Contig-U05215-1
Contig ID Contig-U05215-1
Contig update 2001. 8.29
Contig sequence
>Contig-U05215-1 (Contig-U05215-1Q) /CSM_Contig/Contig-U05215-1Q.Seq.d
ATGCGAACAATAGTAACAATAATATTAATAACAATAATCCATTTAGTAAT
AATATAATACAACCGATATCACAAATTGAGAACTTTCAATTACCAACCTC
ATTAACCAATGCCTTTGAAGAAGATACCGACAGTGACATGGCATTAGATA
GTGATGATGATTTTGATGACCTTGAAAATTATGACCTAAGTGATGATAAT
GATGATAATGATTACAATAATAATAATAATAATAATAATAGTAATAATAA
TGAAATAAATGATGAAGATTCTGATAGCGATCAAAATAATTATAACAACA
ATTCAAATTCTAAATCAAAATTAAAATTATCAAAATCATCAACTGAACCA
AAAGAAAAGAAACCACCAAATGCTTTCATTTTATTTACAATGGATAAAAG
AAAAGAATTAAGAACAAATAATCCAGAATTAACAAATGCGATGGTTTCGT
CATTACTTGGTAAAGAATGGAAAGAGTTACATCCAAGTGAAAAGAAGAAA
TATGTTGAAAAAGCAGCCACTTTTA

Gap no gap
Contig length 525
Chromosome number (1..6, M) 3
Chromosome length 6358359
Start point 2369735
End point 2370260
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 1
Link to clone list U05215
List of clone(s)

est1=SSG301F,1,526
Translated Amino Acid sequence
ANNSNNNINNNNPFSNNIIQPISQIENFQLPTSLTNAFEEDTDSDMALDSDDDFDDLENY
DLSDDNDDNDYNNNNNNNNSNNNEINDEDSDSDQNNYNNNSNSKSKLKLSKSSTEPKEKK
PPNAFILFTMDKRKELRTNNPELTNAMVSSLLGKEWKELHPSEKKKYVEKAATF


Translated Amino Acid sequence (All Frames)
Frame A:
mrtivtiilitiihlvii*ynryhklrtfnyqph*pmplkkiptvtwh*ivmmilmtlki
mt*vmimmimitiiiiiiiiviimk*mmkiliaikiiittiqilnqn*nyqnhqlnqkkr
nhqmlsfylqwikekn*eqiiqn*qmrwfrhylvkngksyiqvkrrnmlkkqpll


Frame B:
ceq**q*y**q*si***ynttditn*elsitnlinqcl*rryrq*hgir****f**p*kl
*pk*******lq************nk**rf**rsk*l*qqfkf*ikikiikiin*tkrke
ttkcfhfiyng*kkriknk*srinkcdgfvitw*rmervtsk*keeic*ksshf


Frame C:
ANNSNNNINNNNPFSNNIIQPISQIENFQLPTSLTNAFEEDTDSDMALDSDDDFDDLENY
DLSDDNDDNDYNNNNNNNNSNNNEINDEDSDSDQNNYNNNSNSKSKLKLSKSSTEPKEKK
PPNAFILFTMDKRKELRTNNPELTNAMVSSLLGKEWKELHPSEKKKYVEKAATF


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U05215-1 (Contig-U05215-1Q)
/CSM_Contig/Contig-U05215-1Q.Seq.d
(525 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U05215-1 (Contig-U05215-1Q) /CSM_Contig/Conti... 525 e-149
Contig-U11812-1 (Contig-U11812-1Q) /CSM_Contig/Conti... 44 1e-04
Contig-U06386-1 (Contig-U06386-1Q) /CSM_Contig/Conti... 44 1e-04
Contig-U13880-1 (Contig-U13880-1Q) /CSM_Contig/Conti... 42 6e-04
Contig-U04016-1 (Contig-U04016-1Q) /CSM_Contig/Conti... 42 6e-04
Contig-U14772-1 (Contig-U14772-1Q) /CSM_Contig/Conti... 40 0.002
Contig-U09124-1 (Contig-U09124-1Q) /CSM_Contig/Conti... 40 0.002
Contig-U07032-1 (Contig-U07032-1Q) /CSM_Contig/Conti... 40 0.002
Contig-U01741-1 (Contig-U01741-1Q) /CSM_Contig/Conti... 40 0.002
Contig-U12805-1 (Contig-U12805-1Q) /CSM_Contig/Conti... 38 0.009

>Contig-U05215-1 (Contig-U05215-1Q) /CSM_Contig/Contig-U05215-1Q.Seq.d
Length = 525

Score = 525 bits (265), Expect = e-149
Identities = 265/265 (100%)
Strand = Plus / Plus


Query: 261 gatgaagattctgatagcgatcaaaataattataacaacaattcaaattctaaatcaaaa 320
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 261 gatgaagattctgatagcgatcaaaataattataacaacaattcaaattctaaatcaaaa 320


Query: 321 ttaaaattatcaaaatcatcaactgaaccaaaagaaaagaaaccaccaaatgctttcatt 380
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 321 ttaaaattatcaaaatcatcaactgaaccaaaagaaaagaaaccaccaaatgctttcatt 380


Query: 381 ttatttacaatggataaaagaaaagaattaagaacaaataatccagaattaacaaatgcg 440
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 381 ttatttacaatggataaaagaaaagaattaagaacaaataatccagaattaacaaatgcg 440


Query: 441 atggtttcgtcattacttggtaaagaatggaaagagttacatccaagtgaaaagaagaaa 500
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 441 atggtttcgtcattacttggtaaagaatggaaagagttacatccaagtgaaaagaagaaa 500


Query: 501 tatgttgaaaaagcagccactttta 525
|||||||||||||||||||||||||
Sbjct: 501 tatgttgaaaaagcagccactttta 525


Score = 309 bits (156), Expect = 2e-84
Identities = 156/156 (100%)
Strand = Plus / Plus


Query: 60 caaccgatatcacaaattgagaactttcaattaccaacctcattaaccaatgcctttgaa 119
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60 caaccgatatcacaaattgagaactttcaattaccaacctcattaaccaatgcctttgaa 119


Query: 120 gaagataccgacagtgacatggcattagatagtgatgatgattttgatgaccttgaaaat 179
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 120 gaagataccgacagtgacatggcattagatagtgatgatgattttgatgaccttgaaaat 179


Query: 180 tatgacctaagtgatgataatgatgataatgattac 215
||||||||||||||||||||||||||||||||||||
Sbjct: 180 tatgacctaagtgatgataatgatgataatgattac 215


>Contig-U11812-1 (Contig-U11812-1Q) /CSM_Contig/Contig-U11812-1Q.Seq.d
Length = 1354

Score = 44.1 bits (22), Expect = 1e-04
Identities = 22/22 (100%)
Strand = Plus / Plus


Query: 191 tgatgataatgatgataatgat 212
||||||||||||||||||||||
Sbjct: 990 tgatgataatgatgataatgat 1011


Score = 28.2 bits (14), Expect = 8.9
Identities = 14/14 (100%)
Strand = Plus / Plus


Query: 199 atgatgataatgat 212
||||||||||||||
Sbjct: 989 atgatgataatgat 1002


Score = 28.2 bits (14), Expect = 8.9
Identities = 20/22 (90%)
Strand = Plus / Plus


Query: 191 tgatgataatgatgataatgat 212
||||||| || |||||||||||
Sbjct: 762 tgatgatgataatgataatgat 783


>Contig-U06386-1 (Contig-U06386-1Q) /CSM_Contig/Contig-U06386-1Q.Seq.d
Length = 475

Score = 44.1 bits (22), Expect = 1e-04
Identities = 22/22 (100%)
Strand = Plus / Plus


Query: 191 tgatgataatgatgataatgat 212
||||||||||||||||||||||
Sbjct: 17 tgatgataatgatgataatgat 38


Score = 28.2 bits (14), Expect = 8.9
Identities = 14/14 (100%)
Strand = Plus / Plus


Query: 199 atgatgataatgat 212
||||||||||||||
Sbjct: 16 atgatgataatgat 29


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 10,619
Number of Sequences: 6905
Number of extensions: 10619
Number of successful extensions: 1756
Number of sequences better than 10.0: 587
length of query: 525
length of database: 5,674,871
effective HSP length: 16
effective length of query: 509
effective length of database: 5,564,391
effective search space: 2832275019
effective search space used: 2832275019
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2009. 7.14
Homology vs DNA
Query= Contig-U05215-1 (Contig-U05215-1Q) /CSM_Contig/Contig-U05215-1Q.Seq.d
(525 letters)

Database: ddbj_B
105,743,758 sequences; 104,622,809,269 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU073166) Dictyostelium discoideum slug cDNA, clone SSG301. 172 9e-39 1
(AP007150) Aspergillus oryzae RIB40 genomic DNA, SC009. 36 0.64 2
(DN701718) CLJ37-D03.y1d-s SHGC-CLJ Gasterosteus aculeatus c... 38 0.90 2
(AL844509) Plasmodium falciparum 3D7 chromosome 13. 46 1.4 1
(AC127917) Rattus norvegicus clone CH230-235E15, WORKING DRA... 46 1.4 1
(AC126291) Rattus norvegicus clone CH230-198E3, WORKING DRAF... 46 1.4 1
(FP340284) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 1.4 1
(FP091238) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 1.4 1
(AC218848) Bos taurus clone CH240-292G20, WORKING DRAFT SEQU... 46 1.4 1
(AC175130) Bos taurus clone CH240-38F23, WORKING DRAFT SEQUE... 46 1.4 1
(AC173499) Bos taurus clone CH240-313G1, WORKING DRAFT SEQUE... 46 1.4 1
(AC171381) Oryctolagus cuniculus clone LB1-197F15, WORKING D... 46 1.4 1
(CT322407) Sus scrofa genomic clone CH242-404G5, genomic sur... 46 1.4 1
(EL501229) 064_PFLAB1-M-P9B.AB1 Blood stage Plasmodium falci... 46 1.4 1
(EL497245) H10_PFBAMHI-M-T3-PLATE4A.AB1 Blood stage Plasmodi... 46 1.4 1
(BU496588) PfESToab52b11.y1 Plasmodium falciparum 3D7 asexua... 46 1.4 1
(CJ186583) Mus musculus 14.5 days embryo Rathke's pouches cD... 38 4.7 2
(AL935163) Zebrafish DNA sequence from clone CH211-206K20 in... 44 5.4 1
(AC216420) Populus trichocarpa clone POP078-D14, complete se... 44 5.4 1
(AC187345) Trichinella spiralis BAC clone TS195-4H12 from ch... 44 5.4 1
(CU861941) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 5.4 1
(CU571265) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 5.4 1
(AY808810) Schistosoma japonicum SJCHGC03192 protein mRNA, p... 44 5.4 1
(DC199069) Plasmodium berghei cDNA clone:LV009265, liver sta... 44 5.4 1
(CX863084) SJEEOE07.T3 SJE Schistosoma japonicum cDNA, mRNA ... 44 5.4 1
(BX834667) Arabidopsis thaliana Full-length cDNA 3PRIM end o... 44 5.4 1
(BU778380) SJEECE07 SJE Schistosoma japonicum cDNA, mRNA seq... 44 5.4 1
(BU776825) SJEDDB07 SJE Schistosoma japonicum cDNA, mRNA seq... 44 5.4 1
(BU776406) SJECME12 SJE Schistosoma japonicum cDNA, mRNA seq... 44 5.4 1
(BU767153) SJEANH12 SJE Schistosoma japonicum cDNA, mRNA seq... 44 5.4 1
(FE246142) CAPG9262.fwd CAPG Naegleria gruberi amoeba stage ... 44 5.4 1
(CA873461) K0925D02-5N NIA Mouse Neural Stem Cell (Undiffere... 38 6.2 2
(AC121166) Rattus norvegicus clone CH230-115J17, *** SEQUENC... 38 6.4 5
(CJ065892) Mus musculus 10 days lactation, adult female mamm... 38 6.9 2
(BB660005) Mus musculus 13 days embryo lung cDNA, RIKEN full... 38 7.4 2

>(AU073166) Dictyostelium discoideum slug cDNA, clone SSG301.
Length = 240

Score = 172 bits (87), Expect = 9e-39
Identities = 87/87 (100%)
Strand = Plus / Plus


Query: 60 caaccgatatcacaaattgagaactttcaattaccaacctcattaaccaatgcctttgaa 119
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 60 caaccgatatcacaaattgagaactttcaattaccaacctcattaaccaatgcctttgaa 119


Query: 120 gaagataccgacagtgacatggcatta 146
|||||||||||||||||||||||||||
Sbjct: 120 gaagataccgacagtgacatggcatta 146

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 105743758
Number of Hits to DB: 362,356,198
Number of extensions: 24769882
Number of successful extensions: 2036391
Number of sequences better than 10.0: 37
Length of query: 525
Length of database: 104,622,809,269
Length adjustment: 23
Effective length of query: 502
Effective length of database: 102,190,702,835
Effective search space: 51299732823170
Effective search space used: 51299732823170
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 8. 1
Homology vs Protein
Query= Contig-U05215-1 (Contig-U05215-1Q) /CSM_Contig/Contig-U05215-1Q.Seq.d
(525 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

BC120384_1(BC120384|pid:none) Bos taurus SRY (sex determining re... 65 8e-10
AY423014_1(AY423014|pid:none) Danio rerio SRY-box 7 (SOX7) mRNA,... 65 8e-10
AY277961_1(AY277961|pid:none) Takifugu rubripes transcription fa... 65 1e-09
FJ895592_1(FJ895592|pid:none) Oryzias latipes SRY-box containing... 65 1e-09
(Q28GD5) RecName: Full=Transcription factor Sox-7; &BC170859_1(... 64 3e-09
(P35713) RecName: Full=Transcription factor SOX-18; &AB033888_1... 63 4e-09
BC097973_1(BC097973|pid:none) Rattus norvegicus SRY (sex determi... 62 7e-09
AK144281_1(AK144281|pid:none) Mus musculus 14 days embryo lung c... 62 7e-09
JC4238(JC4238;S57339;S57309)HMG-box transcription factor - mouse 62 7e-09
L35032_1(L35032|pid:none) Mouse HMG-box transcription factor (so... 62 7e-09
(P43680) RecName: Full=Transcription factor SOX-18; &AF288518_1... 62 7e-09
EU761243_1(EU761243|pid:none) Dicentrarchus labrax Sox17 protein... 62 1e-08
DQ632572_1(DQ632572|pid:none) Oreochromis niloticus SRY-box cont... 62 1e-08
AY277968_1(AY277968|pid:none) Takifugu rubripes transcription fa... 62 1e-08
FJ895598_1(FJ895598|pid:none) Oryzias latipes SRY-box containing... 62 1e-08
EU252558_1(EU252558|pid:none) Tadorna tadorna Sox7 (Sox7) gene, ... 60 3e-08
AF168614_1(AF168614|pid:none) Danio rerio HMG-box transcription ... 60 4e-08
(Q9BT81) RecName: Full=Transcription factor SOX-7; &AB464717_1(... 59 6e-08
AK223574_1(AK223574|pid:none) Homo sapiens mRNA for SRY-box 7 va... 59 6e-08
(P40646) RecName: Full=Transcription factor SOX-7; Shor... 59 6e-08
AK156497_1(AK156497|pid:none) Mus musculus activated spleen cDNA... 59 7e-08
L29086_1(L29086|pid:none) Mus musculus HMG-box transcription fac... 59 1e-07
AB052690_1(AB052690|pid:none) Xenopus laevis mRNA for xSox17alph... 59 1e-07
AB197131_1(AB197131|pid:none) Gallus gallus sox17 mRNA for HMG t... 59 1e-07
(Q3KQ35) RecName: Full=Transcription factor Sox-17-alpha-A; ... 59 1e-07
(Q9H6I2) RecName: Full=Transcription factor SOX-17; &AB073988_1... 58 1e-07
BC166978_1(BC166978|pid:none) Rattus norvegicus SRY (sex determi... 58 1e-07
(Q61473) RecName: Full=Transcription factor SOX-17; &AK004781_1... 58 1e-07
BC030209_1(BC030209|pid:none) Homo sapiens SRY (sex determining ... 58 1e-07
(Q8AWH3) RecName: Full=Transcription factor Sox-17-alpha; ... 58 1e-07
AY277969_1(AY277969|pid:none) Takifugu rubripes transcription fa... 58 2e-07
EU939768_1(EU939768|pid:none) Saccoglossus kowalevskii sox7/17 p... 58 2e-07
AF302936_1(AF302936|pid:none) Gallus gallus transcription factor... 58 2e-07
BC141780_1(BC141780|pid:none) Xenopus laevis hypothetical protei... 57 2e-07
EF397004_1(EF397004|pid:none) Eleutherodactylus coqui Sox17 alph... 57 2e-07
AJ250955_1(AJ250955|pid:none) Drosophila melanogaster mRNA for S... 57 3e-07
AC148408_2(AC148408|pid:none) X. tropicalis BAC clone ISB1-15D4 ... 57 4e-07
AY830454_1(AY830454|pid:none) Petromyzon marinus SoxF (SoxF) mRN... 56 5e-07
AB271934_1(AB271934|pid:none) Sus scrofa SOX18 mRNA for transcri... 55 8e-07
AC148408_3(AC148408|pid:none) X. tropicalis BAC clone ISB1-15D4 ... 55 1e-06
DQ632586_1(DQ632586|pid:none) Oreochromis niloticus SRY-box cont... 55 1e-06
(Q69FB1) RecName: Full=Sex-determining region Y protein; AltName... 55 1e-06
AF182425_1(AF182425|pid:none) Ceratocystis eucalypti mating type... 54 2e-06
DQ888696_1(DQ888696|pid:none) Cervus elaphus yarkandensis SRY (s... 54 2e-06
EU784831_1(EU784831|pid:none) Acropora millepora SoxB1 mRNA, com... 54 2e-06
DQ173692_1(DQ173692|pid:none) Nematostella vectensis sox family ... 54 2e-06
EF062527_1(EF062527|pid:none) Cervus elaphus isolate WCE2 SRY (S... 54 2e-06
AY244497_1(AY244497|pid:none) Cervus elaphus maral sex determini... 54 2e-06
DQ336534_1(DQ336534|pid:none) Syncerus caffer isolate ScSRY test... 54 3e-06
AY604733_1(AY604733|pid:none) Ovis aries sex determining protein... 53 4e-06
DQ119747_1(DQ119747|pid:none) Bubalus bubalis SRY (SRY) gene, co... 53 4e-06
DQ173695_1(DQ173695|pid:none) Nematostella vectensis sox family ... 53 4e-06
D58423_1(D58423|pid:none) Capra hircus SRY gene for testis deter... 53 4e-06
EF431926_1(EF431926|pid:none) Oreochromis karongae Sox14 (Sox14)... 53 5e-06
DQ632581_1(DQ632581|pid:none) Oreochromis niloticus SRY-box cont... 53 5e-06
AJ252124_1(AJ252124|pid:none) Drosophila melanogaster mRNA for S... 53 5e-06
(Q9BH08) RecName: Full=Sex-determining region Y protein; AltName... 53 5e-06
AB247627_1(AB247627|pid:none) Cervus nippon yesoensis SRY gene f... 53 5e-06
EF431924_1(EF431924|pid:none) Oreochromis niloticus Sox14 (Sox14... 53 5e-06
EU402964_1(EU402964|pid:none) Capreolus capreolus SRY gene, exon... 53 5e-06
AM459462_1(AM459462|pid:none) Vitis vinifera contig VV78X205617.... 53 5e-06
EU009462_3(EU009462|pid:none) Phycomyces blakesleeanus putative ... 53 5e-06
AB210699_1(AB210699|pid:none) Ciona intestinalis mRNA for transc... 52 7e-06
FJ895597_1(FJ895597|pid:none) Oryzias latipes SRY-box containing... 52 7e-06
EF062549_1(EF062549|pid:none) Alces alces isolate AA1 SRY (SRY) ... 52 7e-06
DQ888697_1(DQ888697|pid:none) Cervus eldi truncated SRY (sry) ge... 52 7e-06
EF693906_1(EF693906|pid:none) Cervus elaphus haplotype WE SRY (S... 52 7e-06
(Q32PP9) RecName: Full=Transcription factor Sox-14; &BC108033_1... 52 7e-06
DQ888702_1(DQ888702|pid:none) Odocoileus virginianus SRY (sry) g... 52 7e-06
DQ173697_1(DQ173697|pid:none) Nematostella vectensis sox family ... 52 7e-06
AF461765_1(AF461765|pid:none) Elaphodus cephalophus sex-determin... 52 7e-06
EF062529_1(EF062529|pid:none) Odocoileus hemionus isolate MD1 SR... 52 7e-06
AF461767_1(AF461767|pid:none) Muntiacus reevesi sex-determining ... 52 7e-06
EF062550_1(EF062550|pid:none) Odocoileus virginianus isolate WWT... 52 7e-06
AB275394_1(AB275394|pid:none) Kogia breviceps SRY gene for testi... 52 9e-06
(Q864Q8) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
EU233299_1(EU233299|pid:none) Bos indicus isolate N9 sex determi... 52 9e-06
(Q864P7) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
I45833(I45833) sex-determining protein SRY - European bison &Z3... 52 9e-06
(Q864Q3) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
(Q864P5) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
(Q03255) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
(Q864P4) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
(Q864Q5) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
(Q864Q9) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
(Q864Q7) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
(Q864Q4) RecName: Full=Sex-determining region Y protein; AltName... 52 9e-06
AF180946_1(AF180946|pid:none) Elephas maximus SRY protein gene, ... 52 9e-06
AB275390_1(AB275390|pid:none) Eubalaena japonica SRY gene for te... 52 9e-06
EF100132_1(EF100132|pid:none) Hydropotes inermis voucher cgrb699... 52 1e-05
AY842540_1(AY842540|pid:none) Sus scrofa isolate JNP15 sex deter... 52 1e-05
T22022(T22022) hypothetical protein F40E10.2 - Caenorhabditis el... 52 1e-05
AY842527_1(AY842527|pid:none) Sus scrofa isolate B0453 sex deter... 52 1e-05
EU784834_1(EU784834|pid:none) Acropora millepora SoxC mRNA, comp... 52 1e-05
AY842528_1(AY842528|pid:none) Sus scrofa isolate D03154 sex dete... 52 1e-05
AY842541_1(AY842541|pid:none) Sus scrofa coreanus isolate KWB3 s... 52 1e-05
AY842532_1(AY842532|pid:none) Sus scrofa isolate CJ1S sex determ... 52 1e-05
AB014474_1(AB014474|pid:none) Mus musculus Sox15 gene, complete ... 52 1e-05
AF061784_1(AF061784|pid:none) Calotes versicolor Sox9 homolog mR... 52 1e-05
AY842536_1(AY842536|pid:none) Sus scrofa isolate JNP1 sex determ... 52 1e-05
FJ895590_1(FJ895590|pid:none) Oryzias latipes SRY-box containing... 52 1e-05
AY842544_1(AY842544|pid:none) Sus scrofa coreanus isolate KS37 s... 52 1e-05
(Q04892) RecName: Full=Transcription factor SOX-14; &AF193437_1... 51 2e-05
BC097403_1(BC097403|pid:none) Rattus norvegicus SRY (sex determi... 51 2e-05
(Q5RCU4) RecName: Full=Transcription factor SOX-6; &CR858174_1(... 51 2e-05
AF309476_1(AF309476|pid:none) Homo sapiens SOX6 (SOX6) gene, exo... 51 2e-05
AY277973_1(AY277973|pid:none) Takifugu rubripes transcription fa... 51 2e-05
BC069948_1(BC069948|pid:none) Mus musculus SRY-box containing ge... 51 2e-05
AM392730_1(AM392730|pid:none) Synthetic construct Homo sapiens c... 51 2e-05
(P35712) RecName: Full=Transcription factor SOX-6; &AM392594_1(... 51 2e-05
(B0ZTE2) RecName: Full=Transcription factor Sox-14; AltName: Ful... 51 2e-05
AF271787_1(AF271787|pid:none) Branchiostoma floridae HMG box tra... 51 2e-05
AK030713_1(AK030713|pid:none) Mus musculus 8 days embryo whole b... 51 2e-05
D61689_1(D61689|pid:none) Mus musculus mRNA for leucine zipper-c... 51 2e-05
AY112710_1(AY112710|pid:none) Ornithorhynchus anatinus SOX14 (SO... 51 2e-05
EU784835_1(EU784835|pid:none) Acropora millepora SoxE1 mRNA, com... 51 2e-05
EU053400_1(EU053400|pid:none) Andrias davidianus Sox gene, parti... 51 2e-05
BC067407_1(BC067407|pid:none) Mus musculus SRY-box containing ge... 51 2e-05
T16581(T16581)hypothetical protein K08A8.2 - Caenorhabditis eleg... 51 2e-05
AB463289_1(AB463289|pid:none) Synthetic construct DNA, clone: pF... 51 2e-05
AF309034_1(AF309034|pid:none) Homo sapiens SOX6 mRNA, complete c... 51 2e-05
AF193435_1(AF193435|pid:none) Mus musculus HMG box transcription... 51 2e-05
BC100555_1(BC100555|pid:none) Mus musculus SRY-box containing ge... 51 2e-05
AF309476_2(AF309476|pid:none) Homo sapiens SOX6 (SOX6) gene, exo... 51 2e-05
AK049986_1(AK049986|pid:none) Mus musculus adult male hippocampu... 51 2e-05
AY904048_1(AY904048|pid:none) Coturnix japonica SRY sex determin... 51 2e-05
(Q04887) RecName: Full=Transcription factor SOX-9; &AF421878_1(... 51 2e-05
EF564795_1(EF564795|pid:none) Aspidoscelis inornata SRY-box cont... 51 2e-05
AY892429_1(AY892429|pid:none) Synthetic construct Homo sapiens c... 51 2e-05
S52469(S52469)SOX9 protein - mouse 51 2e-05
AK301687_1(AK301687|pid:none) Homo sapiens cDNA FLJ55408 complet... 51 2e-05
AJ534323_1(AJ534323|pid:none) Ciona intestinalis partial mRNA fo... 51 2e-05
(Q6P0E1) RecName: Full=Transcription factor Sox-2; &AB242329_1(... 51 2e-05
AK220197_1(AK220197|pid:none) Mus musculus mRNA for mKIAA4243 pr... 51 2e-05
(P48436) RecName: Full=Transcription factor SOX-9; &(P61753) Re... 51 2e-05
AY904046_1(AY904046|pid:none) Anas platyrhynchos SRY sex determi... 51 2e-05
FJ432693_1(FJ432693|pid:none) Epinephelus coioides voucher C.-M.... 51 2e-05
AF322897_1(AF322897|pid:none) Hylobates sp. TIB-201 SOX9 mRNA, c... 51 2e-05
AY891750_1(AY891750|pid:none) Synthetic construct Homo sapiens c... 51 2e-05
BT044795_1(BT044795|pid:none) Salmo salar clone ssal-rgf-504-016... 51 2e-05
(O18896) RecName: Full=Transcription factor SOX-9; &AF029696_1(... 51 2e-05
AF217252_1(AF217252|pid:none) Eublepharis macularius Sox9 (Sox9)... 51 2e-05
AY277972_1(AY277972|pid:none) Takifugu rubripes transcription fa... 51 2e-05
(B1H349) RecName: Full=Transcription factor Sox-6; AltName: Full... 51 2e-05
(Q9BG91) RecName: Full=Transcription factor SOX-9; &AF322899_1(... 51 2e-05
U66068_1(U66068|pid:none) Lama guanicoe sex-determining protein ... 51 2e-05
(Q7YRJ7) RecName: Full=Transcription factor SOX-9; &AY237827_1(... 51 2e-05
AK289500_1(AK289500|pid:none) Homo sapiens cDNA FLJ75952 complet... 50 3e-05
(P47792) RecName: Full=Transcription factor Sox-19a; &AB242331_... 50 3e-05
AY069926_1(AY069926|pid:none) Mus musculus HMG-box protein (Sox2... 50 3e-05
AL355734_1(AL355734|pid:none) Mus musculus mRNA full length inse... 50 3e-05
(Q9BG89) RecName: Full=Transcription factor SOX-9; &AF322902_1(... 50 3e-05
DQ401163_1(DQ401163|pid:none) Microhyla ornata sox2a gene, parti... 50 3e-05
AY277967_1(AY277967|pid:none) Takifugu rubripes transcription fa... 50 3e-05
EU532205_1(EU532205|pid:none) Danio rerio SRY-box containing pro... 50 3e-05
AK155615_1(AK155615|pid:none) Mus musculus B6-derived CD11 +ve d... 50 3e-05
(Q7SZS1) RecName: Full=Transcription factor Sox-21-A; AltName: F... 50 3e-05
AK155652_1(AK155652|pid:none) Mus musculus B6-derived CD11 +ve d... 50 3e-05
D86075_1(D86075|pid:none) Xenopus laevis mRNA for DNA-binding pr... 50 3e-05
(Q9Z104) RecName: Full=SWI/SNF-related matrix-associated actin-d... 50 3e-05
AJ534325_1(AJ534325|pid:none) Ciona intestinalis partial mRNA fo... 50 3e-05
EU312053_1(EU312053|pid:none) Carassius carassius red var x Mega... 50 3e-05
DQ632584_1(DQ632584|pid:none) Oreochromis niloticus SRY-box cont... 50 3e-05
AB247646_1(AB247646|pid:none) Danio rerio mRNA for sox-lz, parti... 50 3e-05
FJ895594_1(FJ895594|pid:none) Oryzias latipes SRY-box containing... 50 3e-05
DQ138605_1(DQ138605|pid:none) Clytia hemisphaerica Sox10 mRNA, p... 50 3e-05
D86076_1(D86076|pid:none) Xenopus laevis mRNA for DNA-binding pr... 50 3e-05
(Q6RVD7) RecName: Full=Transcription factor Sox-21-B; AltName: F... 50 3e-05
BC163449_1(BC163449|pid:none) Danio rerio SRY-box containing gen... 50 3e-05
AY847639_1(AY847639|pid:none) Acipenser sturio SRY-box containin... 50 3e-05
AF454966_1(AF454966|pid:none) Pygathrix bieti SRY gene, partial ... 50 3e-05
(Q9Y651) RecName: Full=Transcription factor SOX-21; AltName: Ful... 50 3e-05
AY883015_1(AY883015|pid:none) Danio rerio Sox8 (sox8) mRNA, comp... 50 3e-05
(P43267) RecName: Full=Protein SOX-15; &AF182945_1(AF182945|pid... 50 3e-05
AB039216_1(AB039216|pid:none) Mus musculus Sox15 gene for HMG-bo... 50 3e-05
(Q5FWM3) RecName: Full=Transcription factor Sox-3-B; AltName: Fu... 50 3e-05
AY118670_1(AY118670|pid:none) Drosophila melanogaster AT02631 fu... 50 3e-05
(Q04886) RecName: Full=Transcription factor SOX-8; &AF191325_1(... 50 3e-05
AB292070_1(AB292070|pid:none) Ailuropoda melanoleuca SRY gene fo... 50 3e-05
DQ328983_1(DQ328983|pid:none) Petromyzon marinus HMG box protein... 50 3e-05
BC063054_1(BC063054|pid:none) Mus musculus SRY-box containing ge... 50 3e-05
(P57073) RecName: Full=Transcription factor SOX-8; &AB464249_1(... 50 3e-05
AB210482_1(AB210482|pid:none) Ciona intestinalis mRNA for transc... 50 3e-05
(Q24533) RecName: Full=SOX domain-containing protein dichaete; A... 50 3e-05
AK033460_1(AK033460|pid:none) Mus musculus adult male colon cDNA... 50 3e-05
AK034231_1(AK034231|pid:none) Mus musculus adult male diencephal... 50 3e-05
AB039223_1(AB039223|pid:none) Mus spicilegus Sox15 gene for HMG-... 50 3e-05
EF192051_1(EF192051|pid:none) Xenopus laevis sex determining reg... 50 3e-05
AY532156_1(AY532156|pid:none) Heliocidaris tuberculata SOX1 prot... 50 3e-05
AB108673_1(AB108673|pid:none) Mus musculus Sox2 mRNA for transcr... 50 4e-05
(Q6TC27) RecName: Full=Sex-determining region Y protein; AltName... 50 4e-05
(A2TED3) RecName: Full=Transcription factor Sox-1; AltName: Full... 50 4e-05
L07335_1(L07335|pid:none) Homo sapiens (clone 6AR33) HMG box mRN... 50 4e-05
(P48432) RecName: Full=Transcription factor SOX-2; &U31967_1(U3... 50 4e-05
AY277952_1(AY277952|pid:none) Takifugu rubripes transcription fa... 50 4e-05
(P48430) RecName: Full=Transcription factor SOX-2; Shor... 50 4e-05
EU244486_1(EU244486|pid:none) Tadorna tadorna Sox2 (Sox2) cds. ... 50 4e-05
(Q6DGL6) RecName: Full=Transcription factor Sox-1a; &AB242327_1... 50 4e-05
(P54231) RecName: Full=Transcription factor SOX-2; &BC133458_1(... 50 4e-05
AY313139_1(AY313139|pid:none) Saccoglossus kowalevskii sox1/2/3 ... 50 4e-05
AY627769_1(AY627769|pid:none) Danio rerio HMG-box transcription ... 50 4e-05
AF338386_1(AF338386|pid:none) Cebus apella apella SRY (SRY) gene... 50 4e-05
(P56693) RecName: Full=Transcription factor SOX-10; &AB489148_1... 50 4e-05
BC051058_1(BC051058|pid:none) Mus musculus SRY-box containing ge... 50 4e-05
AL031587_9(AL031587|pid:none) Human DNA sequence from clone RP5-... 50 4e-05
AB108672_1(AB108672|pid:none) Mus musculus Sox1 mRNA for transcr... 50 4e-05
AF017182_1(AF017182|pid:none) Mus musculus putative transcriptio... 50 4e-05
AF338390_1(AF338390|pid:none) Cebus apella xanthosternos SRY (SR... 50 4e-05
BC076717_1(BC076717|pid:none) Xenopus laevis cDNA clone MGC:7993... 50 4e-05
AF047389_1(AF047389|pid:none) Mus musculus Dominant megacolon mu... 50 4e-05
AY684328_1(AY684328|pid:none) Pelteobagrus fulvidraco Sox9a1 mRN... 50 4e-05
D50603_1(D50603|pid:none) Gallus gallus mRNA for SOX-2, complete... 50 4e-05
AY847641_1(AY847641|pid:none) Acipenser sturio SRY-box containin... 50 4e-05
FJ375750_1(FJ375750|pid:none) Macaca mulatta sex determining reg... 50 4e-05
S10949(S10949)sex-determining protein - mouse (fragment) 50 4e-05
AY277953_1(AY277953|pid:none) Takifugu rubripes transcription fa... 50 4e-05
(Q9W757) RecName: Full=Transcription factor SOX-10; Sho... 50 4e-05
AY357890_1(AY357890|pid:none) Glomerella cingulata mating-type g... 50 4e-05
FJ895587_1(FJ895587|pid:none) Oryzias latipes SRY-box containing... 50 4e-05
S10950(S10950)sex-determining protein - mouse (fragment) 50 4e-05
AX001335_1(AX001335|pid:none) Sequence 3 from Patent WO9900516. ... 50 4e-05
U66141_1(U66141|pid:none) Mus musculus transcription factor Sox-... 50 4e-05
(Q04888) RecName: Full=Transcription factor SOX-10; AltName: Ful... 50 4e-05
(P53783) RecName: Full=Transcription factor SOX-1; &X94126_1(X9... 50 4e-05
(Q6NVN0) RecName: Full=Transcription factor Sox-2; AltName: Full... 50 4e-05
BC142559_1(BC142559|pid:none) Xenopus laevis cDNA clone MGC:1608... 50 4e-05
AB087830_1(AB087830|pid:none) Halocynthia roretzi HrSoxB1 mRNA f... 50 4e-05
AK043220_1(AK043220|pid:none) Mus musculus 7 days neonate cerebe... 50 4e-05
(A5A763) RecName: Full=Transcription factor SOX-10; &AB271933_1... 50 4e-05
(O42569) RecName: Full=Transcription factor Sox-2; Shor... 50 4e-05
EU433954_1(EU433954|pid:none) Amphimedon queenslandica SoxB1-lik... 50 4e-05
AY685135_1(AY685135|pid:none) Paramisgurnus dabryanus Sox21a pro... 50 4e-05
EU503117_1(EU503117|pid:none) Sus scrofa sex determining region ... 50 4e-05
AJ010604_1(AJ010604|pid:none) Mus musculus mRNA for transcriptio... 49 6e-05
(Q9DDD7) RecName: Full=Transcription factor Sox-19b; AltName: Fu... 49 6e-05
AF284298_1(AF284298|pid:none) Macaca fascicularis isolate philli... 49 6e-05
EU872027_1(EU872027|pid:none) Pleurodeles waltl SOX9 mRNA, compl... 49 6e-05
BC110478_1(BC110478|pid:none) Mus musculus SRY-box containing ge... 49 6e-05
AF338378_1(AF338378|pid:none) Callithrix geoffroyi SRY (SRY) gen... 49 6e-05
EU312054_1(EU312054|pid:none) Carassius carassius red var x Mega... 49 6e-05
EF577484_1(EF577484|pid:none) Oryzias latipes SOX5 longer form (... 49 6e-05
AF338391_1(AF338391|pid:none) Saguinus midas midas SRY (SRY) gen... 49 6e-05
AY532153_1(AY532153|pid:none) Heliocidaris erythrogramma SOX21 p... 49 6e-05
AB081588_1(AB081588|pid:none) Homo sapiens mRNA for L-SOX5 trans... 49 6e-05
AY035397_1(AY035397|pid:none) Xenopus laevis transcription facto... 49 6e-05
BC114658_1(BC114658|pid:none) Bos taurus SRY (sex determining re... 49 6e-05
EU784832_1(EU784832|pid:none) Acropora millepora SoxBa mRNA, par... 49 6e-05
CU207379_3(CU207379|pid:none) Mouse DNA sequence from clone CH29... 49 6e-05
AF338383_1(AF338383|pid:none) Callimico goeldii SRY (SRY) gene, ... 49 6e-05
AF338370_1(AF338370|pid:none) Leontopithecus chrysomelas SRY (SR... 49 6e-05
EU337019_1(EU337019|pid:none) Diploid improved red crucian carp ... 49 6e-05
AF338374_1(AF338374|pid:none) Aotus lemurinus SRY (SRY) gene, pa... 49 6e-05
(Q9W7R5) RecName: Full=Transcription factor SOX-21; &AB026623_1... 49 6e-05
AB006448_1(AB006448|pid:none) Oncorhynchus mykiss SOX9 mRNA, com... 49 6e-05
FN357280_1(FN357280|pid:none) Platynereis dumerilii mRNA for SRY... 49 6e-05
S35561(S35561)sex-determining protein SRY - orangutan 49 6e-05
(P35710) RecName: Full=Transcription factor SOX-5; &AB006330_1(... 49 6e-05
BC087910_1(BC087910|pid:none) Mus musculus high-mobility group b... 49 6e-05
CR456713_1(CR456713|pid:none) Homo sapiens full open reading fra... 49 6e-05
EU373500_1(EU373500|pid:none) Oreochromis aureus SOX9 (sox9) gen... 49 6e-05
(Q28783) RecName: Full=Sex-determining region Y protein; AltName... 49 6e-05
BC029220_1(BC029220|pid:none) Homo sapiens SRY (sex determining ... 49 6e-05
EU599187_1(EU599187|pid:none) Equus caballus sex-determining pro... 49 6e-05
AF338375_1(AF338375|pid:none) Aotus azarai SRY (SRY) gene, parti... 49 6e-05
(P51501) RecName: Full=Sex-determining region Y protein; AltName... 49 6e-05
DQ136023_1(DQ136023|pid:none) Petromyzon marinus Sox9 mRNA, part... 49 6e-05
AY888183_1(AY888183|pid:none) Synthetic construct Homo sapiens c... 49 6e-05
AK160154_1(AK160154|pid:none) Mus musculus adult male testis cDN... 49 6e-05
DQ644541_1(DQ644541|pid:none) Branchiostoma floridae SoxB1 mRNA,... 49 6e-05
(Q8TEA4) RecName: Full=Transcription factor SOX-5; &AB081589_1(... 49 6e-05
AK098610_1(AK098610|pid:none) Homo sapiens cDNA FLJ25744 fis, cl... 49 6e-05
AJ626988_1(AJ626988|pid:none) Gallus gallus mRNA for transcripti... 49 6e-05
Y10043_1(Y10043|pid:none) Homo sapiens mRNA for high mobility gr... 49 6e-05
AY277963_1(AY277963|pid:none) Takifugu rubripes transcription fa... 49 6e-05
AK074317_1(AK074317|pid:none) Homo sapiens cDNA FLJ23737 fis, cl... 49 6e-05
AY277950_1(AY277950|pid:none) Takifugu rubripes transcription fa... 49 6e-05
AF338388_1(AF338388|pid:none) Cebus capucinus SRY (SRY) gene, pa... 49 6e-05
AF338384_1(AF338384|pid:none) Cebus albifrons SRY (SRY) gene, pa... 49 6e-05
AY581214_1(AY581214|pid:none) Acipenser schrenckii transcription... 49 6e-05
S25195(S25195;S22943;S21484;S21485) sex-determining protein SOX-... 49 6e-05
EU931639_1(EU931639|pid:none) Saccoglossus kowalevskii Sox14/21-... 49 6e-05
AF338377_1(AF338377|pid:none) Callithrix aurita SRY (SRY) gene, ... 49 6e-05
(O15347) RecName: Full=High mobility group protein B3; AltName: ... 49 6e-05
BT059262_1(BT059262|pid:none) Salmo salar clone ssal-rgf-537-204... 49 6e-05
(Q2Z1R2) RecName: Full=Transcription factor Sox-1b; &AB242328_1... 49 6e-05
AY170913_1(AY170913|pid:none) Pelodiscus sinensis PS47 protein (... 49 6e-05
BC170060_1(BC170060|pid:none) Xenopus laevis transcription facto... 49 6e-05
EU240939_1(EU240939|pid:none) Equus asinus sex-determining regio... 49 6e-05
EU240941_1(EU240941|pid:none) Equus grevyi sex-determining regio... 49 6e-05
CU462871_4(CU462871|pid:none) Zebrafish DNA sequence from clone ... 49 8e-05
AY998489_1(AY998489|pid:none) Homo sapiens clone pSOx.6 SRY prot... 49 8e-05
DQ917227_1(DQ917227|pid:none) Strongylocentrotus pallidus haplot... 49 8e-05
AB270702_1(AB270702|pid:none) Eptatretus burgeri Sox9 mRNA for S... 49 8e-05
(P48046) RecName: Full=Sex-determining region Y protein; AltName... 49 8e-05
AF440223_1(AF440223|pid:none) Zea mays cultivar Ohio43 HMG type ... 49 8e-05
AY277951_1(AY277951|pid:none) Takifugu rubripes transcription fa... 49 8e-05
DQ917216_1(DQ917216|pid:none) Strongylocentrotus pallidus haplot... 49 8e-05
AB211148_1(AB211148|pid:none) Oryzias latipes Sox9a2 mRNA for HM... 49 8e-05
DQ917180_1(DQ917180|pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05
AY172026_1(AY172026|pid:none) Branchiostoma belcheri tsingtaunes... 49 8e-05
DQ917177_1(DQ917177|pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05
AY573259_1(AY573259|pid:none) Oncorhynchus keta transcription fa... 49 8e-05
DQ917190_1(DQ917190|pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05
AY330304_1(AY330304|pid:none) Homo sapiens SRY (SRY) gene, parti... 49 8e-05
(B0ZTE1) RecName: Full=Transcription factor Sox-21; AltName: Ful... 49 8e-05
AB292068_1(AB292068|pid:none) Melursus ursinus SRY gene for sex ... 49 8e-05
DQ095190_1(DQ095190|pid:none) Puma concolor sex-determining regi... 49 8e-05
AB292063_1(AB292063|pid:none) Ursus arctos SRY gene for sex dete... 49 8e-05
AY057745_1(AY057745|pid:none) Mus minutoides sex-determining pro... 49 8e-05
DQ683740_1(DQ683740|pid:none) Kryptolebias marmoratus sox9b mRNA... 49 8e-05
AY998490_1(AY998490|pid:none) Homo sapiens clone pSOx5 SRY prote... 49 8e-05
AB428664_1(AB428664|pid:none) Oryzias luzonensis Sox9a2 mRNA for... 49 8e-05
DQ917230_1(DQ917230|pid:none) Strongylocentrotus franciscanus ha... 49 8e-05
DQ917235_1(DQ917235|pid:none) Strongylocentrotus franciscanus ha... 49 8e-05
DQ401164_1(DQ401164|pid:none) Microhyla ornata sox2b gene, parti... 49 8e-05
DQ917184_1(DQ917184|pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05
AY998484_1(AY998484|pid:none) Homo sapiens clone pSOx1 SRY prote... 49 8e-05
EU070763_1(EU070763|pid:none) Cynoglossus semilaevis transcripti... 49 8e-05
AY608625_1(AY608625|pid:none) Homo sapiens isolate APRARBSRY SRY... 49 8e-05
AK295455_1(AK295455|pid:none) Homo sapiens cDNA FLJ58176 complet... 49 8e-05
AY601858_1(AY601858|pid:none) Homo sapiens isolate SAP20SRY sex-... 49 8e-05
(Q9XS37) RecName: Full=Sex-determining region Y protein; AltName... 49 8e-05
DQ222970_1(DQ222970|pid:none) Salmo salar Sox8 mRNA, partial cds. 49 8e-05
DQ190443_1(DQ190443|pid:none) Scyliorhinus canicula Sox8 mRNA, p... 49 8e-05
DQ441596_1(DQ441596|pid:none) Odontesthes hatcheri transcription... 49 8e-05
AF157388_1(AF157388|pid:none) Strongylocentrotus purpuratus tran... 49 8e-05
AM884748_1(AM884748|pid:none) Homo sapiens SRY gene for sex dete... 49 8e-05
AY235423_1(AY235423|pid:none) Trachemys scripta Sry-related gene... 49 8e-05
DQ917209_1(DQ917209|pid:none) Strongylocentrotus droebachiensis ... 49 8e-05
AY330303_1(AY330303|pid:none) Homo sapiens SRY (SRY) gene, parti... 49 8e-05
DQ917229_1(DQ917229|pid:none) Strongylocentrotus pallidus haplot... 49 8e-05
DQ917172_1(DQ917172|pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05
FJ614517_1(FJ614517|pid:none) Tarsius lariang voucher T06 SRY ge... 49 8e-05
DQ917188_1(DQ917188|pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05
U66067_1(U66067|pid:none) Equus caballus sex-determining protein... 49 8e-05
DQ917224_1(DQ917224|pid:none) Strongylocentrotus pallidus haplot... 49 8e-05
DQ917208_1(DQ917208|pid:none) Strongylocentrotus droebachiensis ... 49 8e-05
BT066033_1(BT066033|pid:none) Zea mays full-length cDNA clone ZM... 49 8e-05
BC107991_1(BC107991|pid:none) Danio rerio zgc:123215, mRNA (cDNA... 49 8e-05
AF000024_1(AF000024|pid:none) Carica papaya sex-determining regi... 49 8e-05
(Q6VVD7) RecName: Full=Transcription factor Sox-8; &AY324658_1(... 49 8e-05
DQ683727_1(DQ683727|pid:none) Poecilia reticulata Sox9 (Sox9) mR... 49 8e-05
AY935980_1(AY935980|pid:none) Takifugu rubripes DNA-binding tran... 49 8e-05
AY578709_1(AY578709|pid:none) Branchiostoma belcheri tsingtaunes... 49 8e-05
DQ917205_1(DQ917205|pid:none) Strongylocentrotus droebachiensis ... 49 8e-05
(P55863) RecName: Full=Transcription factor Sox-3-A; Sh... 49 8e-05
AY573238_1(AY573238|pid:none) Homo sapiens SRY protein (SRY) gen... 49 8e-05
AB292069_1(AB292069|pid:none) Tremarctos ornatus SRY gene for se... 49 8e-05
AY277962_1(AY277962|pid:none) Takifugu rubripes transcription fa... 49 8e-05
AB292065_1(AB292065|pid:none) Ursus americanus SRY gene for sex ... 49 8e-05
DQ632566_1(DQ632566|pid:none) Oreochromis niloticus SRY-box cont... 49 8e-05
AB011803_1(AB011803|pid:none) Gallus gallus mRNA for SOX3, compl... 49 8e-05
DQ917183_1(DQ917183|pid:none) Strongylocentrotus purpuratus hapl... 49 8e-05
AY998487_1(AY998487|pid:none) Homo sapiens clone pSOx7 SRY prote... 49 8e-05
(P48433) RecName: Full=Transcription factor SOX-3; Shor... 49 8e-05
AY676309_1(AY676309|pid:none) Epinephelus akaara sox9 mRNA, comp... 49 8e-05
AM884751_1(AM884751|pid:none) Homo sapiens SRY gene for sex dete... 49 8e-05
D83256_1(D83256|pid:none) Oncorhynchus mykiss mRNA for SoxP1, co... 49 8e-05
(P53784) RecName: Full=Transcription factor SOX-3; &AF434675_1(... 49 1e-04
AK069900_1(AK069900|pid:none) Oryza sativa Japonica Group cDNA c... 49 1e-04
AF402677_1(AF402677|pid:none) Danio rerio HMG-box transcription ... 49 1e-04
(Q66JF1) RecName: Full=Transcription factor Sox-11; &AC148407_1... 49 1e-04
(P40650) RecName: Full=Transcription factor Sox-11-B; AltName: F... 49 1e-04
(Q9XT60) RecName: Full=Sex-determining region Y protein; AltName... 49 1e-04
AF284283_1(AF284283|pid:none) Trachypithecus cristatus SRY (SRY)... 49 1e-04
BT067305_1(BT067305|pid:none) Zea mays full-length cDNA clone ZM... 49 1e-04
D87209_1(D87209|pid:none) Xenopus laevis mRNA for XLS13B protein... 49 1e-04
EF174418_1(EF174418|pid:none) Carassius auratus Sox3 mRNA, compl... 49 1e-04
AF503585_1(AF503585|pid:none) Oryza sativa (indica cultivar-grou... 49 1e-04
BC170062_1(BC170062|pid:none) Xenopus laevis transcription facto... 49 1e-04
CS560088_1(CS560088|pid:none) Sequence 675 from Patent WO2006032... 49 1e-04
(Q9LGR0) RecName: Full=FACT complex subunit SSRP1-A; AltName: Fu... 49 1e-04
EU921550_1(EU921550|pid:none) Bombina maxima sox1b mRNA, partial... 49 1e-04
D83650_1(D83650|pid:none) Xenopus laevis mRNA for XLS13A protein... 49 1e-04
DQ901549_1(DQ901549|pid:none) Ambystoma mexicanum Sry-type HMG b... 49 1e-04
EU004461_1(EU004461|pid:none) Trachypithecus vetulus SRY gene, p... 49 1e-04
BC059296_1(BC059296|pid:none) Xenopus laevis hypothetical protei... 49 1e-04
I38239(I38239;I38242;S67816) transcription factor SOX3 - human ... 49 1e-04
BC096018_1(BC096018|pid:none) Mus musculus SRY-box containing ge... 49 1e-04
AY684329_1(AY684329|pid:none) Pelteobagrus fulvidraco Sox9a2 mRN... 49 1e-04
BT037050_1(BT037050|pid:none) Zea mays full-length cDNA clone ZM... 49 1e-04
AB117991_1(AB117991|pid:none) Oryza sativa Japonica Group bip104... 49 1e-04
AY998488_1(AY998488|pid:none) Homo sapiens clone pSOx.3 SRY prot... 49 1e-04
(P41225) RecName: Full=Transcription factor SOX-3; &AF264713_1(... 49 1e-04
AF388945_1(AF388945|pid:none) Gelasinospora sp. FGSC 8239 mating... 49 1e-04
(P36981) RecName: Full=Mating- type protein a-1; Short=... 49 1e-04
AJ133040_1(AJ133040|pid:none) Neurospora discreta mat a-1 gene (... 49 1e-04
BC063061_1(BC063061|pid:none) Mus musculus SRY-box containing ge... 49 1e-04
AE017345_424(AE017345|pid:none) Cryptococcus neoformans var. neo... 49 1e-04
A53143(A53143)testis-determining gene/SRY homolog - dunnart (Smi... 49 1e-04
EU908060_1(EU908060|pid:none) Amphiprion melanopus Sox3 mRNA, co... 49 1e-04
(Q9LEF5) RecName: Full=FACT complex subunit SSRP1; AltName: Full... 49 1e-04
(Q91731) RecName: Full=Transcription factor Sox-11-A; S... 49 1e-04
(Q5B995) RecName: Full=Non-histone chromosomal protein 6; 49 1e-04
S10948(S10948)sex-determining protein - mouse (fragment) 49 1e-04
BC052024_1(BC052024|pid:none) Mus musculus SRY-box containing ge... 49 1e-04
CS559844_1(CS559844|pid:none) Sequence 431 from Patent WO2006032... 49 1e-04
(A4IIJ8) RecName: Full=Transcription factor Sox-10; AltName: Ful... 49 1e-04
AY998491_1(AY998491|pid:none) Homo sapiens clone pSOx4 SRY prote... 49 1e-04
DQ095179_1(DQ095179|pid:none) Herpailurus yaguarondi sex-determi... 49 1e-04
AJ133047_1(AJ133047|pid:none) Neurospora intermedia mat a-1 gene... 49 1e-04
EU004457_1(EU004457|pid:none) Semnopithecus entellus pop-variant... 49 1e-04
AJ421270_1(AJ421270|pid:none) Homo sapiens partial mRNA for sex ... 49 1e-04
AY627281_1(AY627281|pid:none) Oncorhynchus keta sox transcriptio... 49 1e-04
FJ236233_1(FJ236233|pid:none) Poecilia reticulata transcription ... 49 1e-04
BC093134_1(BC093134|pid:none) Danio rerio SRY-box containing gen... 49 1e-04
AF277096_1(AF277096|pid:none) Danio rerio HMG box transcription ... 49 1e-04
BC127563_1(BC127563|pid:none) Danio rerio cDNA clone IMAGE:70628... 49 1e-04
DQ494323_1(DQ494323|pid:none) Pelteobagrus fulvidraco HMG box tr... 49 1e-04
(Q28447) RecName: Full=Sex-determining region Y protein; AltName... 49 1e-04
EU921549_1(EU921549|pid:none) Bombina maxima sox1a mRNA, partial... 49 1e-04
EU213010_1(EU213010|pid:none) Pelteobagrus fulvidraco Sox9a2 gen... 49 1e-04
DQ095173_1(DQ095173|pid:none) Leopardus tigrinus sex-determining... 48 1e-04
AF284282_1(AF284282|pid:none) Presbytis melalophos SRY (SRY) gen... 48 1e-04
DQ095184_1(DQ095184|pid:none) Prionailurus bengalensis sex-deter... 48 1e-04
AF284284_1(AF284284|pid:none) Macaca sinica isolate 985 SRY (SRY... 48 1e-04
DQ917197_1(DQ917197|pid:none) Strongylocentrotus droebachiensis ... 48 1e-04
DQ173696_1(DQ173696|pid:none) Nematostella vectensis sox family ... 48 1e-04
(P36395) RecName: Full=Sex-determining region Y protein; AltName... 48 1e-04
AF454967_1(AF454967|pid:none) Macaca fascicularis SRY gene, part... 48 1e-04
DQ095174_1(DQ095174|pid:none) Prionailurus planiceps sex-determi... 48 1e-04
EU004456_1(EU004456|pid:none) Presbytis melalophos SRY gene, par... 48 1e-04
AF284288_1(AF284288|pid:none) Macaca silenus isolate 108806 SRY ... 48 1e-04
AF284329_1(AF284329|pid:none) Theropithecus gelada SRY (SRY) gen... 48 1e-04
D50552_1(D50552|pid:none) Xenopus laevis xSox12 mRNA for XSOX12,... 48 1e-04
AY157672_1(AY157672|pid:none) Rattus norvegicus HMG box transcri... 48 1e-04
DQ095176_1(DQ095176|pid:none) Prionailurus rubiginosa sex-determ... 48 1e-04
AY450889_1(AY450889|pid:none) Cercopithecus wolfi isolate Nguma.... 48 1e-04
AY277966_1(AY277966|pid:none) Takifugu rubripes transcription fa... 48 1e-04
DQ095162_1(DQ095162|pid:none) Felis nigripes sex-determining reg... 48 1e-04
AY048067_1(AY048067|pid:none) Cercopithecus lhoesti isolate Antw... 48 1e-04
DQ002891_1(DQ002891|pid:none) Panthera tigris sex-determining re... 48 1e-04
AF284328_1(AF284328|pid:none) Papio hamadryas SRY (SRY) gene, pa... 48 1e-04
AY048069_1(AY048069|pid:none) Cercopithecus mitis isolate 5311.7... 48 1e-04
AY450886_1(AY450886|pid:none) Cercopithecus neglectus isolate Su... 48 1e-04
EF517798_1(EF517798|pid:none) Cercopithecus ascanius isolate 411... 48 1e-04
DQ095189_1(DQ095189|pid:none) Neofelis nebulosa sex-determining ... 48 1e-04
AY450890_1(AY450890|pid:none) Cercopithecus diana isolate The.Zo... 48 1e-04
L29545_1(L29545|pid:none) Rattus exulans sex-determing protein g... 48 1e-04
EF517799_1(EF517799|pid:none) Cercopithecus pogonias isolate 108... 48 1e-04
AY450885_1(AY450885|pid:none) Cercopithecus mitis isolate Lehn s... 48 1e-04
DQ095167_1(DQ095167|pid:none) Leptailurus serval sex-determining... 48 1e-04
AF454970_1(AF454970|pid:none) Macaca nemestrina SRY gene, partia... 48 1e-04
BC109793_1(BC109793|pid:none) Bos taurus high-mobility group box... 48 1e-04
(Q32L31) RecName: Full=High mobility group protein B3; 48 1e-04
AM884746_1(AM884746|pid:none) Homo sapiens SRY gene for sex dete... 48 1e-04
EU864029_1(EU864029|pid:none) Ctenopharyngodon idella Sox1 gene,... 48 1e-04
DQ095182_1(DQ095182|pid:none) Prionailurus viverrinus sex-determ... 48 1e-04
AF284327_1(AF284327|pid:none) Macaca thibetana SRY (SRY) gene, p... 48 1e-04
(Q6TC50) RecName: Full=Sex-determining region Y protein; AltName... 48 1e-04
DQ095177_1(DQ095177|pid:none) Leopardus pardalis sex-determining... 48 1e-04
DQ095168_1(DQ095168|pid:none) Felis libyca sex-determining regio... 48 1e-04
AF454968_1(AF454968|pid:none) Mandrillus leucophaeus SRY gene, p... 48 1e-04
S35564(S35564)sex-determining protein SRY - common marmoset 48 1e-04
AY157997_1(AY157997|pid:none) Rattus norvegicus HMG box transcri... 48 1e-04
(Q9BG90) RecName: Full=Sex-determining region Y protein; AltName... 48 1e-04
(Q4PBZ9) RecName: Full=Non-histone chromosomal protein 6; 48 1e-04
DQ095191_1(DQ095191|pid:none) Oncifelis guigna sex-determining r... 48 1e-04
CP001327_331(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 48 1e-04
DQ095183_1(DQ095183|pid:none) Oncifelis colocolo sex-determining... 48 1e-04
DQ095180_1(DQ095180|pid:none) Panthera onca sex-determining regi... 48 1e-04
AF275682_1(AF275682|pid:none) Rattus norvegicus sex-determining ... 48 1e-04
AF284292_1(AF284292|pid:none) Macaca arctoides isolate St0316 SR... 48 1e-04
AY048072_1(AY048072|pid:none) Erythrocebus patas isolate 151 SRY... 48 1e-04
AF284330_1(AF284330|pid:none) Mandrillus sphinx SRY (SRY) gene, ... 48 1e-04
AF284295_1(AF284295|pid:none) Macaca assamensis SRY (SRY) gene, ... 48 1e-04
AB099654_1(AB099654|pid:none) Felis catus sry gene for sex-deter... 48 1e-04
DQ095172_1(DQ095172|pid:none) Acinonyx jubatus sex-determining r... 48 1e-04
BC115164_1(BC115164|pid:none) Danio rerio zgc:136533, mRNA (cDNA... 48 2e-04
AF284286_1(AF284286|pid:none) Macaca tonkeana isolate PM604.H.cl... 48 2e-04
AB108675_1(AB108675|pid:none) Mus musculus Sox11 mRNA for transc... 48 2e-04
AJ000740_1(AJ000740|pid:none) Mus Musculus mRNA for HMG-box tran... 48 2e-04
(Q6TC44) RecName: Full=Sex-determining region Y protein; AltName... 48 2e-04
U85090_1(U85090|pid:none) Danio rerio transcriptional regulator ... 48 2e-04
U85091_1(U85091|pid:none) Danio rerio transcriptional regulator ... 48 2e-04
EU921551_1(EU921551|pid:none) Bombina maxima sox3a mRNA, partial... 48 2e-04
AK304192_1(AK304192|pid:none) Homo sapiens cDNA FLJ59817 complet... 48 2e-04
(Q6TC46) RecName: Full=Sex-determining region Y protein; AltName... 48 2e-04
AK304801_1(AK304801|pid:none) Homo sapiens cDNA FLJ51471 complet... 48 2e-04
AB210700_1(AB210700|pid:none) Ciona intestinalis mRNA for transc... 48 2e-04
AF416953_1(AF416953|pid:none) Naegleria fowleri high mobility gr... 48 2e-04
DQ095193_1(DQ095193|pid:none) Catopuma temminckii sex-determinin... 48 2e-04
(Q9DC33) RecName: Full=High mobility group protein 20A; AltName:... 48 2e-04
AY333983_1(AY333983|pid:none) Oreochromis niloticus SRY-box cont... 48 2e-04
AY157670_1(AY157670|pid:none) Rattus norvegicus HMG box transcri... 48 2e-04
AB012237_1(AB012237|pid:none) Gallus gallus mRNA for SOX11, comp... 48 2e-04
(P35716) RecName: Full=Transcription factor SOX-11; &AB028641_1... 48 2e-04
AK301782_1(AK301782|pid:none) Homo sapiens cDNA FLJ58547 complet... 48 2e-04
(Q6TC32) RecName: Full=Sex-determining region Y protein; AltName... 48 2e-04
AF284318_1(AF284318|pid:none) Macaca nigra SRY (SRY) gene, parti... 48 2e-04
DQ632578_1(DQ632578|pid:none) Oreochromis niloticus SRY-box cont... 48 2e-04
U64608_7(U64608|pid:none) Caenorhabditis elegans cosmid T22B7, c... 48 2e-04
AF083105_1(AF083105|pid:none) Homo sapiens HMG box factor SOX-13... 48 2e-04
AF097319_1(AF097319|pid:none) Caenorhabditis elegans Sox domain ... 48 2e-04
AK039222_1(AK039222|pid:none) Mus musculus adult male hypothalam... 48 2e-04
DQ977203_1(DQ977203|pid:none) Pan paniscus HMG20A (HMG20A) gene,... 48 2e-04
(P48435) RecName: Full=Transcription factor SOX-11; Sho... 48 2e-04
AF116571_1(AF116571|pid:none) Homo sapiens SRY-like DNA binding ... 48 2e-04
BC068257_1(BC068257|pid:none) Mus musculus high mobility group 2... 48 2e-04
DQ408598_1(DQ408598|pid:none) Glomeris marginata SoxE1 mRNA, par... 48 2e-04

>BC120384_1(BC120384|pid:none) Bos taurus SRY (sex determining
region Y)-box 18, mRNA (cDNA clone MGC:142871
IMAGE:8280640), complete cds.
Length = 389

Score = 65.5 bits (158), Expect = 8e-10
Identities = 28/57 (49%), Positives = 43/57 (75%)
Frame = +3

Query: 345 EPKEKKPPNAFILFTMDKRKELRTNNPELTNAMVSSLLGKEWKELHPSEKKKYVEKA 515
E + ++P NAF+++ D+RK L NP+L NA++S +LGK WKEL P+EK+ +VE+A
Sbjct: 82 ESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELSPAEKRPFVEEA 138

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 414,376,455
Number of extensions: 5457312
Number of successful extensions: 15482
Number of sequences better than 10.0: 1463
Number of HSP's gapped: 15445
Number of HSP's successfully gapped: 1502
Length of query: 175
Length of database: 1,061,185,681
Length adjustment: 120
Effective length of query: 55
Effective length of database: 668,971,921
Effective search space: 36793455655
Effective search space used: 36793455655
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

PSORT

psg: 0.80 gvh: 0.40 alm: 0.55 top: 0.53 tms: 0.00 mit: 0.32 mip: 0.00
nuc: 0.16 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

52.0 %: nuclear
28.0 %: cytoplasmic
12.0 %: cytoskeletal
4.0 %: mitochondrial
4.0 %: peroxisomal

>> prediction for Contig-U05215-1 is nuc

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 1
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0