.2.1...    70   4e-11
AB274616_1(AB274616|pid:none) Uncultured symbiotic protist of Ne...    48   4e-11
AB274535_1(AB274535|pid:none) Uncultured symbiotic protist of Re...    59   5e-11
AB274637_1(AB274637|pid:none) Uncultured symbiotic protist of Ne...    50   1e-10
AB274660_1(AB274660|pid:none) Uncultured symbiotic protist of Ma...    51   1e-10
BX897678_3(BX897678|pid:none) Neurospora crassa DNA linkage grou...    68   2e-10
AB274636_1(AB274636|pid:none) Uncultured symbiotic protist of Ne...    51   5e-10
CS414617_1(CS414617|pid:none) Sequence 9 from Patent EP1700524.        65   1e-09
AB274624_1(AB274624|pid:none) Uncultured symbiotic protist of Ne...    49   4e-09
AB274658_1(AB274658|pid:none) Uncultured symbiotic protist of Ma...    61   2e-08
AF546136_1(AF546136|pid:none) Fusarium sporotrichioides Cbh-C (C...    40   2e-07
AF490897_1(AF490897|pid:none) Fusarium tricinctum Cbh-C (Cbh-C) ...    39   1e-06
AB274551_1(AB274551|pid:none) Uncultured symbiotic protist of Re...    50   6e-05
EF624464_1(EF624464|pid:none) Thermomyces lanuginosus cellobiohy...    43   0.006
CU633459_38(CU633459|pid:none) Podospora anserina genomic DNA ch...    39   0.11
AL844509_589(AL844509|pid:none) Plasmodium falciparum 3D7 chromo...    37   0.57
AJ249165_1(AJ249165|pid:none) Plasmodium falciparum gc-beta gene...    37   0.57
AY009089_10(AY009089|pid:none) Camelpox virus CMS, complete geno...    36   0.74
AY814250_1(AY814250|pid:none) Schistosoma japonicum SJCHGC04655 ...    35   1.3

>AM711863_1(AM711863|pid:none) Thermoascus aurantiacus cel7A gene
           for cellulose 1,4-beta-cellobiosidase.
          Length = 457

 Score =  142 bits (357), Expect(2) = 3e-58
 Identities = 63/98 (64%), Positives = 75/98 (76%)
 Frame = +3

Query: 3   QSVCKSDSCGGAASSNRYGGICDPDGCDYNPYRMGNTSFFGPNKMIDTNSVITVVTQFIT 182
           Q++C+ D CGG  SS RY G CDPDGCD+NPYR GN SF+GP +++DT+S  TVVTQFIT
Sbjct: 252 QTMCQGDDCGGTYSSTRYAGTCDPDGCDFNPYRQGNHSFYGPGQIVDTSSKFTVVTQFIT 311

Query: 183 DDGSSDGKLTSIKRLYVQDGNVISQSVSTIDGVEGNEV 296
           DDG+  G LT IKR YVQ+G VI QS STI GV GN +
Sbjct: 312 DDGTPSGTLTEIKRFYVQNGKVIPQSESTISGVTGNSI 349

 Score =  106 bits (265), Expect(2) = 3e-58
 Identities = 49/79 (62%), Positives = 59/79 (74%)
 Frame = +2

Query: 314 MGEALKDGMVLVLSLWDDYQANMLWLXXXXXXXXXXXXXGVARGSCPTTSGVPSKVEQNY 493
           + +AL  GMVLV+SLWDD+ ANMLWL             GVARG+CPTTSGVP+ VE  Y
Sbjct: 376 ISQALAQGMVLVMSLWDDHAANMLWLDSTYPTDADPDTPGVARGTCPTTSGVPADVESQY 435

Query: 494 PNAYVVYSNIKVGPIDSTY 550
           PN+YV+YSNIKVGPI+ST+
Sbjct: 436 PNSYVIYSNIKVGPINSTF 454

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,001,442,098
Number of extensions: 19679290
Number of successful extensions: 52169
Number of sequences better than 10.0: 163
Number of HSP's gapped: 51537
Number of HSP's successfully gapped: 314
Length of query: 202
Length of database: 1,051,180,864
Length adjustment: 122
Effective length of query: 80
Effective length of database: 656,320,666
Effective search space: 52505653280
Effective search space used: 52505653280
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
PSORT 

 psg: 0.85  gvh: 0.46  alm: 0.48  top: 0.47  tms: 0.00  mit: 0.20  mip: 0.04
 nuc: 0.00  erl: 0.00  erm: 0.20  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 44.0 %: cytoplasmic
	 32.0 %: nuclear
	 12.0 %: cytoskeletal
	  8.0 %: peroxisomal
	  4.0 %: mitochondrial

>> prediction for Contig-U01222-1 is cyt
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 2
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0