| Contig-U05546-1 |
| Contig ID |
Contig-U05546-1 |
| Contig update |
2001. 8.30 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
897 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
6834039 |
| End point |
6834939 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
1 |
| Number of EST |
1 |
| Link to clone list |
U05546 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 7.29 |
| Homology vs DNA |
Query= Contig-U05546-1 (Contig-U05546-1Q) /CSM_Contig/Contig-U05546-1Q.Seq.d
(897 letters)
Database: ddbj_B
105,743,758 sequences; 104,622,809,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AC115613) Dictyostelium discoideum chromosome 2 map 209116-... 930 0.0 5
(C91060) Dictyostelium discoideum slug cDNA, clone SSJ435. 928 0.0 3
(AU074065) Dictyostelium discoideum slug cDNA, clone SSJ435. 248 2e-97 4
(CJ396524) Molgula tectiformis cDNA, gonad clone:mtgd028j15,... 54 3e-11 3
(CJ394514) Molgula tectiformis cDNA, gonad clone:mtgd022k12,... 54 3e-11 3
(DV344643) NABWF37TF Aedes aegypti infected with Brugia Mala... 52 9e-10 2
(ES623914) NGPPI20TR NGPP Nasonia giraulti cDNA, mRNA sequence. 64 3e-09 4
(EE571454) F12_F12fv2c24_pDNRf_530645 Myzus persicae, line F... 72 4e-08 1
(EE571438) F10_F10fv4c20_pDNRf_531397 Myzus persicae, line F... 72 4e-08 1
(EE261988) G08_G08ff5p15_pDNRf_515110 Myzus persicae, line F... 72 4e-08 1
(GE741528) CBUG4244.b1 B.anynana_wing.LCPP_nosize Bicyclus a... 46 7e-07 2
(GE741529) CBUG4244.g1 B.anynana_wing.LCPP_nosize Bicyclus a... 46 7e-07 2
(CJ401383) Molgula tectiformis cDNA, gonad clone:mtgd014o18,... 54 2e-06 3
(FM916799) Brachionus plicatilis EST 5' end, clone sb102P002... 52 5e-05 3
(FM904494) Brachionus plicatilis EST 5' end, clone sb101P002... 52 6e-05 3
(FM939368) Brachionus plicatilis EST 5' end, clone sb104P005... 52 7e-05 3
(FM938425) Brachionus plicatilis EST 5' end, clone sb104P004... 52 7e-05 3
(GE373611) 292309981 Nasonia vitripennis Male Pupae Nasonia ... 56 6e-04 2
(GE363566) 292287682 Nasonia vitripennis Male Pupae Nasonia ... 56 6e-04 2
(GE454822) 294593851 Nasonia vitripennis Adult Female Nasoni... 56 6e-04 2
(CV740518) SJAL_027_58.T7 SJL Schistosoma japonicum cDNA, mR... 58 6e-04 1
(GE416627) 294498929 Nasonia vitripennis Adult Male Nasonia ... 56 6e-04 2
(FE154909) LV_LO_RA015M16r Litopenaeus vannamei lymphoid org... 54 7e-04 2
(FE154821) LV_LO_RA015K04r Litopenaeus vannamei lymphoid org... 54 7e-04 2
(FE159767) LV_LO_RA026K10r Litopenaeus vannamei lymphoid org... 54 7e-04 2
(FM910660) Brachionus plicatilis EST 5' end, clone sb102P000... 48 8e-04 3
(GE415425) 294495985 Nasonia vitripennis Adult Male Nasonia ... 56 0.002 1
(FF784036) XABT82228.fwd Gateway compatible cien cDNA librar... 36 0.003 3
(AR546391) Sequence 1522 from patent US 6747137. 54 0.003 2
(FF713823) XABT33380.fwd Gateway compatible cien cDNA librar... 36 0.004 3
(FM943877) Brachionus plicatilis EST 5' end, clone sbs03P000... 52 0.006 2
(FM897967) Brachionus plicatilis EST 5' end, clone sb101P000... 44 0.009 3
(DB843066) Nilaparvata lugens mRNA, EST clone:NLEA4727, 5' e... 54 0.010 1
(CJ390814) Molgula tectiformis cDNA, gonad clone:mtgd014o18,... 54 0.010 1
(FE154910) LV_LO_RA015O16f Litopenaeus vannamei lymphoid org... 54 0.010 1
(FE154822) LV_LO_RA015M04f Litopenaeus vannamei lymphoid org... 54 0.010 1
(AC034139) Homo sapiens BAC clone RP11-67M24 from 4, complet... 52 0.039 1
(FK088194) XABT141229.g1 Gateway compatible cien cDNA librar... 36 0.040 3
(CJ407305) Molgula tectiformis cDNA, gonad clone:mtgd028j15,... 44 0.041 3
(FK088193) XABT141229.b1 Gateway compatible cien cDNA librar... 34 0.041 3
(GE355866) 291525731 Nasonia vitripennis Male Pupae Nasonia ... 48 0.12 2
(GC700359) Sequence 15604 from patent US 6812339. 44 0.14 3
(CE323645) tigr-gss-dog-17000360287228 Dog Library Canis lup... 50 0.15 1
(EB607639) AGENCOURT_54968762 D. mojavensis EST Drosophila m... 50 0.15 1
(FE159768) LV_LO_RA026M10r Litopenaeus vannamei lymphoid org... 50 0.15 1
(CS742011) Sequence 10007 from Patent WO2005083127. 44 0.20 3
(ER477365) 1093015245156 Global-Ocean-Sampling_GS-35-01-01-1... 34 0.24 3
(FM942657) Brachionus plicatilis EST 5' end, clone sbs02P000... 46 0.32 2
(FF713822) XABT33380.rev Gateway compatible cien cDNA librar... 36 0.44 2
(BB342235) Mus musculus 10 days neonate cerebellum cDNA, RIK... 38 0.46 2
(EF506888) Homo sapiens fibroblast growth factor 2 (basic) (... 48 0.60 2
(AC157217) Pan troglodytes BAC clone CH251-305B5 from chromo... 48 0.60 1
(AC106715) Homo sapiens 3 BAC RP11-695J20 (Roswell Park Canc... 48 0.60 1
(AC021205) Homo sapiens BAC clone RP11-170N16 from 4, comple... 48 0.60 1
(AC025799) Homo sapiens chromosome 15 clone RP11-695J20 map ... 48 0.60 1
(AC130187) Atelerix albiventris clone LB4-344F17, complete s... 40 0.92 6
(AC079386) Homo sapiens 12 BAC RP11-12K13 (Roswell Park Canc... 42 1.2 3
(AL445930) Human DNA sequence from clone RP11-366O20 on chro... 44 1.3 3
(CT743726) Paramecium tetraurelia 5-PRIME EST from clone LK0... 32 1.6 2
(AC084092) Homo sapiens chromosome 8 clone CTD-3117N17 map 8... 42 1.7 2
(AC068268) Homo sapiens chromosome 3 clone RP11-322F17 map 3... 46 2.0 2
(AC026190) Homo sapiens chromosome 3 clone RP11-372K9 map 3p... 46 2.0 5
(AC012148) Homo sapiens chromosome 18, clone RP11-128L12, co... 40 2.2 4
(AC090231) Homo sapiens chromosome 18, clone RP11-834I3, com... 40 2.3 4
(AP009290) Solanum lycopersicum genomic DNA, chromosome 8, c... 46 2.4 1
(AM454104) Vitis vinifera, whole genome shotgun sequence, co... 46 2.4 1
(U67917) Dictyostelium discoideum RING/leucine zipper protei... 46 2.4 1
(EU124597) Lutzomyia longipalpis 19.0 kDa midgut protein mRN... 46 2.4 1
(AC027123) Homo sapiens chromosome 3 clone RP11-392M7 map 3p... 46 2.4 1
(AC151637) Dasypus novemcinctus clone VMRC5-14E11, WORKING D... 46 2.4 1
(AC151451) Dasypus novemcinctus clone VMRC5-290I3, WORKING D... 46 2.4 1
(AC179380) Strongylocentrotus purpuratus clone R3-59O6, WORK... 46 2.4 1
(AC024377) Homo sapiens clone RP11-611H22, WORKING DRAFT SEQ... 46 2.4 1
(AC018496) Homo sapiens chromosome 3p clone RP11-210B17, WOR... 46 2.4 1
(FH311701) CHO_OF4425xn03r1.ab1 CHO_OF4 Nicotiana tabacum ge... 46 2.4 1
(FH309981) CHO_OF4424xn03r1.ab1 CHO_OF4 Nicotiana tabacum ge... 46 2.4 1
(CE132855) tigr-gss-dog-17000326253832 Dog Library Canis lup... 46 2.4 1
(AV675769) Ciona intestinalis cDNA clone:citb13i16 : 5' end,... 46 2.4 1
(AM097266) Lutzomyia longipalpis EST clone NSFM-54h01, seque... 46 2.4 1
(AM097265) Lutzomyia longipalpis EST clone NSFM-54h01, seque... 46 2.4 1
(AM097264) Lutzomyia longipalpis EST clone NSFM-55h01, seque... 46 2.4 1
(CJ405200) Molgula tectiformis cDNA, gonad clone:mtgd022k12,... 46 2.4 1
(BJ404979) Dictyostelium discoideum cDNA clone:dds30a10, 3' ... 46 2.4 1
(BJ393134) Dictyostelium discoideum cDNA clone:dds30a10, 5' ... 46 2.4 1
(FF757792) XABT64727.fwd Gateway compatible cien cDNA librar... 46 2.4 1
(EW996180) LJGUM-P03_C06 Adult female Lutzomyia longipalpis ... 46 2.4 1
(EW995898) LJGU-M-8_G07 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW995858) LJGU-M-8_C05 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW995385) LJGUL-P02_F03 Adult female Lutzomyia longipalpis ... 46 2.4 1
(EW995089) LJGU-L-7_C03 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW994669) LJGDIL7_D12 Adult female Lutzomyia longipalpis mi... 46 2.4 1
(EW994165) LJGDIL10_B04 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW994159) LJGDIL10_A08 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW992694) LJGDM30_H02 Adult female Lutzomyia longipalpis mi... 46 2.4 1
(EW990720) LJGFIS30_C11 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW990467) LJGFIM27_C03 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW989497) LJGFIL5_C04 Adult female Lutzomyia longipalpis mi... 46 2.4 1
(EW989423) LJGFIL4_B08 Adult female Lutzomyia longipalpis mi... 46 2.4 1
(EW989389) LJGFIL3_G01 Adult female Lutzomyia longipalpis mi... 46 2.4 1
(EW988082) LJGFM5_H09 Adult female Lutzomyia longipalpis mid... 46 2.4 1
(EW987708) LJGF-L-7_E08 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW987568) LJGF-L-5_D09 Adult female Lutzomyia longipalpis m... 46 2.4 1
(EW987471) LJGF-L-10_C04 Adult female Lutzomyia longipalpis ... 46 2.4 1
(AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 38 2.4 7
(AL953855) Zebrafish DNA sequence from clone CH211-239F4 in ... 40 2.5 6
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 32 3.5 17
(AC145969) Pan troglodytes chromosome UNK clone RP43-12J14, ... 36 3.6 4
(AC116960) Dictyostelium discoideum chromosome 2 map complem... 36 3.7 8
(BX548709) Glossina morsitans morsitans (Tseatse fly) EST fr... 40 4.4 2
(AC232643) Solanum lycopersicum chromosome 7 clone C07HBa001... 40 4.5 4
(AC114263) Dictyostelium discoideum chromosome 2 map 215673-... 44 4.8 5
(AC204732) MACACA MULATTA BAC clone CH250-134C7 from chromos... 40 5.2 2
(AC219803) Bos taurus clone CH240-321C16, WORKING DRAFT SEQU... 40 5.3 5
(AF500705) Mus musculus olfactory receptor GA_x5J8B7W60AJ-92... 32 5.6 3
(AL844501) Plasmodium falciparum strain 3D7, chromosome 1. 34 6.4 12
(BJ407153) Dictyostelium discoideum cDNA clone:dds37k14, 3' ... 42 6.5 2
(FN185033) Glossina morsitans morsitans EST, clone GMreN17d1... 40 6.7 2
(FN185105) Glossina morsitans morsitans EST, clone GMreN17d1... 40 6.8 2
(ER445076) 1092963826306 Global-Ocean-Sampling_GS-35-01-01-1... 36 6.9 2
(AC096579) Homo sapiens BAC clone RP11-601N4 from 2, complet... 34 7.7 5
(AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 32 7.9 12
(CZ957230) 287897 Tomato EcoRI BAC Library Solanum lycopersi... 40 8.1 2
(BX548047) Zebrafish DNA sequence from clone CH211-77G15 in ... 44 9.4 1
(AL929247) Zebrafish DNA sequence from clone CH211-152J7 in ... 44 9.4 1
(AL672127) Mouse DNA sequence from clone RP23-370O18 on chro... 44 9.4 1
(AC124549) Mus musculus BAC clone RP23-284E24 from 13, compl... 44 9.4 1
(AC068907) Mus musculus strain C57BL/6J clone rp23-347f7 map... 44 9.4 1
(AC198796) MACACA MULATTA BAC clone CH250-326I2 from chromos... 44 9.4 1
(AC190275) Rhesus Macaque BAC CH250-162B21 () complete sequ... 44 9.4 1
(AC161127) Pan troglodytes BAC clone CH251-452P2 from chromo... 44 9.4 1
(AC142339) Pan troglodytes BAC clone RP43-42C16 from chromos... 44 9.4 1
(AP007155) Aspergillus oryzae RIB40 genomic DNA, SC003. 44 9.4 1
(AP006643) Lotus japonicus genomic DNA, chromosome 2, clone:... 44 9.4 1
(AM435124) Vitis vinifera contig VV78X107869.6, whole genome... 44 9.4 1
(DD010736) Diagnosis of known genetic Parameters within the ... 44 9.4 1
(CS775624) Sequence 43620 from Patent WO2005083127. 44 9.4 1
(AX344573) Sequence 24 from Patent WO0200932. 44 9.4 1
(GC701568) Sequence 16813 from patent US 6812339. 44 9.4 1
(U40414) Caenorhabditis elegans cosmid F53B3, complete seque... 44 9.4 1
(AJ314911) Dictyostelium discoideum DrnA gene for putative R... 44 9.4 1
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 44 9.4 1
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 44 9.4 1
(AL161650) Human DNA sequence from clone RP11-421O21 on chro... 44 9.4 1
(AC105342) Homo sapiens BAC clone RP11-279I15 from 2, comple... 44 9.4 1
(AC068721) Homo sapiens BAC clone RP11-545L5 from 4, complet... 44 9.4 1
(AC046185) Homo sapiens chromosome 17, clone RP11-51F16, com... 44 9.4 1
(AC021518) Homo sapiens chromosome 8, clone RP11-313D2, comp... 44 9.4 1
(AC016734) Homo sapiens BAC clone RP11-391A7 from 2, complet... 44 9.4 1
(AC013492) Homo sapiens chromosome , clone RP11-32K4, comple... 44 9.4 1
(AC012535) Homo sapiens chromosome 8, clone RP11-115G12, com... 44 9.4 1
(AC011890) Homo sapiens PAC clone RP4-655L22 from Xq23, comp... 44 9.4 1
(AC002069) Homo sapiens BAC clone CTA-326K9 from 7, complete... 44 9.4 1
(AC156517) Bos taurus clone CH240-55P23, WORKING DRAFT SEQUE... 44 9.4 1
(AC153232) Bos taurus clone CH240-31B15, WORKING DRAFT SEQUE... 44 9.4 1
(CU915335) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 9.4 1
(CU914200) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 9.4 1
(CU672267) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 44 9.4 1
(CU582960) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 9.4 1
(CU467804) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 9.4 1
(BX294172) Human DNA sequence *** SEQUENCING IN PROGRESS ***... 44 9.4 1
(AL445234) Human DNA sequence *** SEQUENCING CANCELLED *** f... 44 9.4 1
(AC231279) Pongo abelii chromosome UNKNOWN clone CH276-500M2... 44 9.4 1
(AC225736) Saimiri boliviensis boliviensis clone CH254-15A4,... 44 9.4 1
(AC222281) Bos taurus clone CH240-414D1, WORKING DRAFT SEQUE... 44 9.4 1
(AC208963) Nomascus leucogenys chromosome UNK clone CH271-2H... 44 9.4 1
(AC208753) Chlorocebus aethiops clone CH252-139P18, WORKING ... 44 9.4 1
(AC200361) Chlorocebus aethiops clone CH252-298J8, WORKING D... 44 9.4 1
(AC200355) Macaca mulatta clone CH250-195B11, WORKING DRAFT ... 44 9.4 1
(AC188921) Callicebus moloch clone LB5-262H2, WORKING DRAFT ... 44 9.4 1
(AC169998) Bos taurus clone CH240-261K23, WORKING DRAFT SEQU... 44 9.4 1
(AC169144) Papio anubis clone RP41-340N23, WORKING DRAFT SEQ... 44 9.4 1
(AC166853) Chlorocebus aethiops clone CH252-526E16, WORKING ... 44 9.4 1
(AC163228) Bos taurus clone CH240-137B23, WORKING DRAFT SEQU... 44 9.4 1
(AC021009) Homo sapiens clone RP11-279H15, WORKING DRAFT SEQ... 44 9.4 1
(AC018571) Homo sapiens chromosome 17 clone RP11-47C2 map 17... 44 9.4 1
(AC009195) Homo sapiens chromosome 9 clone RP11-331K1 map 9,... 44 9.4 1
(AQ691851) HS_5385_A1_H04_MR RPCI-11 Human Male BAC Library ... 44 9.4 1
(FI319672) AdH1158-CPY2-F3TR AdH1 Arachis duranensis genomic... 44 9.4 1
(FI287210) AdH1010-CPY2-A19TF AdH1 Arachis duranensis genomi... 44 9.4 1
(FH684520) CHO_OF5073xc11r1.ab1 CHO_OF5 Nicotiana tabacum ge... 44 9.4 1
(ER863441) PPTB161TF Solanum tuberosum RHPOTKEY BAC ends Sol... 44 9.4 1
(ER798548) PPTD293TF Solanum tuberosum RHPOTKEY BAC ends Sol... 44 9.4 1
(ER525465) 1093015632024 Global-Ocean-Sampling_GS-35-01-01-1... 44 9.4 1
(EK385623) 1095469481630 Global-Ocean-Sampling_GS-31-01-01-1... 44 9.4 1
(EK260042) 1095462116903 Global-Ocean-Sampling_GS-31-01-01-1... 44 9.4 1
(EK212306) 1095460103114 Global-Ocean-Sampling_GS-31-01-01-1... 44 9.4 1
(EK111423) 1092963115246 Global-Ocean-Sampling_GS-31-01-01-1... 44 9.4 1
(EK027914) 1092955383149 Global-Ocean-Sampling_GS-31-01-01-1... 44 9.4 1
(EK024168) 1092955354157 Global-Ocean-Sampling_GS-31-01-01-1... 44 9.4 1
(EJ899321) 1093018482420 Global-Ocean-Sampling_GS-30-02-01-1... 44 9.4 1
(EJ884185) 1093018409364 Global-Ocean-Sampling_GS-30-02-01-1... 44 9.4 1
(EJ791354) 1093017379295 Global-Ocean-Sampling_GS-30-02-01-1... 44 9.4 1
(DX533889) GH_MBb0050B07f GH_MBb Gossypium hirsutum genomic ... 44 9.4 1
(DX186188) OR_ABa0050C23.r OR_ABa Oryza ridleyi genomic clon... 44 9.4 1
(DE627500) Bombyx mori genomic DNA, Fosmid clone:GBMFno369_o... 44 9.4 1
(DE180918) Bombyx mori genomic DNA, Fosmid clone:RO0334-B02_F. 44 9.4 1
(DE180008) Bombyx mori genomic DNA, Fosmid clone:RO0332-L08_F. 44 9.4 1
(AG646518) Macaca fuscata fuscata DNA, clone: MSB2-058J03_F,... 44 9.4 1
(BX157584) Danio rerio genomic clone DKEY-146J22, genomic su... 44 9.4 1
(DW478300) GH_RMIRS_013_D11_089_F Cotton Normalized Library ... 44 9.4 1
(DT664123) He_wd2a1_31G12_M13R Heliconius erato wing disk 2 ... 44 9.4 1
(AU268024) Dictyostelium discoideum vegetative cDNA clone:VS... 44 9.4 1
(AU265260) Dictyostelium discoideum vegetative cDNA clone:VS... 44 9.4 1
(AU265259) Dictyostelium discoideum vegetative cDNA clone:VS... 44 9.4 1
(CV689748) sjs6-001_A06_sjs6-001A06-T3 SJS Schistosoma japon... 44 9.4 1
(CT863221) Oryza sativa Indica Group EST sequence:CONTIG5220. 44 9.4 1
(CT751978) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(CT749667) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(CT747311) Paramecium tetraurelia 3-PRIME EST from clone LK0... 44 9.4 1
(CT746392) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(CT746061) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(CT745576) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(CT743232) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(CT742404) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(CT742288) Paramecium tetraurelia 5-PRIME EST from clone LK0... 44 9.4 1
(BW597906) Lotus japonicus cDNA, clone: LjCa-012-CE12, 5' en... 44 9.4 1
(BW307716) Ciona intestinalis cDNA, clone:ciht017j04, 5' end... 44 9.4 1
(BU772498) SJEEQF07 SJE Schistosoma japonicum cDNA, mRNA seq... 44 9.4 1
(BU768110) SJEBGD04 SJE Schistosoma japonicum cDNA, mRNA seq... 44 9.4 1
(BJ771527) Caenorhabditis elegans cDNA clone:yk1718h09 : 5' ... 44 9.4 1
(BJ756429) Caenorhabditis elegans cDNA clone:yk1489h05 : 5' ... 44 9.4 1
(BJ360576) Dictyostelium discoideum cDNA clone:ddc6f23, 5' e... 44 9.4 1
(BJ329631) Dictyostelium discoideum cDNA clone:dda25a20, 5' ... 44 9.4 1
(BJ326834) Dictyostelium discoideum cDNA clone:dda18o01, 5' ... 44 9.4 1
(BJ324484) Dictyostelium discoideum cDNA clone:dda6d15, 5' e... 44 9.4 1
(BJ324275) Dictyostelium discoideum cDNA clone:dda5f17, 5' e... 44 9.4 1
(EW991713) LJGD-L9_A01 Adult female Lutzomyia longipalpis mi... 44 9.4 1
(CP001157) Azotobacter vinelandii DJ, complete genome. 44 9.4 1
(CP000721) Clostridium beijerinckii NCIMB 8052, complete gen... 44 9.4 1
(BX950229) Methanococcus maripaludis strain S2, complete seq... 44 9.4 1
(FI303803) AdH1191-CPY2-I14TR AdH1 Arachis duranensis genomi... 34 9.7 3
(AC004141) Homo sapiens PAC clone RP5-1110N13 from 7, comple... 42 9.9 2
(AC140407) Mus musculus BAC clone RP23-142K9 from chromosome... 38 9.9 4
>(AC115613) Dictyostelium discoideum chromosome 2 map 209116-215573
strain AX4, complete sequence.
Length = 6457
Score = 930 bits (469), Expect(5) = 0.0
Identities = 471/472 (99%)
Strand = Plus / Plus
Query: 206 tttatcatcattatttccagaangattaagtgttggtatggaacttagagacaaggttgt 265
|||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||
Sbjct: 3197 tttatcatcattatttccagaaagattaagtgttggtatggaacttagagacaaggttgt 3256
Query: 266 acaatatgttgaggaacgtattgataaattacgtgagaaacatgttggtcaatttcaaaa 325
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3257 acaatatgttgaggaacgtattgataaattacgtgagaaacatgttggtcaatttcaaaa 3316
Query: 326 tatcagtgtcattagaaccaatgcaatgaaatatttaccaaactattttgaaaaaggtca 385
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3317 tatcagtgtcattagaaccaatgcaatgaaatatttaccaaactattttgaaaaaggtca 3376
Query: 386 attacaaaagatatttttcctttttccagacccacattttaaaaaagcaacacataaacg 445
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3377 attacaaaagatatttttcctttttccagacccacattttaaaaaagcaacacataaacg 3436
Query: 446 tcgtatcatttcaccaacattactctctgaatatgcatacattttggcaccaggtgccta 505
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3437 tcgtatcatttcaccaacattactctctgaatatgcatacattttggcaccaggtgccta 3496
Query: 506 tgcatactttattagtgacgttgaagaactttatctctggatgtttgaacatttcaaaaa 565
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3497 tgcatactttattagtgacgttgaagaactttatctctggatgtttgaacatttcaaaaa 3556
Query: 566 tcatccactctttgaacaagttgaaagagatatcgctgaaaatgattcttgtattccttt 625
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3557 tcatccactctttgaacaagttgaaagagatatcgctgaaaatgattcttgtattccttt 3616
Query: 626 aattgtaaattcaactgaagaaggtagaaaagtcaatcgtatcgatggtaaa 677
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3617 aattgtaaattcaactgaagaaggtagaaaagtcaatcgtatcgatggtaaa 3668
Score = 194 bits (98), Expect(5) = 0.0
Identities = 98/98 (100%)
Strand = Plus / Plus
Query: 730 gatttaacttttaaaaattatactttaacttcaccaaaagaaattgattcaactacaaca 789
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3714 gatttaacttttaaaaattatactttaacttcaccaaaagaaattgattcaactacaaca 3773
Query: 790 actacaacttcaactgccactattactgaagtagaatc 827
||||||||||||||||||||||||||||||||||||||
Sbjct: 3774 actacaacttcaactgccactattactgaagtagaatc 3811
Score = 117 bits (59), Expect(5) = 0.0
Identities = 59/59 (100%)
Strand = Plus / Plus
Query: 95 tccaactggaccagaatcatatgattggacaaagaattatccacaacaagcaatgaatg 153
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3083 tccaactggaccagaatcatatgattggacaaagaattatccacaacaagcaatgaatg 3141
Score = 91.7 bits (46), Expect(5) = 0.0
Identities = 46/46 (100%)
Strand = Plus / Plus
Query: 677 atggtaaaaaatggtttgccgtttttagacgtataaccgatccttc 722
||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3661 atggtaaaaaatggtttgccgtttttagacgtataaccgatccttc 3706
Score = 89.7 bits (45), Expect(5) = 0.0
Identities = 45/45 (100%)
Strand = Plus / Plus
Query: 162 gttgaaattgcagatgttggatgcggatatggtggattattaatt 206
|||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3150 gttgaaattgcagatgttggatgcggatatggtggattattaatt 3194
Score = 131 bits (66), Expect(2) = 9e-30
Identities = 66/66 (100%)
Strand = Plus / Plus
Query: 29 ggcaattaagccatatcatagaattaaagcacatgcaaatccagcatcagattataactt 88
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 2912 ggcaattaagccatatcatagaattaaagcacatgcaaatccagcatcagattataactt 2971
Query: 89 ttatta 94
||||||
Sbjct: 2972 ttatta 2977
Score = 32.2 bits (16), Expect(2) = 9e-30
Identities = 16/16 (100%)
Strand = Plus / Plus
Query: 1 atcaaaaacaagaacc 16
||||||||||||||||
Sbjct: 2884 atcaaaaacaagaacc 2899
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 105743758
Number of Hits to DB: 1,120,474,064
Number of extensions: 72045730
Number of successful extensions: 5827075
Number of sequences better than 10.0: 234
Length of query: 897
Length of database: 104,622,809,269
Length adjustment: 24
Effective length of query: 873
Effective length of database: 102,084,959,077
Effective search space: 89120169274221
Effective search space used: 89120169274221
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 8. 2 |
| Homology vs Protein |
Query= Contig-U05546-1 (Contig-U05546-1Q) /CSM_Contig/Contig-U05546-1Q.Seq.d
(897 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q28H76) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase A;... 251 2e-65
CR761007_1(CR761007|pid:none) Xenopus tropicalis finished cDNA, ... 251 2e-65
(Q6NU94) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 250 4e-65
BT075780_1(BT075780|pid:none) Caligus rogercresseyi clone crog-e... 250 5e-65
BC076665_1(BC076665|pid:none) Xenopus tropicalis methyltransfera... 249 9e-65
(A8NFF0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 244 2e-64
(Q1HPU2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 240 1e-63
(A8WTA7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 240 4e-63
(A6ZXD2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 243 8e-63
(B3LH81) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 243 8e-63
(A3LS77) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 241 1e-62
(Q7Q2P7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 241 2e-62
(Q23126) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 238 6e-62
FM992691_423(FM992691|pid:none) Candida dubliniensis CD36 chromo... 239 9e-62
(Q6FNR1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 238 2e-61
BT079436_1(BT079436|pid:none) Esox lucius clone eluc-evq-525-048... 236 4e-61
(Q5XJ57) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 237 5e-61
(Q8GXB7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 233 7e-60
(Q9Z120) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 231 9e-60
(Q6CY47) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 233 9e-60
(B0WSB8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 232 1e-59
AB463884_1(AB463884|pid:none) Synthetic construct DNA, clone: pF... 230 2e-59
X96698_1(X96698|pid:none) H.sapiens mRNA for D1075-like gene. 230 2e-59
(B4Q1B6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 231 2e-59
(B4R338) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 231 3e-59
(B4I9N7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 231 3e-59
(B4L529) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 230 4e-59
BX908812_29(BX908812|pid:none) Neurospora crassa DNA linkage gro... 228 5e-59
(Q6CE12) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 229 7e-59
(O77263) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 229 1e-58
FN392321_1132(FN392321|pid:none) Pichia pastoris GS115 chromosom... 229 1e-58
(B3MYY4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 229 1e-58
CU928173_416(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 226 6e-58
(B4JLU7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 226 8e-58
(B4N278) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 225 1e-57
CP001574_544(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 225 2e-57
(B6SHG7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 224 2e-57
CU928169_435(CU928169|pid:none) Kluyveromyces thermotolerans str... 224 4e-57
(A6S8E7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 219 2e-56
(Q5H737) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 218 7e-56
(B2AR91) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 217 5e-55
(Q2GS86) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 210 5e-53
EU824100_1(EU824100|pid:none) Populus tremula isolate swl255-64E... 210 5e-53
EU824098_1(EU824098|pid:none) Populus tremula isolate swl255-63E... 210 5e-53
EU824077_1(EU824077|pid:none) Populus tremula isolate swl255-3 S... 210 6e-53
EU824094_1(EU824094|pid:none) Populus tremula isolate swl255-17E... 210 6e-53
(A2Q9E4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 204 3e-51
CP001141_95(CP001141|pid:none) Phaeodactylum tricornutum CCAP 10... 197 4e-49
FN357317_53(FN357317|pid:none) Schistosoma mansoni genome sequen... 191 3e-47
(Q0TZT0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 189 3e-47
(Q2UU72) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 189 4e-47
AM055942_88(AM055942|pid:none) Toxoplasma gondii RH, genomic DNA... 189 1e-46
(Q0CT71) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 186 2e-46
AY813414_1(AY813414|pid:none) Schistosoma japonicum SJCHGC09352 ... 188 2e-46
AM910991_250(AM910991|pid:none) Plasmodium knowlesi strain H chr... 183 6e-45
AE014186_265(AE014186|pid:none) Plasmodium falciparum 3D7 chromo... 174 4e-42
AK340917_1(AK340917|pid:none) Acyrthosiphon pisum ACYPI001906 mR... 157 4e-37
AM920437_542(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 154 3e-36
CP000081_518(CP000081|pid:none) Leishmania major chromosome 35, ... 138 2e-31
AM502253_516(AM502253|pid:none) Leishmania infantum chromosome 35. 137 5e-31
AM494971_518(AM494971|pid:none) Leishmania braziliensis chromoso... 135 2e-30
CP001037_23(CP001037|pid:none) Nostoc punctiforme PCC 73102, com... 84 8e-15
(Q2JJQ0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 83 1e-14
AM778957_276(AM778957|pid:none) Microcystis aeruginosa PCC 7806 ... 79 2e-13
(P72546) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 79 3e-13
CP001291_4055(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 78 5e-13
CP001326_411(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 76 2e-12
(B0JUK5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 75 3e-12
(B1KV69) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 70 1e-10
(A5HZ44) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 70 1e-10
CT978603_2216(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 70 1e-10
(B1IEK9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 70 1e-10
(Q117P8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 68 4e-10
(Q7V4W7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 67 6e-10
CP000572_3045(CP000572|pid:none) Burkholderia pseudomallei 1106a... 64 7e-09
(Q3JPL2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 64 9e-09
CP000570_3013(CP000570|pid:none) Burkholderia pseudomallei 668 c... 64 9e-09
CU466930_761(CU466930|pid:none) Candidatus Cloacamonas acidamino... 63 1e-08
(P73161) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 63 2e-08
(Q474P5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 62 2e-08
(Q0K7S5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 62 2e-08
(Q4L792) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 62 2e-08
AP008212_719(AP008212|pid:none) Oryza sativa (japonica cultivar-... 62 3e-08
(Q0IDB0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 62 3e-08
(Q31CU2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 62 3e-08
(A0K594) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 62 3e-08
(Q62HT7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 62 3e-08
(Q3AMX6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 61 4e-08
(Q897E6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 61 6e-08
(A8G2P9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 61 6e-08
AP009385_753(AP009385|pid:none) Burkholderia multivorans ATCC 17... 60 8e-08
CP000868_2462(CP000868|pid:none) Burkholderia multivorans ATCC 1... 60 8e-08
CP001359_3890(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 60 8e-08
CP001131_3810(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 60 8e-08
CP001281_3873(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 60 1e-07
(B2U7E2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 60 1e-07
CP001071_272(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 60 1e-07
CP001390_1742(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 60 1e-07
AK223202_1(AK223202|pid:none) Homo sapiens mRNA for methyltransf... 60 1e-07
CP001628_1784(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 60 1e-07
CP000958_885(CP000958|pid:none) Burkholderia cenocepacia MC0-3 c... 60 1e-07
AK099631_1(AK099631|pid:none) Oryza sativa Japonica Group cDNA c... 59 2e-07
(P47589) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 59 2e-07
CP001025_799(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 59 2e-07
CP001339_3200(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 59 2e-07
AM746676_785(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ... 59 3e-07
(A2SJR5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 59 3e-07
CP000698_943(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 59 3e-07
(A4JC58) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 59 3e-07
(Q7U9H3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 58 4e-07
CP001656_1280(CP001656|pid:none) Paenibacillus sp. JDR-2, comple... 58 5e-07
CP000975_2258(CP000975|pid:none) Methylacidiphilum infernorum V4... 58 5e-07
CP000813_2595(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 57 6e-07
BT035111_1(BT035111|pid:none) Zea mays full-length cDNA clone ZM... 57 6e-07
(Q7NRJ5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 57 6e-07
(Q0BHL9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 57 8e-07
AB006706_1(AB006706|pid:none) Arabidopsis thaliana genomic DNA, ... 57 1e-06
(Q9JZ24) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 57 1e-06
(B0T162) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 56 1e-06
(A1KUF5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 56 2e-06
CU914168_2313(CU914168|pid:none) Ralstonia solanacearum strain I... 56 2e-06
(A2C073) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 56 2e-06
(Q7V350) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 56 2e-06
(Q2SYE0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 56 2e-06
(Q030M2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 56 2e-06
(Q9JU19) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 2e-06
(A9LZQ8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 2e-06
(A0RJT7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 2e-06
AP009247_860(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 55 3e-06
(Q5F929) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 3e-06
(B7IKW6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 3e-06
(Q8Y6R8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 4e-06
AM295250_1344(AM295250|pid:none) Staphylococcus carnosus subsp. ... 55 4e-06
(Q8YEA9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 4e-06
CP000708_1906(CP000708|pid:none) Brucella ovis ATCC 25840 chromo... 55 4e-06
CP000270_3537(CP000270|pid:none) Burkholderia xenovorans LB400 c... 55 4e-06
CP000896_354(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 55 4e-06
CP000922_441(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 55 4e-06
CP000872_2078(CP000872|pid:none) Brucella canis ATCC 23365 chrom... 55 4e-06
CP001488_2040(CP001488|pid:none) Brucella melitensis ATCC 23457 ... 55 4e-06
(Q8FXT6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 55 4e-06
CP000911_1898(CP000911|pid:none) Brucella suis ATCC 23445 chromo... 55 4e-06
AE017283_1769(AE017283|pid:none) Propionibacterium acnes KPA1712... 54 5e-06
(Q6A6S9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 5e-06
(A0AJ67) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 5e-06
CP001089_2878(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 54 5e-06
(Q7WC23) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 5e-06
(A0Q2J7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 7e-06
(Q97FU9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 7e-06
(Q608G0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 7e-06
(A1TRL2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 7e-06
(Q7VT61) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 7e-06
(Q0AK73) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 9e-06
(A7GTW9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 9e-06
(B7H758) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 9e-06
CP001389_49(CP001389|pid:none) Rhizobium sp. NGR234, complete ge... 54 9e-06
(Q1MMC3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 9e-06
(A3DBL4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 54 9e-06
FJ529692_29(FJ529692|pid:none) Uncultured bacterium 34R1 genomic... 53 1e-05
(A1WZP9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 53 1e-05
CP001103_278(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 53 1e-05
CP000769_3866(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 53 2e-05
CP001154_424(CP001154|pid:none) Laribacter hongkongensis HLHK9, ... 53 2e-05
(Q8F9Q1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 53 2e-05
(Q6G4W3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 53 2e-05
(Q1QS68) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 53 2e-05
AP009152_402(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, c... 53 2e-05
(A9VKK9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 53 2e-05
(B2GDC8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 53 2e-05
(Q2RMS4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 2e-05
CP001104_1975(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 52 2e-05
AM902716_4339(AM902716|pid:none) Bordetella petrii strain DSM 12... 52 2e-05
(Q03QE7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 2e-05
CP001349_5683(CP001349|pid:none) Methylobacterium nodulans ORS 2... 52 2e-05
(Q5FIS5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 2e-05
AL591688_413(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 52 3e-05
(Q9F305) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 3e-05
(B4U1E2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 3e-05
(Q92SI3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 3e-05
(A5N127) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 4e-05
(Q129H3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 52 4e-05
CP000628_503(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 52 4e-05
CP001638_2496(CP001638|pid:none) Geobacillus sp. WCH70, complete... 52 4e-05
BA000012_4298(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 51 5e-05
(Q98BJ3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 51 5e-05
(Q74FT5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 51 5e-05
(B1MZE7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 51 5e-05
(P59719) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 51 5e-05
CP001191_12(CP001191|pid:none) Rhizobium leguminosarum bv. trifo... 51 5e-05
(Q49YH9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 51 5e-05
AP010935_1724(AP010935|pid:none) Streptococcus dysgalactiae subs... 51 5e-05
CP001074_400(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 51 6e-05
(Q8NZU4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 51 6e-05
CP000777_2727(CP000777|pid:none) Leptospira biflexa serovar Pato... 51 6e-05
CP001622_14(CP001622|pid:none) Rhizobium leguminosarum bv. trifo... 50 8e-05
(A3CQ23) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 8e-05
(Q7VDU8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 8e-05
(Q2VYQ1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 8e-05
(B5E261) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(B2IMD9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
CP001615_714(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 50 1e-04
AM285321_79(AM285321|pid:none) Spiroplasma citri GII3-3X chromos... 50 1e-04
(A8Z4H5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(Q65G12) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(A7X3I5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(O34522) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(A6QHT1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(A4QHQ6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(A5ITS0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(B2V2I8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(Q03WU9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 50 1e-04
(A8IG13) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 2e-04
CP000774_3599(CP000774|pid:none) Parvibaculum lavamentivorans DS... 49 2e-04
(Q6G8H9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 2e-04
CP000943_5025(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 49 2e-04
CP001298_3480(CP001298|pid:none) Methylobacterium chloromethanic... 49 2e-04
(B1IA75) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 2e-04
(Q1AUF5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 2e-04
(A1RAI8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 2e-04
CP001277_338(CP001277|pid:none) Candidatus Hamiltonella defensa ... 49 2e-04
(A1VRF7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 2e-04
(A7Z7T3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 3e-04
(A1S8I6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 3e-04
CP001032_878(CP001032|pid:none) Opitutus terrae PB90-1, complete... 49 3e-04
(Q2KD95) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 3e-04
(Q12KQ0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 49 3e-04
CP000613_2903(CP000613|pid:none) Rhodospirillum centenum SW, com... 49 3e-04
CP000472_3523(CP000472|pid:none) Shewanella piezotolerans WP3, c... 48 4e-04
(Q07Z53) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 48 4e-04
AP009380_989(AP009380|pid:none) Porphyromonas gingivalis ATCC 33... 48 4e-04
AM260525_214(AM260525|pid:none) Bartonella tribocorum CIP 105476... 48 4e-04
(P59721) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 48 4e-04
(Q03JA3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 48 4e-04
(A4IRW9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 48 4e-04
CP001091_1434(CP001091|pid:none) Actinobacillus pleuropneumoniae... 48 5e-04
CP000687_1351(CP000687|pid:none) Actinobacillus pleuropneumoniae... 48 5e-04
(Q7UN36) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 48 5e-04
(A4Y8Y5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 7e-04
CP001029_3461(CP001029|pid:none) Methylobacterium populi BJ001, ... 47 7e-04
(Q3SWQ3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 7e-04
(Q8FM11) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 7e-04
AP009493_3900(AP009493|pid:none) Streptomyces griseus subsp. gri... 47 7e-04
CP000847_1200(CP000847|pid:none) Rickettsia akari str. Hartford,... 47 7e-04
CP001100_1069(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 47 7e-04
CP001146_1399(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 47 7e-04
AB290234_2(AB290234|pid:none) Uncultured bacterium clone SuGC21 ... 47 7e-04
(Q0TU06) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 7e-04
(Q1G997) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
(P57616) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
(A8AVP7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
(Q98R44) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
(A1RHL0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
(Q0AJ68) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
(A1BGS9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
(Q5YNA5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 9e-04
CU207211_2549(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 47 0.001
(Q7MVS9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 0.001
(A4VRK4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 47 0.001
(P75256) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
(Q4A6T7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
(Q0I516) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
(A9KXQ5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
(A0K1I7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
(Q5KW28) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
(A1WIH0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
CP000482_2848(CP000482|pid:none) Pelobacter propionicus DSM 2379... 46 0.001
(Q21X81) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
(A0Q7Q5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.001
CP000140_3554(CP000140|pid:none) Parabacteroides distasonis ATCC... 46 0.002
(Q8A0X7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 46 0.002
CP001348_1117(CP001348|pid:none) Clostridium cellulolyticum H10,... 45 0.003
(B0TJD3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.003
(Q9K7U8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.003
AM942444_170(AM942444|pid:none) Corynebacterium urealyticum DSM ... 45 0.003
CP001010_250(CP001010|pid:none) Polynucleobacter necessarius sub... 45 0.003
AY458646_53(AY458646|pid:none) Uncultured marine bacterium 578 c... 45 0.003
CP001391_949(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 45 0.003
(Q15ZS8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.003
(A5IZB9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.003
(Q5X7R0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.003
(A4VXH8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.003
(Q2SRA2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.003
CP000662_711(CP000662|pid:none) Rhodobacter sphaeroides ATCC 170... 45 0.003
CP000766_1327(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 45 0.003
AP008955_4282(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 45 0.003
CP001280_2822(CP001280|pid:none) Methylocella silvestris BL2, co... 45 0.004
AP008957_1086(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 45 0.004
CP001227_887(CP001227|pid:none) Rickettsia peacockii str. Rustic... 45 0.004
(Q5ZY91) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 45 0.004
(Q92G13) RecName: Full=Bifunctional methyltransferase; Includes:... 45 0.004
CU234118_47(CU234118|pid:none) Bradyrhizobium sp. ORS278,complet... 44 0.006
(Q13EL3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.006
(A5VKZ3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.006
CP001562_203(CP001562|pid:none) Bartonella grahamii as4aup, comp... 44 0.006
CP001047_70(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, c... 44 0.006
(A0KUE8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.006
AM181176_5649(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 44 0.006
(Q6AFR0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.006
(Q8K927) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.006
CP001013_1902(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 44 0.006
AP009608_723(AP009608|pid:none) Mycoplasma fermentans PG18 DNA, ... 44 0.006
(Q478Z3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.006
CP001001_4433(CP001001|pid:none) Methylobacterium radiotolerans ... 44 0.007
(B1AIQ8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.007
(Q4UJU4) RecName: Full=Bifunctional methyltransferase; Includes:... 44 0.007
(Q5QY61) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.007
(A1T1J8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.007
(Q4JY06) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.007
(A1TY08) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.007
(Q74I98) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.007
(Q8EBX8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.010
(Q6F1P8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.010
(Q0VLC7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.010
(A8H1J9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 44 0.010
Z95398_20(Z95398|pid:none) Mycobacterium leprae cosmid L622. 43 0.013
(O66479) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 43 0.013
CP000644_766(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 43 0.013
(Q9CCZ9) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 43 0.013
CP001324_627(CP001324|pid:none) Micromonas sp. RCC299 chromosome... 43 0.013
CP000683_925(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 43 0.013
CP001213_433(CP001213|pid:none) Bifidobacterium animalis subsp. ... 43 0.013
(Q5L8Y2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 43 0.016
CR626927_3669(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 43 0.016
(Q73TS5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 43 0.016
(Q89WA4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 43 0.016
(A4XZZ7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 43 0.016
CP000264_707(CP000264|pid:none) Jannaschia sp. CCS1, complete ge... 43 0.016
CP000655_261(CP000655|pid:none) Polynucleobacter necessarius sub... 42 0.022
(Q68VR6) RecName: Full=Bifunctional methyltransferase; Includes:... 42 0.022
(Q9ZCB3) RecName: Full=Bifunctional methyltransferase; Includes:... 42 0.022
(A6VLR7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.022
CP000438_400(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA1... 42 0.028
(A5UGF0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.028
(A7MTN8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.028
AE004091_383(AE004091|pid:none) Pseudomonas aeruginosa PAO1, com... 42 0.028
(A6UYJ1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.028
(A1SNN2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.037
CP001485_131(CP001485|pid:none) Vibrio cholerae MJ-1236 chromoso... 42 0.037
(Q9Z6S3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.037
AM398681_362(AM398681|pid:none) Flavobacterium psychrophilum JIP... 42 0.037
DQ088856_2(DQ088856|pid:none) Uncultured bacterium eBACred22E04 ... 42 0.037
(A5UAE5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.037
(Q21EN2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.037
(A1B475) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 42 0.037
(Q5LLK8) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 41 0.048
(Q1RH40) RecName: Full=Bifunctional methyltransferase; Includes:... 41 0.048
(Q8EP25) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 41 0.048
DQ423208_2(DQ423208|pid:none) Haemophilus influenzae strain 11P6... 41 0.048
AE016827_318(AE016827|pid:none) Mannheimia succiniciproducens MB... 41 0.048
(Q4QNK0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 41 0.048
CP000849_171(CP000849|pid:none) Rickettsia bellii OSU 85-389, co... 41 0.048
CP001600_253(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 41 0.048
(Q4ZM56) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 41 0.063
CP001357_1632(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 41 0.063
(Q2YCZ3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 41 0.063
CP000580_162(CP000580|pid:none) Mycobacterium sp. JLS, complete ... 41 0.063
(A1U992) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 41 0.063
AM999887_1042(AM999887|pid:none) Wolbachia endosymbiont of Culex... 41 0.063
AP011115_5226(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 40 0.082
CP001157_291(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 40 0.082
CP000934_3425(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 40 0.082
(Q2S8L4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.082
(Q11BD3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.082
(B4STS7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.11
(Q88AF5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.11
(A6TMJ6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.11
(A5WAD6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.11
(Q87LI7) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.11
CP001151_663(CP001151|pid:none) Rhodobacter sphaeroides KD131 ch... 40 0.11
(B0KN57) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.11
(Q07V74) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.11
(Q8R6G8) RecName: Full=Bifunctional glycosyltransferase/methyltr... 40 0.14
(Q3IW88) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.14
CR954218_34(CR954218|pid:none) Ostreococcus tauri strain OTTH059... 40 0.14
AM384990_18(AM384990|pid:none) Enterobacter sakazakii clone BAC ... 40 0.14
(A9KLV5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.14
(Q7NBG2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 40 0.14
CP000930_544(CP000930|pid:none) Heliobacterium modesticaldum Ice... 40 0.14
AM889285_1258(AM889285|pid:none) Gluconacetobacter diazotrophicu... 39 0.18
(Q161H1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.18
CP001251_1510(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 39 0.18
(A7MLY2) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.18
CP001196_507(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 39 0.18
(Q48CM0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.24
CP001098_515(CP001098|pid:none) Halothermothrix orenii H 168, co... 39 0.24
(B5ZB79) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.31
(Q6FCN6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.31
CP000521_1276(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 39 0.31
(Q2J2K3) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.31
CP001172_2338(CP001172|pid:none) Acinetobacter baumannii AB307-0... 39 0.31
(A1JPV4) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.31
(Q7MHI6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 39 0.31
AB360762_1(AB360762|pid:none) Tribolium castaneum MT2 mRNA for m... 38 0.41
(A1KF28) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 38 0.41
CP000863_1175(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 38 0.41
(Q3BQ14) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 38 0.41
(Q3ILJ1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 38 0.41
CP000578_281(CP000578|pid:none) Rhodobacter sphaeroides ATCC 170... 38 0.41
CP001291_2571(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 38 0.53
CP000964_705(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 38 0.53
AY966965_1(AY966965|pid:none) Synthetic construct isolate FTT143... 38 0.53
FM211060_22(FM211060|pid:none) Photorhabdus asymbiotica subsp. a... 38 0.53
AE000657_1200(AE000657|pid:none) Aquifex aeolicus VF5, complete ... 37 0.69
(B0U509) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 37 0.69
CP001322_4381(CP001322|pid:none) Desulfatibacillum alkenivorans ... 37 0.69
CP001616_957(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 37 0.69
AY774304_1(AY774304|pid:none) Synthetic construct Francisella tu... 37 0.69
(A8GJ47) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 37 0.69
BC154861_1(BC154861|pid:none) Xenopus tropicalis hypothetical pr... 37 0.70
(B2I9C6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 37 0.91
AB1903(AB1903) hypothetical protein all0772 [imported] - Nostoc ... 37 0.91
CP001654_2980(CP001654|pid:none) Dickeya dadantii Ech703, comple... 37 0.91
(A4TI61) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 37 1.2
AE008384_2332(AE008384|pid:none) Methanosarcina mazei strain Goe... 37 1.2
CP001219_263(CP001219|pid:none) Acidithiobacillus ferrooxidans A... 37 1.2
CP001132_440(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 37 1.2
(A7FEX6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 37 1.2
CP000020_415(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 36 1.5
CP000077_748(CP000077|pid:none) Sulfolobus acidocaldarius DSM 63... 36 1.5
CP000359_48(CP000359|pid:none) Deinococcus geothermalis DSM 1130... 36 1.5
(Q4UXY5) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 36 1.5
CP001132_2476(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 36 1.5
EF672686_3(EF672686|pid:none) Planktothrix agardhii NIVA-CYA 126... 36 1.5
CP000009_842(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 36 1.5
(Q5SHW1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 36 2.0
(Q8EWB6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 36 2.0
(O84836) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 36 2.0
CP001329_284(CP001329|pid:none) Micromonas sp. RCC299 chromosome... 36 2.0
CP000480_244(CP000480|pid:none) Mycobacterium smegmatis str. MC2... 36 2.0
CP000806_2989(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 36 2.0
AE001273_848(AE001273|pid:none) Chlamydia trachomatis D/UW-3/CX,... 36 2.0
AP009240_3229(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 36 2.0
(Q3KKL0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 36 2.0
AM477077_1(AM477077|pid:none) Vitis vinifera contig VV78X217549.... 35 2.6
FM954972_2552(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 35 2.6
AE014296_3308(AE014296|pid:none) Drosophila melanogaster chromos... 35 2.6
CP000886_3762(CP000886|pid:none) Salmonella enterica subsp. ente... 35 2.6
(Q2NRB6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 35 2.6
AB426060_10(AB426060|pid:none) Escherichia coli O111:H- DNA, gen... 35 2.6
CU928164_3363(CU928164|pid:none) Escherichia coli IAI39 chromoso... 35 3.4
CP001615_2475(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 35 3.4
CP001504_1717(CP001504|pid:none) Burkholderia glumae BGR1 chromo... 35 3.4
(Q6MBP0) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 35 3.4
CR380956_419(CR380956|pid:none) Candida glabrata strain CBS138 c... 35 4.5
(Q0TDP1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 35 4.5
AE014133_1057(AE014133|pid:none) Streptococcus mutans UA159, com... 35 4.5
CP000553_1634(CP000553|pid:none) Prochlorococcus marinus str. NA... 35 4.5
AM910987_245(AM910987|pid:none) Plasmodium knowlesi strain H chr... 35 4.5
EU603720_4(EU603720|pid:none) Planktothrix rubescens genomic seq... 35 4.5
(A7ZR85) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 34 5.9
AE005174_3857(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 34 5.9
FM180568_3213(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 34 5.9
(A1AFE6) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 34 5.9
BA000045_3478(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 34 5.9
(Q32C29) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 34 5.9
CR936503_44(CR936503|pid:none) Lactobacillus sakei strain 23K co... 34 5.9
M59471_1(M59471|pid:none) E.coli A/G-specific adenine glycosylas... 34 5.9
CP000857_3066(CP000857|pid:none) Salmonella enterica subsp. ente... 34 5.9
CP000853_2094(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 34 5.9
(Q8Z3U1) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; ... 34 5.9
AE004439_374(AE004439|pid:none) Pasteurella multocida subsp. mul... 34 7.7
CP000094_4937(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 34 7.7
AM933173_2898(AM933173|pid:none) Salmonella enterica subsp. ente... 34 7.7
AL844509_296(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 34 7.7
>(Q28H76) RecName: Full=tRNA (guanine-N(7)-)-methyltransferase A;
EC=2.1.1.33; AltName:
Full=tRNA(m7G46)-methyltransferase A; AltName:
Full=Methyltransferase-like protein 1 A;
Length = 273
Score = 251 bits (641), Expect = 2e-65
Identities = 122/232 (52%), Positives = 159/232 (68%), Gaps = 19/232 (8%)
Frame = +3
Query: 36 KPYHRIKAHANPASDYNFYYPTGPESYDWTKNYP------------------QQAMNEKK 161
K Y+R +AH+NP +D+ F YP PE DW++ YP Q+ + +
Sbjct: 20 KRYYRQRAHSNPMADHTFQYPVKPEIMDWSEYYPDYFKPLVPDSAHDDAKDLQERKEQHQ 79
Query: 162 VEIADVGCGYGGLLI-LSSLFPEXLSVGMELRDKVVQYVEERIDKLREKHVGQFQNISVI 338
VE AD+GCGYGGLL+ LS LFP L +G+E+R KV YV++RI LR H+GQ+QNI+ I
Sbjct: 80 VEFADIGCGYGGLLVELSPLFPNTLMLGLEIRVKVSDYVQDRIKSLRASHLGQYQNIACI 139
Query: 339 RTNAMKYLPNYFEKGQLQKIFFLFPDPHFKKATHKRRIISPTLLSEYAYILAPGAYAYFI 518
R+NAMKY+PN+F+KGQL K+FFLFPDPHFKK HK RIISPTLL+EYAY+L G Y I
Sbjct: 140 RSNAMKYIPNFFKKGQLSKMFFLFPDPHFKKTKHKWRIISPTLLAEYAYVLRIGGMVYTI 199
Query: 519 SDVEELYLWMFEHFKNHPLFEQVERDIAENDSCIPLIVNSTEEGRKVNRIDG 674
+DVEE++ WM +HF HPLFE+V ++ ND + + STEEG+KV R G
Sbjct: 200 TDVEEVHTWMVKHFTEHPLFERVAKEELVNDIVVGKLGTSTEEGKKVQRNKG 251
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,219,436,430
Number of extensions: 23592869
Number of successful extensions: 71559
Number of sequences better than 10.0: 464
Number of HSP's gapped: 71347
Number of HSP's successfully gapped: 485
Length of query: 299
Length of database: 1,061,185,681
Length adjustment: 128
Effective length of query: 171
Effective length of database: 642,824,337
Effective search space: 109922961627
Effective search space used: 109922961627
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
1 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |