NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U05364-1
Contig ID Contig-U05364-1
Contig update 2001. 8.29
Contig sequence 
>Contig-U05364-1 (Contig-U05364-1Q) /CSM_Contig/Contig-U05364-1Q.Seq.d
AATAGAAGAGATTGACACTGATGAAACATTCACATCAGATTATGTGAGTG
CTAGAAAAGATGAAGTTGATGATATTATAACAGCAACTACAATTGCACAA
AAAAAAATGGAGAATTCAATTTTGGAAAAATTAAATTCAACTGAAAATGG
TAATATAATTGAAAAAAAAAAGATATTAAATTTTTTAATGAATGGTATTG
AAAAAATACCAATGTCACATCAAGGTTTAGATTCAAGTAAAGTTTGGATA
TCATTTTGGATATTGAATGGTATGGATATGTTGGATAGTTTAGATAGTTA
TCCA
Gap no gap
Contig length 304
Chromosome number (1..6, M) 1
Chromosome length 4919822
Start point 3556434
End point 3556707
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 1
Link to clone list U05364
List of clone(s) 

est1=SSH530F,1,305
Translated Amino Acid sequence 
IEEIDTDETFTSDYVSARKDEVDDIITATTIAQKKMENSILEKLNSTENGNIIEKKKILN
FLMNGIEKIPMSHQGLDSSKVWISFWILNGMDMLDSLDSYP
Translated Amino Acid sequence (All Frames) 
Frame A:
nrrd*h**nihirlcec*kr*s**yynsnynctkkngefnfgkikfn*kw*yn*kkkdik
ffnewy*kntnvtsrfrfk*sldiildiewygyvg*fr*ls


Frame B:
IEEIDTDETFTSDYVSARKDEVDDIITATTIAQKKMENSILEKLNSTENGNIIEKKKILN
FLMNGIEKIPMSHQGLDSSKVWISFWILNGMDMLDSLDSYP


Frame C:
*krltlmkhshqim*vlekmklmil*qqlqlhkkkwriqfwkn*iqlkmvi*lkkkry*i
f**mvlkkyqchikv*iqvkfgyhfgy*mvwicwiv*ivi
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U05364-1 (Contig-U05364-1Q)
/CSM_Contig/Contig-U05364-1Q.Seq.d
         (304 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U05364-1 (Contig-U05364-1Q) /CSM_Contig/Conti...   490  e-139
Contig-U13820-1 (Contig-U13820-1Q) /CSM_Contig/Conti...    36  0.021
Contig-U10832-1 (Contig-U10832-1Q) /CSM_Contig/Conti...    36  0.021
Contig-U09294-1 (Contig-U09294-1Q) /CSM_Contig/Conti...    36  0.021
Contig-U08875-1 (Contig-U08875-1Q) /CSM_Contig/Conti...    36  0.021
Contig-U04626-1 (Contig-U04626-1Q) /CSM_Contig/Conti...    36  0.021
Contig-U13879-1 (Contig-U13879-1Q) /CSM_Contig/Conti...    34  0.082
Contig-U10784-1 (Contig-U10784-1Q) /CSM_Contig/Conti...    34  0.082
Contig-U06961-1 (Contig-U06961-1Q) /CSM_Contig/Conti...    34  0.082
Contig-U06377-1 (Contig-U06377-1Q) /CSM_Contig/Conti...    34  0.082

>Contig-U05364-1 (Contig-U05364-1Q) /CSM_Contig/Contig-U05364-1Q.Seq.d
          Length = 304

 Score =  490 bits (247), Expect = e-139
 Identities = 285/304 (93%)
 Strand = Plus / Plus

                                                                       
Query: 1   aatagaagagattgacactgatgaaacattcacatcagattatgtgagtgctagaaaaga 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   aatagaagagattgacactgatgaaacattcacatcagattatgtgagtgctagaaaaga 60

                                                                       
Query: 61  tgaagttgatgatattataacagcaactacaattgcacnnnnnnnnntggagaattcaat 120
           ||||||||||||||||||||||||||||||||||||||         |||||||||||||
Sbjct: 61  tgaagttgatgatattataacagcaactacaattgcacaaaaaaaaatggagaattcaat 120

                                                                       
Query: 121 tttggaaaaattaaattcaactgaaaatggtaatataattgnnnnnnnnnngatattaaa 180
           |||||||||||||||||||||||||||||||||||||||||          |||||||||
Sbjct: 121 tttggaaaaattaaattcaactgaaaatggtaatataattgaaaaaaaaaagatattaaa 180

                                                                       
Query: 181 ttttttaatgaatggtattgaaaaaataccaatgtcacatcaaggtttagattcaagtaa 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ttttttaatgaatggtattgaaaaaataccaatgtcacatcaaggtttagattcaagtaa 240

                                                                       
Query: 241 agtttggatatcattttggatattgaatggtatggatatgttggatagtttagatagtta 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 agtttggatatcattttggatattgaatggtatggatatgttggatagtttagatagtta 300

               
Query: 301 tcca 304
           ||||
Sbjct: 301 tcca 304


>Contig-U13820-1 (Contig-U13820-1Q) /CSM_Contig/Contig-U13820-1Q.Seq.d
          Length = 535

 Score = 36.2 bits (18), Expect = 0.021
 Identities = 21/22 (95%)
 Strand = Plus / Plus

                                 
Query: 127 aaaattaaattcaactgaaaat 148
           ||||||||||| ||||||||||
Sbjct: 170 aaaattaaatttaactgaaaat 191


>Contig-U10832-1 (Contig-U10832-1Q) /CSM_Contig/Contig-U10832-1Q.Seq.d
          Length = 1848

 Score = 36.2 bits (18), Expect = 0.021
 Identities = 18/18 (100%)
 Strand = Plus / Plus

                              
Query: 114  attcaattttggaaaaat 131
            ||||||||||||||||||
Sbjct: 1004 attcaattttggaaaaat 1021


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 5645
Number of Sequences: 6905
Number of extensions: 5645
Number of successful extensions: 1799
Number of sequences better than 10.0: 232
length of query: 304
length of database: 5,674,871
effective HSP length: 15
effective length of query: 289
effective length of database: 5,571,296
effective search space: 1610104544
effective search space used: 1610104544
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2009. 7.19
Homology vs DNA 
Query= Contig-U05364-1 (Contig-U05364-1Q) /CSM_Contig/Contig-U05364-1Q.Seq.d
         (304 letters)

Database: ddbj_B
           105,743,758 sequences; 104,622,809,269 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU073552) Dictyostelium discoideum slug cDNA, clone SSH530.      194   8e-80  2
(CP000361) Arcobacter butzleri RM4018, complete genome.            48   0.19   1
(EK426512) 1095516034871 Global-Ocean-Sampling_GS-31-01-01-1...    46   0.77   1
(EK182843) 1095458130767 Global-Ocean-Sampling_GS-31-01-01-1...    46   0.77   1
(EJ727055) 1092959537767 Global-Ocean-Sampling_GS-30-02-01-1...    46   0.77   1
(EJ688463) 1092955225427 Global-Ocean-Sampling_GS-30-02-01-1...    46   0.77   1
(EJ677331) 1092955094284 Global-Ocean-Sampling_GS-30-02-01-1...    46   0.77   1
(EJ570088) 1092960030900 Global-Ocean-Sampling_GS-29-01-01-1...    46   0.77   1
(EJ020184) 1095448001455 Global-Ocean-Sampling_GS-26-01-01-1...    34   2.8    2
(DQ127571) Emiliania huxleyi virus 163 clone new246.seq part...    44   3.0    1
(AJ890364) Emiliania huxleyi virus 86 isolate EhV86.               44   3.0    1
(AC140547) Medicago truncatula clone mth2-17p16, complete se...    44   3.0    1
(AX344580) Sequence 5 from Patent WO0200927.                       44   3.0    1
(AC053544) Homo sapiens BAC clone RP11-793B9 from 4, complet...    44   3.0    1
(AC093287) Homo sapiens chromosome 5 clone RP11-459N10, WORK...    44   3.0    1
(EI170447) DH042N09_R1.ab1 Brachypodium distachyon Bd21 Hind...    44   3.0    1
(AE017194) Bacillus cereus ATCC 10987, complete genome.            44   3.0    1
(BZ935861) CH240_85L12.TJ CHORI-240 Bos taurus genomic clone...    36   7.5    2
(AC123379) Rattus norvegicus clone CH230-288C16, WORKING DRA...    40   8.7    2
(AC156881) Bos taurus clone CH240-54P19, WORKING DRAFT SEQUE...    40   9.4    2
(AF215845) Homo sapiens chromosome 8 clone CTD-2542N7 map q1...    42   9.4    2

>(AU073552) Dictyostelium discoideum slug cDNA, clone SSH530.
          Length = 240

 Score =  194 bits (98), Expect(2) = 8e-80
 Identities = 98/98 (100%)
 Strand = Plus / Plus


Query: 1  aatagaagagattgacactgatgaaacattcacatcagattatgtgagtgctagaaaaga 60
          ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1  aatagaagagattgacactgatgaaacattcacatcagattatgtgagtgctagaaaaga 60


Query: 61 tgaagttgatgatattataacagcaactacaattgcac 98
          ||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tgaagttgatgatattataacagcaactacaattgcac 98

 Score =  137 bits (69), Expect(2) = 8e-80
 Identities = 69/69 (100%)
 Strand = Plus / Plus


Query: 172 gatattaaattttttaatgaatggtattgaaaaaataccaatgtcacatcaaggtttaga 231
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 172 gatattaaattttttaatgaatggtattgaaaaaataccaatgtcacatcaaggtttaga 231


Query: 232 ttcaagtaa 240
           |||||||||
Sbjct: 232 ttcaagtaa 240

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 105743758
Number of Hits to DB: 311,713,417
Number of extensions: 19156384
Number of successful extensions: 1601715
Number of sequences better than 10.0: 21
Length of query: 304
Length of database: 104,622,809,269
Length adjustment: 23
Effective length of query: 281
Effective length of database: 102,190,702,835
Effective search space: 28715587496635
Effective search space used: 28715587496635
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 8. 1
Homology vs Protein 
Query= Contig-U05364-1 (Contig-U05364-1Q) /CSM_Contig/Contig-U05364-1Q.Seq.d
         (304 letters)

Database: nrp_A
           3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q55D51) RecName: Full=Protein farnesyltransferase subunit beta;...   202   2e-51
(Q8K2I1) RecName: Full=Protein farnesyltransferase subunit beta;...    51   1e-05
(Q02293) RecName: Full=Protein farnesyltransferase subunit beta;...    51   1e-05
BT021758_1(BT021758|pid:none) Bos taurus farnesyltransferase, CA...    51   1e-05
BT079562_1(BT079562|pid:none) Esox lucius clone eluc-evq-513-129...    47   2e-04
AK296850_1(AK296850|pid:none) Homo sapiens cDNA FLJ59570 complet...    44   0.002
AK303739_1(AK303739|pid:none) Homo sapiens cDNA FLJ58825 complet...    42   0.009
AL928866_1(AL928866|pid:none) Zebrafish DNA sequence from clone ...    41   0.015
CR380958_307(CR380958|pid:none) Candida glabrata strain CBS138 c...    41   0.015
(O13782) RecName: Full=Protein farnesyltransferase subunit beta;...    40   0.034
FJ429092_16(FJ429092|pid:none) Architeuthis dux isolate 5-32 mit...    39   0.074
BC111924_1(BC111924|pid:none) Synthetic construct Homo sapiens c...    38   0.099
AY780790_1(AY780790|pid:none) Homo sapiens geranylgeranyltransfe...    38   0.099
(Q5EAD5) RecName: Full=Geranylgeranyl transferase type-1 subunit...    37   0.17
BC141021_1(BC141021|pid:none) Mus musculus protein geranylgerany...    37   0.17
AY815896_1(AY815896|pid:none) Schistosoma japonicum SJCHGC09483 ...    37   0.17
(P53610) RecName: Full=Geranylgeranyl transferase type-1 subunit...    37   0.17
AM429924_2(AM429924|pid:none) Vitis vinifera contig VV78X254909....    37   0.17
AM270080_24(AM270080|pid:none) Aspergillus niger contig An04c019...    37   0.17
(Q8BUY9) RecName: Full=Geranylgeranyl transferase type-1 subunit...    37   0.17
FJ603522_1(FJ603522|pid:none) Enteroctopus dofleini cytochrome b...    37   0.21
DQ087276_1(DQ087276|pid:none) Aedes pseudoscutellaris reovirus s...    37   0.22
(Q38920) RecName: Full=Protein farnesyltransferase subunit beta;...    37   0.22
AB240156_11(AB240156|pid:none) Octopus ocellatus mitochondrial D...    37   0.28
FJ603526_1(FJ603526|pid:none) Benthoctopus normani clone 14323no...    37   0.28
EF598362_1(EF598362|pid:none) Arabidopsis thaliana isolate CS675...    37   0.29
EU148465_1(EU148465|pid:none) Thaumeledone gunteri cytochrome b ...    36   0.37
AJ628174_1(AJ628174|pid:none) Hapalochlaena fasciata mitochondri...    36   0.37
AJ628176_1(AJ628176|pid:none) Hapalochlaena maculosa mitochondri...    36   0.37
FJ603518_1(FJ603518|pid:none) Benthoctopus oregonensis clone 162...    36   0.37
AM910990_132(AM910990|pid:none) Plasmodium knowlesi strain H chr...    36   0.48
EU148461_1(EU148461|pid:none) Thaumeledone peninsulae voucher US...    36   0.48
EU148463_1(EU148463|pid:none) Thaumeledone peninsulae voucher NM...    36   0.48
EU148462_1(EU148462|pid:none) Thaumeledone peninsulae voucher US...    36   0.48
FJ603527_1(FJ603527|pid:none) Benthoctopus rigbyae clone 207AP c...    36   0.48
AK073299_1(AK073299|pid:none) Oryza sativa Japonica Group cDNA c...    36   0.49
FJ603525_1(FJ603525|pid:none) Benthoctopus sp. B JMS-2009 clone ...    35   0.62
EU148457_1(EU148457|pid:none) Adelieledone polymorpha voucher NM...    35   0.62
EU148459_1(EU148459|pid:none) Thaumeledone rotunda voucher USNM1...    35   0.62
AJ628188_1(AJ628188|pid:none) Octopus graptus mitochondrial part...    35   0.82
AJ628171_1(AJ628171|pid:none) Ameloctopus litoralis mitochondria...    35   0.82
FJ603517_1(FJ603517|pid:none) Benthoctopus johnsonianus clone 14...    35   0.82
AJ628199_1(AJ628199|pid:none) Octopus pallidus mitochondrial par...    35   0.82
T07605(T07605) protein farnesyltransferase (EC 2.5.1.-) beta cha...    35   0.84
AF461508_1(AF461508|pid:none) Leishmania major strain Friedlin f...    35   0.84
AJ628178_1(AJ628178|pid:none) Octopus aegina mitochondrial parti...    35   1.1
FJ603516_1(FJ603516|pid:none) Benthoctopus eureka clone BeFI1 cy...    35   1.1
AJ628197_1(AJ628197|pid:none) Octopus ocellate sp. A-MG-2004 mit...    35   1.1
AJ628195_1(AJ628195|pid:none) Octopus marginatus mitochondrial p...    35   1.1
AJ628179_1(AJ628179|pid:none) Octopus alpheus mitochondrial part...    34   1.4
EU882066_1(EU882066|pid:none) Dosidicus gigas haplotype A02 cyto...    34   1.4
EU148464_1(EU148464|pid:none) Thaumeledone gunteri voucher NMSZ2...    34   1.4
AJ628183_1(AJ628183|pid:none) Octopus bunurong mitochondrial par...    34   1.4
AJ628170_1(AJ628170|pid:none) Argonauta nodosa mitochondrial par...    34   1.8
AJ628196_1(AJ628196|pid:none) Octopus mototi mitochondrial parti...    34   1.8
EU882080_1(EU882080|pid:none) Dosidicus gigas haplotype A21 cyto...    34   1.8
U73203_1(U73203|pid:none) Nicotiana glutinosa farnesyltransferas...    34   1.9
CP001336_1240(CP001336|pid:none) Desulfitobacterium hafniense DC...    34   1.9
AJ628194_1(AJ628194|pid:none) Octopus maorum mitochondrial parti...    33   2.4
BC097794_1(BC097794|pid:none) Xenopus laevis hypothetical protei...    33   2.4
AJ628190_1(AJ628190|pid:none) Octopus kagoshimensis mitochondria...    33   3.1
GQ225110_3(GQ225110|pid:none) Loligo opalescens isolate 2001 MB-...    33   3.1
AB240154_3(AB240154|pid:none) Sepioteuthis lessoniana mitochondr...    33   3.1
AB266516_12(AB266516|pid:none) Sepia esculenta mitochondrial DNA...    33   3.1
AJ628177_1(AJ628177|pid:none) Octopus aculeatus mitochondrial pa...    33   3.1
EU882069_1(EU882069|pid:none) Dosidicus gigas haplotype A07 cyto...    33   3.1
AJ628198_1(AJ628198|pid:none) Octopus oculifer mitochondrial par...    33   3.1
AB430419_1(AB430419|pid:none) Sepia esculenta mitochondrial Cytb...    33   3.1
AF389849_1(AF389849|pid:none) Catharanthus roseus farnesyltransf...    33   3.2
AJ628182_1(AJ628182|pid:none) Octopus berrima mitochondrial part...    33   4.0
CP001078_820(CP001078|pid:none) Clostridium botulinum E3 str. Al...    33   4.2
AC147008_31(AC147008|pid:none) Medicago truncatula clone mth2-10...    33   4.2
AE014297_2280(AE014297|pid:none) Drosophila melanogaster chromos...    33   4.2
AM920437_1241(AM920437|pid:none) Penicillium chrysogenum Wiscons...    33   4.2
(O47477) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt...    32   5.3
DQ471484_1(DQ471484|pid:none) Drosophila polychaeta NADH dehydro...    32   5.3
AB086202_16(AB086202|pid:none) Watasenia scintillans mitochondri...    32   5.3
EU882082_1(EU882082|pid:none) Dosidicus gigas haplotype A23 cyto...    32   5.3
FJ603520_1(FJ603520|pid:none) Benthoctopus sp. A JMS-2009 clone ...    32   5.3
AB470277_1(AB470277|pid:none) Rossia pacifica mitochondrial cytb...    32   5.3
EU068697_16(EU068697|pid:none) Dosidicus gigas mitochondrion, co...    32   5.3
EU682403_13(EU682403|pid:none) Panonychus ulmi mitochondrion, co...    32   5.3
EU882065_1(EU882065|pid:none) Dosidicus gigas haplotype A01 cyto...    32   5.3
DQ858293_1(DQ858293|pid:none) Triticum aestivum farnesyltransfer...    32   5.5
AC116920_30(AC116920|pid:none) Dictyostelium discoideum chromoso...    32   5.5
CP000672_691(CP000672|pid:none) Haemophilus influenzae PittGG, c...    32   5.5
CP000591_90(CP000591|pid:none) Ostreococcus lucimarinus CCE9901 ...    32   5.5
(P44619) RecName: Full=Transcription termination factor rho;    ...    32   5.5
AE017346_246(AE017346|pid:none) Cryptococcus neoformans var. neo...    32   5.5
CR762084_1(CR762084|pid:none) Xenopus tropicalis finished cDNA, ...    32   5.5
(Q5UQN7) RecName: Full=Probable capsid protein 3;  &AY653733_440...    32   5.5
AJ628200_1(AJ628200|pid:none) Octopus tetricus mitochondrial par...    32   6.9
AB158363_11(AB158363|pid:none) Octopus vulgaris mitochondrial DN...    32   6.9
CP001251_158(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ...    32   7.1
CP001357_384(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ...    32   7.1
AB430430_1(AB430430|pid:none) Sepia pharaonis mitochondrial Cytb...    32   9.0
AB240153_10(AB240153|pid:none) Todarodes pacificus mitochondrial...    32   9.0
AB158364_16(AB158364|pid:none) Todarodes pacificus mitochondrial...    32   9.0
U96430_1(U96430|pid:none) Dennyus wraggi cytochrome b (cytb) gen...    32   9.0
EU882072_1(EU882072|pid:none) Dosidicus gigas haplotype A10 cyto...    32   9.0
AY444742_1(AY444742|pid:none) Aedes albopictus ribonucleotide re...    32   9.3
AF284755_1(AF284755|pid:none) Mus musculus VPS10 domain receptor...    32   9.3
AK030440_1(AK030440|pid:none) Mus musculus adult male pituitary ...    32   9.3
DQ479927_1(DQ479927|pid:none) Mus musculus strain BTBR T+ tf/J S...    32   9.3
(Q9JLC4) RecName: Full=VPS10 domain-containing receptor SorCS1; ...    32   9.3
DQ479927_2(DQ479927|pid:none) Mus musculus strain BTBR T+ tf/J S...    32   9.3
DQ479927_3(DQ479927|pid:none) Mus musculus strain BTBR T+ tf/J S...    32   9.3

>(Q55D51) RecName: Full=Protein farnesyltransferase subunit beta;
                 Short=FTase-beta;          EC=2.5.1.58; AltName:
           Full=CAAX farnesyltransferase subunit beta; AltName:
           Full=Ras proteins prenyltransferase subunit beta;
          Length = 500

 Score =  202 bits (515), Expect = 2e-51
 Identities = 101/101 (100%), Positives = 101/101 (100%)
 Frame = +2

Query: 2   IEEIDTDETFTSDYVSARKDEVDDIITATTIAQKKMENSILEKLNSTENGNIIEKKKILN 181
           IEEIDTDETFTSDYVSARKDEVDDIITATTIAQKKMENSILEKLNSTENGNIIEKKKILN
Sbjct: 4   IEEIDTDETFTSDYVSARKDEVDDIITATTIAQKKMENSILEKLNSTENGNIIEKKKILN 63

Query: 182 FLMNGIEKIPMSHQGLDSSKVWISFWILNGMDMLDSLDSYP 304
           FLMNGIEKIPMSHQGLDSSKVWISFWILNGMDMLDSLDSYP
Sbjct: 64  FLMNGIEKIPMSHQGLDSSKVWISFWILNGMDMLDSLDSYP 104

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 407,361,793
Number of extensions: 7291842
Number of successful extensions: 22797
Number of sequences better than 10.0: 107
Number of HSP's gapped: 22787
Number of HSP's successfully gapped: 107
Length of query: 101
Length of database: 1,061,185,681
Length adjustment: 69
Effective length of query: 32
Effective length of database: 835,662,769
Effective search space: 26741208608
Effective search space used: 26741208608
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 28 (15.4 bits)
PSORT 

 psg: 0.75  gvh: 0.26  alm: 0.45  top: 0.53  tms: 0.00  mit: 0.21  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 48.0 %: nuclear
	 32.0 %: cytoplasmic
	  8.0 %: cytoskeletal
	  4.0 %: vacuolar
	  4.0 %: plasma membrane
	  4.0 %: vesicles of secretory system

>> prediction for Contig-U05364-1 is nuc
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 1
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0