>Contig-U05198-1 (Contig-U05198-1Q) /CSM_Contig/Contig-U05198-1Q.Seq.d
TTTTTTTTTATTTTTTTTTTTTTATTAAAAAGAGAGCCATATAAATTAAT
AGAATCAAATTTGAATTTTCAGACTATACTATTAAAATTAATAATAGTTA
AAAAAATAAAGTTTTTATTCTACAAAAATTAAAAATATTATAAAATTTTA
AAATGGGTATTATGAAAATAGGAGAAATTGCTCCTGAATTTACACTTCCA
AATAAAGATGGAAAATTATTTAATCTAAAAGATTTTGCCGGTAAACCTCT
AGTTATATTTTTTTATCCAAATAATATTGGATGGGTTTGTACTCGTGAAG
TTTGTTATTTTAGAGATAGTTAAAATTTATTGAAATGGGTGCAGAGGTAA
TTGGAATTAGTCCAAACACAATGGATAATCATAAAAAATTTCATGCTGCT
CATAGAGTCAACTATACTATATTATCAGATAAAAACGGAGCGATTGGGAA
GCTATATGGAGTAAATGGTCTACTTCCTGGTAGNGTAACATTTGTTATTG
ATAAAAACGGCAAGATTGCTTTAAATCATCATACTTCCTGGTTATCCCAT
TCATCACATATTGAAAACTCTTTGAGTGTAATAGAATTATTAAATTCTCA
ATAATGAATTTAATAATTGGATTATTAAAATCTCAATGAATTTGTAAATA
TTTTATTTCCACACAATCAATTTATATTATAATAAATTTTATTATATTTT
TTCCTCTTCTCCTTCAATATATTATAATAATTACCTATGGTTTTTTTTAA
ATTTTTAAAATAAATAAAAATAAAAAATAAAAATAATAATAATAATAAAA
TATA

est1=SSJ615F,1,272
est2=SSG175E,77,806

fflffffy*keshin**nqi*ifrlyy*n***lkk*sfystkikniikf*ngyyenrrnc
s*iytsk*rwkii*skrfcr*tssyiflsk*ywmglys*sllf*r*LKFIEMGAEVIGIS
PNTMDNHKKFHAAHRVNYTILSDKNGAIGKLYGVNGLLPGXVTFVIDKNGKIALNHHTSW
LSHSSHIENSLSVIELLNSQ**i**ldy*nlnefvnilfphnqfil**illyfflfsfni
l**lpmvffkflk*ikiknknnnnnki

Frame A:
fffifffllkrepykliesnlnfqtillkliivkkikflfykn*kyykilkwvl*k*ekl
llnlhfqikmenyli*kilpvnl*lyffiqiildgfvlvkfvileivkiy*ngcrgnwn*
skhng*s*kisccs*sqlyyiir*krsdweaiwskwstsw*xnicy**krqdcfkssyfl
vipfity*klfecnriikfsimnliigllksq*ickyfistqsiyiiinfiiffplllqy
iiiitygff*ifkinknkk*k*****ni


Frame B:
fflffffy*keshin**nqi*ifrlyy*n***lkk*sfystkikniikf*ngyyenrrnc
s*iytsk*rwkii*skrfcr*tssyiflsk*ywmglys*sllf*r*LKFIEMGAEVIGIS
PNTMDNHKKFHAAHRVNYTILSDKNGAIGKLYGVNGLLPGXVTFVIDKNGKIALNHHTSW
LSHSSHIENSLSVIELLNSQ**i**ldy*nlnefvnilfphnqfil**illyfflfsfni
l**lpmvffkflk*ikiknknnnnnki


Frame C:
ffyffffikkrai*inrikfefsdytikinns*knkvfilqklkil*nfkmgimkigeia
peftlpnkdgklfnlkdfagkplviffypnnigwvctrevcyfrds*nllkwvqr*lelv
qtqwiiiknfmlliestilyyqikterlgsyme*mvyflvx*hllliktarll*iiilpg
ypihhilktl*v**ny*ilnnefnnwiikismnl*ifyfhtinlyynkfyyifssspsiy
ynnylwfflnf*nk*k*kikiiiiiky

Query= Contig-U05198-1 (Contig-U05198-1Q)
/CSM_Contig/Contig-U05198-1Q.Seq.d
         (804 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U05198-1 (Contig-U05198-1Q) /CSM_Contig/Conti...   900  0.0
Contig-U12416-1 (Contig-U12416-1Q) /CSM_Contig/Conti...    46  6e-05
Contig-U13874-1 (Contig-U13874-1Q) /CSM_Contig/Conti...    38  0.014
Contig-U10274-1 (Contig-U10274-1Q) /CSM_Contig/Conti...    38  0.014
Contig-U01937-1 (Contig-U01937-1Q) /CSM_Contig/Conti...    38  0.014
Contig-U11682-1 (Contig-U11682-1Q) /CSM_Contig/Conti...    36  0.057
Contig-U09182-1 (Contig-U09182-1Q) /CSM_Contig/Conti...    36  0.057
Contig-U06085-1 (Contig-U06085-1Q) /CSM_Contig/Conti...    36  0.057
Contig-U05197-1 (Contig-U05197-1Q) /CSM_Contig/Conti...    36  0.057
Contig-U03831-1 (Contig-U03831-1Q) /CSM_Contig/Conti...    36  0.057

>Contig-U05198-1 (Contig-U05198-1Q) /CSM_Contig/Contig-U05198-1Q.Seq.d
          Length = 804

 Score =  900 bits (454), Expect = 0.0
 Identities = 471/478 (98%)
 Strand = Plus / Plus

                                                                       
Query: 170 aggagaaattgctcctgaatttacacttccaaataaagatggaaaattatttaatctaaa 229
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 170 aggagaaattgctcctgaatttacacttccaaataaagatggaaaattatttaatctaaa 229

                                                                       
Query: 230 agattttgccggtaaacctctagttatannnnnnnatccaaataatattggatgggtttg 289
           ||||||||||||||||||||||||||||       |||||||||||||||||||||||||
Sbjct: 230 agattttgccggtaaacctctagttatatttttttatccaaataatattggatgggtttg 289

                                                                       
Query: 290 tactcgtgaagtttgttattttagagatagttaaaatttattgaaatgggtgcagaggta 349
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 290 tactcgtgaagtttgttattttagagatagttaaaatttattgaaatgggtgcagaggta 349

                                                                       
Query: 350 attggaattagtccaaacacaatggataatcataaaaaatttcatgctgctcatagagtc 409
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 350 attggaattagtccaaacacaatggataatcataaaaaatttcatgctgctcatagagtc 409

                                                                       
Query: 410 aactatactatattatcagataaaaacggagcgattgggaagctatatggagtaaatggt 469
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 410 aactatactatattatcagataaaaacggagcgattgggaagctatatggagtaaatggt 469

                                                                       
Query: 470 ctacttcctggtagngtaacatttgttattgataaaaacggcaagattgctttaaatcat 529
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 470 ctacttcctggtagngtaacatttgttattgataaaaacggcaagattgctttaaatcat 529

                                                                       
Query: 530 catacttcctggttatcccattcatcacatattgaaaactctttgagtgtaatagaatta 589
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 530 catacttcctggttatcccattcatcacatattgaaaactctttgagtgtaatagaatta 589

                                                                     
Query: 590 ttaaattctcaataatgaatttaataattggattattaaaatctcaatgaatttgtaa 647
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 590 ttaaattctcaataatgaatttaataattggattattaaaatctcaatgaatttgtaa 647


 Score =  125 bits (63), Expect = 8e-29
 Identities = 63/63 (100%)
 Strand = Plus / Plus

                                                                      
Query: 24 attaaaaagagagccatataaattaatagaatcaaatttgaattttcagactatactatt 83
          ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 24 attaaaaagagagccatataaattaatagaatcaaatttgaattttcagactatactatt 83

             
Query: 84 aaa 86
          |||
Sbjct: 84 aaa 86


 Score = 75.8 bits (38), Expect = 7e-14
 Identities = 38/38 (100%)
 Strand = Plus / Plus

                                                 
Query: 703 cctcttctccttcaatatattataataattacctatgg 740
           ||||||||||||||||||||||||||||||||||||||
Sbjct: 703 cctcttctccttcaatatattataataattacctatgg 740


>Contig-U12416-1 (Contig-U12416-1Q) /CSM_Contig/Contig-U12416-1Q.Seq.d
          Length = 1879

 Score = 46.1 bits (23), Expect = 6e-05
 Identities = 23/23 (100%)
 Strand = Plus / Plus

                                   
Query: 199  caaataaagatggaaaattattt 221
            |||||||||||||||||||||||
Sbjct: 1194 caaataaagatggaaaattattt 1216


>Contig-U13874-1 (Contig-U13874-1Q) /CSM_Contig/Contig-U13874-1Q.Seq.d
          Length = 1287

 Score = 38.2 bits (19), Expect = 0.014
 Identities = 19/19 (100%)
 Strand = Plus / Minus

                               
Query: 559  tattgaaaactctttgagt 577
            |||||||||||||||||||
Sbjct: 1116 tattgaaaactctttgagt 1098


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 9804
Number of Sequences: 6905
Number of extensions: 9804
Number of successful extensions: 936
Number of sequences better than 10.0: 92
length of query: 804
length of database: 5,674,871
effective HSP length: 16
effective length of query: 788
effective length of database: 5,564,391
effective search space: 4384740108
effective search space used: 4384740108
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)

Query= Contig-U05198-1 (Contig-U05198-1Q) /CSM_Contig/Contig-U05198-1Q.Seq.d
         (804 letters)

Database: ddbj_B
           105,743,758 sequences; 104,622,809,269 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(C89804) Dictyostelium discoideum slug cDNA, clone SSG175.        504   e-138  1
(AU073116) Dictyostelium discoideum slug cDNA, clone SSG175.      155   1e-57  2
(AU074140) Dictyostelium discoideum slug cDNA, clone SSJ615.      155   1e-54  2
(FH118851) CHO_OF3274xg11f1.ab1 CHO_OF3 Nicotiana tabacum ge...    44   1.3    2
(EJ090539) 1095460170615 Global-Ocean-Sampling_GS-26-01-01-1...    36   1.5    2
(BJ442878) Dictyostelium discoideum cDNA clone:ddv51a10, 3' ...    46   2.1    1
(BJ442278) Dictyostelium discoideum cDNA clone:ddv49k10, 3' ...    46   2.1    1
(FS238708) Glycyrrhiza uralensis cDNA, clone: H335_D1L1_P01_...    30   7.3    3
(AC176471) Strongylocentrotus purpuratus clone R3-3070D3, WO...    40   8.2    3
(AC174761) Gasterosteus aculeatus clone VMRC26-231K14, compl...    44   8.4    1
(AY086018) Arabidopsis thaliana clone 206791 mRNA, complete ...    44   8.4    1
(AL162751) Arabidopsis thaliana DNA chromosome 5, BAC clone ...    44   8.4    1
(AL161493) Arabidopsis thaliana DNA chromosome 4, contig fra...    44   8.4    1
(AK228148) Arabidopsis thaliana mRNA for transcription facto...    44   8.4    1
(AJ294532) Arabidopsis thaliana mRNA for DP-like protein (dp...    44   8.4    1
(AF001535) Arabidopsis thaliana chromosome IV cosmid AGAA, c...    44   8.4    1
(AF001308) Arabidopsis thaliana BAC T10M13 from chromosome I...    44   8.4    1
(AB493733) Arabidopsis thaliana At5g03415 mRNA for hypotheti...    44   8.4    1
(EA107781) Sequence 1549 from patent US 7196245.                   44   8.4    1
(EA107114) Sequence 609 from patent US 7196245.                    44   8.4    1
(DJ388727) Nucleic acid molecules encoding plant cell cycle ...    44   8.4    1
(DJ388649) Nucleic acid molecules encoding plant cell cycle ...    44   8.4    1
(DJ388621) Nucleic acid molecules encoding plant cell cycle ...    44   8.4    1
(CS240018) Sequence 8 from Patent WO2005117568.                    44   8.4    1
(CS240013) Sequence 3 from Patent WO2005117568.                    44   8.4    1
(CS240011) Sequence 1 from Patent WO2005117568.                    44   8.4    1
(AX461579) Sequence 508 from Patent WO0198480.                     44   8.4    1
(AX461336) Sequence 265 from Patent WO0198480.                     44   8.4    1
(AX449515) Sequence 234 from Patent WO0185946.                     44   8.4    1
(AX449342) Sequence 61 from Patent WO0185946.                      44   8.4    1
(AX449314) Sequence 33 from Patent WO0185946.                      44   8.4    1
(GP391941) Sequence 38673 from patent US 7511127.                  44   8.4    1
(GP105116) Sequence 38673 from patent US 7468248.                  44   8.4    1
(AC223006) Bos taurus clone CH240-432K13, WORKING DRAFT SEQU...    44   8.4    1
(AC184449) Strongylocentrotus purpuratus clone R3-4007I19, W...    44   8.4    1
(AC181819) Strongylocentrotus purpuratus clone R3-1023G22, W...    44   8.4    1
(BX831357) Arabidopsis thaliana Full-length cDNA Complete se...    44   8.4    1
(ET849466) CHO_OF445xn08r1.ab1 CHO_OF Nicotiana tabacum geno...    44   8.4    1
(ET849386) CHO_OF445xn08f2.ab1 CHO_OF Nicotiana tabacum geno...    44   8.4    1
(ET849310) CHO_OF445xn08f1.ab1 CHO_OF Nicotiana tabacum geno...    44   8.4    1
(EK440960) 1091120566165 Global-Ocean-Sampling_GS-32-01-01-1...    44   8.4    1
(BX894390) Arabidopsis thaliana T-DNA flanking sequence GK-6...    44   8.4    1
(BX894389) Arabidopsis thaliana T-DNA flanking sequence GK-6...    44   8.4    1
(BX003943) Arabidopsis thaliana T-DNA flanking sequence GK-3...    44   8.4    1
(DB632921) Halocynthia roretzi cDNA clone:man13k08, 3' end.        44   8.4    1
(DB619985) Halocynthia roretzi cDNA clone:mae22g21, 3' end.        44   8.4    1
(DB618436) Halocynthia roretzi cDNA clone:mae13p14, 3' end.        44   8.4    1
(DB610545) Halocynthia roretzi cDNA clone:mae22g21, 5' end.        44   8.4    1
(DB604072) Halocynthia roretzi cDNA clone:ma338b22, 3' end.        44   8.4    1
(DB592852) Halocynthia roretzi cDNA clone:ma305e06, 3' end.        44   8.4    1
(BA000034) Streptococcus pyogenes SSI-1 DNA, complete genome.      44   8.4    1
(AE014074) Streptococcus pyogenes MGAS315, complete genome.        44   8.4    1
(AC200999) Strongylocentrotus purpuratus clone R3-12D5, WORK...    40   9.7    2

>(C89804) Dictyostelium discoideum slug cDNA, clone SSG175.
          Length = 487

 Score =  504 bits (254), Expect = e-138
 Identities = 256/257 (99%)
 Strand = Plus / Plus


Query: 322 aaaatttattgaaatgggtgcagaggtaattggaattagtccaaacacaatggataatca 381
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   aaaatttattgaaatgggtgcagaggtaattggaattagtccaaacacaatggataatca 60


Query: 382 taaaaaatttcatgctgctcatagagtcaactatactatattatcagataaaaacggagc 441
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  taaaaaatttcatgctgctcatagagtcaactatactatattatcagataaaaacggagc 120


Query: 442 gattgggaagctatatggagtaaatggtctacttcctggtagngtaacatttgttattga 501
           |||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||
Sbjct: 121 gattgggaagctatatggagtaaatggtctacttcctggtagggtaacatttgttattga 180


Query: 502 taaaaacggcaagattgctttaaatcatcatacttcctggttatcccattcatcacatat 561
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 taaaaacggcaagattgctttaaatcatcatacttcctggttatcccattcatcacatat 240


Query: 562 tgaaaactctttgagtg 578
           |||||||||||||||||
Sbjct: 241 tgaaaactctttgagtg 257

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 105743758
Number of Hits to DB: 594,383,217
Number of extensions: 34965978
Number of successful extensions: 2753881
Number of sequences better than 10.0: 57
Length of query: 804
Length of database: 104,622,809,269
Length adjustment: 24
Effective length of query: 780
Effective length of database: 102,084,959,077
Effective search space: 79626268080060
Effective search space used: 79626268080060
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

Query= Contig-U05198-1 (Contig-U05198-1Q) /CSM_Contig/Contig-U05198-1Q.Seq.d
         (804 letters)

Database: nrp_A
           3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC115598_28(AC115598|pid:none) Dictyostelium discoideum chromoso...    85   1e-28
CP000875_4701(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ...    74   8e-22
CP001344_3442(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    72   1e-21
EF084660_1(EF084660|pid:none) Picea sitchensis clone WS02718_F07...    64   1e-20
EF083780_1(EF083780|pid:none) Picea sitchensis clone WS02720_H21...    65   2e-20
EF084656_1(EF084656|pid:none) Picea sitchensis clone WS02722_E06...    65   2e-20
(Q75SY5) RecName: Full=Peroxiredoxin Q, chloroplastic;          ...    65   2e-20
CP001291_4924(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    66   4e-20
AP008231_2152(AP008231|pid:none) Synechococcus elongatus PCC 630...    63   7e-20
(Q9LU86) RecName: Full=Peroxiredoxin Q, chloroplastic;          ...    64   9e-20
(Q6QPJ6) RecName: Full=Peroxiredoxin Q, chloroplastic;          ...    63   1e-19
CP000685_265(CP000685|pid:none) Flavobacterium johnsoniae UW101,...    66   2e-19
CP000117_3860(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    66   2e-19
CU207366_2334(CU207366|pid:none) Gramella forsetii KT0803 comple...    68   4e-19
AM778955_101(AM778955|pid:none) Microcystis aeruginosa PCC 7806 ...    65   4e-19
(P0C5D4) RecName: Full=Putative peroxiredoxin Q, chloroplastic; ...    62   7e-19
AL445064_33(AL445064|pid:none) Thermoplasma acidophilum complete...    60   7e-19
AM746676_4625(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    70   1e-18
BT051537_1(BT051537|pid:none) Medicago truncatula clone MTYF1_F2...    64   3e-18
BA000023_788(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ...    63   6e-18
AM398681_1737(AM398681|pid:none) Flavobacterium psychrophilum JI...    72   3e-17
CP000113_6372(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    67   1e-16
AE017261_442(AE017261|pid:none) Picrophilus torridus DSM 9790, c...    58   1e-16
AE017261_403(AE017261|pid:none) Picrophilus torridus DSM 9790, c...    68   7e-16
CP000682_1295(CP000682|pid:none) Metallosphaera sedula DSM 5348,...    67   9e-16
CP000682_359(CP000682|pid:none) Metallosphaera sedula DSM 5348, ...    54   7e-15
CP001399_874(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ...    57   7e-15
CP000922_368(CP000922|pid:none) Anoxybacillus flavithermus WK1, ...    53   7e-15
CR931997_503(CR931997|pid:none) Corynebacterium jeikeium K411 co...    59   9e-15
AE006641_2072(AE006641|pid:none) Sulfolobus solfataricus P2, com...    58   3e-14
CP000878_1511(CP000878|pid:none) Prochlorococcus marinus str. MI...    52   5e-14
AE017225_493(AE017225|pid:none) Bacillus anthracis str. Sterne, ...    60   8e-14
AE016879_499(AE016879|pid:none) Bacillus anthracis str. Ames, co...    60   8e-14
AE017355_437(AE017355|pid:none) Bacillus thuringiensis serovar k...    59   1e-13
CP001186_450(CP001186|pid:none) Bacillus cereus G9842, complete ...    58   1e-13
CP001400_68(CP001400|pid:none) Sulfolobus islandicus M.14.25, co...    56   1e-13
AE016877_445(AE016877|pid:none) Bacillus cereus ATCC 14579, comp...    58   1e-13
CP000909_1960(CP000909|pid:none) Chloroflexus aurantiacus J-10-f...    58   1e-13
CP001176_464(CP001176|pid:none) Bacillus cereus B4264, complete ...    58   1e-13
AL111168_244(AL111168|pid:none) Campylobacter jejuni subsp. jeju...    51   2e-13
CP000656_2516(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c...    54   3e-13
CP000393_3455(CP000393|pid:none) Trichodesmium erythraeum IMS101...    54   3e-13
CP000792_1732(CP000792|pid:none) Campylobacter concisus 13826, c...    50   4e-13
AE017194_590(AE017194|pid:none) Bacillus cereus ATCC 10987, comp...    59   4e-13
CP000227_507(CP000227|pid:none) Bacillus cereus Q1, complete gen...    59   4e-13
CP000554_1887(CP000554|pid:none) Prochlorococcus marinus str. MI...    50   5e-13
AM286690_774(AM286690|pid:none) Alcanivorax borkumensis SK2, com...    52   6e-13
CP000077_1047(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6...    49   6e-13
CP000431_1008(CP000431|pid:none) Rhodococcus jostii RHA1, comple...    55   6e-13
CP001130_1399(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c...    52   8e-13
AP006618_1867(AP006618|pid:none) Nocardia farcinica IFM 10152 DN...    50   8e-13
CP000878_89(CP000878|pid:none) Prochlorococcus marinus str. MIT ...    59   1e-12
CP001337_1988(CP001337|pid:none) Chloroflexus aggregans DSM 9485...    54   1e-12
AP008955_1061(AP008955|pid:none) Brevibacillus brevis NBRC 10059...    49   1e-12
CP001100_622(CP001100|pid:none) Chloroherpeton thalassium ATCC 3...    55   1e-12
CP000814_246(CP000814|pid:none) Campylobacter jejuni subsp. jeju...    51   1e-12
AE006470_1974(AE006470|pid:none) Chlorobium tepidum TLS, complet...    54   1e-12
AP009044_2449(AP009044|pid:none) Corynebacterium glutamicum R DN...    57   1e-12
CP000479_1584(CP000479|pid:none) Mycobacterium avium 104, comple...    53   1e-12
AM180355_1878(AM180355|pid:none) Clostridium difficile 630 compl...    58   1e-12
BA000036_2489(BA000036|pid:none) Corynebacterium glutamicum ATCC...    57   1e-12
CP000110_1114(CP000110|pid:none) Synechococcus sp. CC9605, compl...    53   1e-12
BX548174_366(BX548174|pid:none) Prochlorococcus marinus MED4 com...    54   1e-12
AE006468_2421(AE006468|pid:none) Salmonella enterica subsp. ente...    58   2e-12
BA000028_903(BA000028|pid:none) Oceanobacillus iheyensis HTE831 ...    52   2e-12
CP000095_125(CP000095|pid:none) Prochlorococcus marinus str. NAT...    60   2e-12
CP000964_1297(CP000964|pid:none) Klebsiella pneumoniae 342, comp...    57   3e-12
CP001097_1984(CP001097|pid:none) Chlorobium limicola DSM 245, co...    56   3e-12
BX548175_471(BX548175|pid:none) Prochlorococcus marinus MIT9313 ...    50   3e-12
CP001078_2977(CP001078|pid:none) Clostridium botulinum E3 str. A...    57   3e-12
CP000097_1306(CP000097|pid:none) Synechococcus sp. CC9902, compl...    54   3e-12
BX571868_79(BX571868|pid:none) Photorhabdus luminescens subsp. l...    57   4e-12
CP000435_1522(CP000435|pid:none) Synechococcus sp. CC9311, compl...    48   4e-12
AM420293_1187(AM420293|pid:none) Saccharopolyspora erythraea NRR...    59   5e-12
CU928158_653(CU928158|pid:none) Escherichia fergusonii ATCC 3546...    59   5e-12
CP000384_3629(CP000384|pid:none) Mycobacterium sp. MCS, complete...    56   5e-12
CP001654_1056(CP001654|pid:none) Dickeya dadantii Ech703, comple...    58   5e-12
CT978603_1342(CT978603|pid:none) Synechococcus sp. RCC307 genomi...    47   5e-12
CP000111_370(CP000111|pid:none) Prochlorococcus marinus str. MIT...    49   5e-12
CP001100_1316(CP001100|pid:none) Chloroherpeton thalassium ATCC ...    48   7e-12
CP000305_1318(CP000305|pid:none) Yersinia pestis Nepal516, compl...    57   7e-12
CP000875_4689(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ...    57   7e-12
CP000733_987(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1...    55   8e-12
AP010872_71(AP010872|pid:none) Candidatus Ishikawaella capsulata...    57   9e-12
AM260525_1055(AM260525|pid:none) Bartonella tribocorum CIP 10547...    52   9e-12
CP000557_484(CP000557|pid:none) Geobacillus thermodenitrificans ...    60   9e-12
CP000822_291(CP000822|pid:none) Citrobacter koseri ATCC BAA-895,...    58   9e-12
AE017126_93(AE017126|pid:none) Prochlorococcus marinus subsp. ma...    65   9e-12
AE017180_3427(AE017180|pid:none) Geobacter sulfurreducens PCA, c...    60   9e-12
BA000004_948(BA000004|pid:none) Bacillus halodurans C-125 DNA, c...    54   9e-12
CP000552_383(CP000552|pid:none) Prochlorococcus marinus str. MIT...    50   9e-12
CP000551_382(CP000551|pid:none) Prochlorococcus marinus str. AS9...    48   9e-12
CP001562_939(CP001562|pid:none) Bartonella grahamii as4aup, comp...    49   1e-11
CT573213_4344(CT573213|pid:none) Frankia alni str. ACN14A chromo...    47   1e-11
CP001110_334(CP001110|pid:none) Pelodictyon phaeoclathratiforme ...    55   1e-11
CP001287_1575(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...    51   1e-11
CP001600_1144(CP001600|pid:none) Edwardsiella ictaluri 93-146, c...    55   1e-11
CP001110_1987(CP001110|pid:none) Pelodictyon phaeoclathratiforme...    51   1e-11
CP000282_1656(CP000282|pid:none) Saccharophagus degradans 2-40, ...    48   1e-11
CP000095_1578(CP000095|pid:none) Prochlorococcus marinus str. NA...    48   1e-11
DQ366719_7(DQ366719|pid:none) Uncultured Prochlorococcus marinus...    47   1e-11
CP001287_3350(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...    50   2e-11
CP000767_228(CP000767|pid:none) Campylobacter curvus 525.92, com...    49   2e-11
CU468135_1064(CU468135|pid:none) Erwinia tasmaniensis strain ET1...    59   2e-11
CP000097_382(CP000097|pid:none) Synechococcus sp. CC9902, comple...    58   2e-11
CP000239_642(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, comp...    51   2e-11
CP001291_3548(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    50   2e-11
AE016828_835(AE016828|pid:none) Coxiella burnetii RSA 493, compl...    55   2e-11
CP000480_4588(CP000480|pid:none) Mycobacterium smegmatis str. MC...    52   2e-11
CP000435_2463(CP000435|pid:none) Synechococcus sp. CC9311, compl...    58   2e-11
CP001146_273(CP001146|pid:none) Dictyoglomus thermophilum H-6-12...    47   2e-11
(Q83CY8) RecName: Full=Putative peroxiredoxin bcp;          EC=1...    55   2e-11
CP000607_289(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2...    50   2e-11
CP000481_1678(CP000481|pid:none) Acidothermus cellulolyticus 11B...    59   3e-11
CP001099_652(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ...    54   3e-11
CP000390_1776(CP000390|pid:none) Mesorhizobium sp. BNC1, complet...    50   3e-11
CP000686_3469(CP000686|pid:none) Roseiflexus sp. RS-1, complete ...    48   3e-11
CP000325_1314(CP000325|pid:none) Mycobacterium ulcerans Agy99, c...    47   3e-11
CP000576_381(CP000576|pid:none) Prochlorococcus marinus str. MIT...    47   3e-11
BA000045_3389(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...    50   4e-11
A72762(A72762) probable bacterioferritin comigratory protein APE...    52   4e-11
AP011115_1132(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp...    53   4e-11
AP006627_1314(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c...    53   4e-11
CP001656_829(CP001656|pid:none) Paenibacillus sp. JDR-2, complet...    55   4e-11
CP000804_1291(CP000804|pid:none) Roseiflexus castenholzii DSM 13...    49   4e-11
CP001251_368(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ...    49   4e-11
CP000108_204(CP000108|pid:none) Chlorobium chlorochromatii CaD3,...    52   4e-11
CP000240_1032(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1...    50   4e-11
AM778930_8(AM778930|pid:none) Microcystis aeruginosa PCC 7806 ge...    49   4e-11
AP009552_6093(AP009552|pid:none) Microcystis aeruginosa NIES-843...    49   4e-11
CP000116_2006(CP000116|pid:none) Thiobacillus denitrificans ATCC...    50   5e-11
CP001019_932(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com...    54   5e-11
CP000653_2950(CP000653|pid:none) Enterobacter sp. 638, complete ...    58   5e-11
CP000947_1743(CP000947|pid:none) Haemophilus somnus 2336, comple...    56   5e-11
CP000384_3039(CP000384|pid:none) Mycobacterium sp. MCS, complete...    52   5e-11
A96940(A96940) bacterioferritin comigratory protein (AHPC/TSA fa...    55   5e-11
BA000039_1197(BA000039|pid:none) Thermosynechococcus elongatus B...    53   5e-11
AE016958_1302(AE016958|pid:none) Mycobacterium avium subsp. para...    46   7e-11
CP001472_2508(CP001472|pid:none) Acidobacterium capsulatum ATCC ...    45   7e-11
BX248342_268(BX248342|pid:none) Mycobacterium bovis subsp. bovis...    51   7e-11
CP000776_485(CP000776|pid:none) Campylobacter hominis ATCC BAA-3...    50   9e-11
(Q9ZHF0) RecName: Full=Putative peroxiredoxin bcp;          EC=1...    54   9e-11
AE000516_2683(AE000516|pid:none) Mycobacterium tuberculosis CDC1...    51   9e-11
CP001656_5822(CP001656|pid:none) Paenibacillus sp. JDR-2, comple...    52   9e-11
CP001607_138(CP001607|pid:none) Aggregatibacter aphrophilus NJ87...    52   9e-11
AM942444_1450(AM942444|pid:none) Corynebacterium urealyticum DSM...    49   1e-10
CP000817_316(CP000817|pid:none) Lysinibacillus sphaericus C3-41,...    49   1e-10
AP009178_1538(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom...    45   1e-10
CP000575_390(CP000575|pid:none) Staphylothermus marinus F1, comp...    49   1e-10
CP001344_4836(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    55   1e-10
CP001037_467(CP001037|pid:none) Nostoc punctiforme PCC 73102, co...    52   1e-10
CP000774_3252(CP000774|pid:none) Parvibaculum lavamentivorans DS...    47   1e-10
AE008691_1462(AE008691|pid:none) Thermoanaerobacter tengcongensi...    56   2e-10
CP000133_2224(CP000133|pid:none) Rhizobium etli CFN 42, complete...    51   2e-10
(Q796Y8) RecName: Full=Putative peroxiredoxin ygaF;          EC=...    50   2e-10
CP000568_1452(CP000568|pid:none) Clostridium thermocellum ATCC 2...    49   2e-10
CP001124_219(CP001124|pid:none) Geobacter bemidjiensis Bem, comp...    46   2e-10
CP000507_1903(CP000507|pid:none) Shewanella amazonensis SB2B, co...    50   2e-10
BA000045_2375(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...    50   2e-10
CP001601_2067(CP001601|pid:none) Corynebacterium aurimucosum ATC...    52   3e-10
CP001074_2332(CP001074|pid:none) Rhizobium etli CIAT 652, comple...    50   3e-10
CP000930_2879(CP000930|pid:none) Heliobacterium modesticaldum Ic...    47   3e-10
CP000560_817(CP000560|pid:none) Bacillus amyloliquefaciens FZB42...    51   3e-10
CP001016_12(CP001016|pid:none) Beijerinckia indica subsp. indica...    49   3e-10
CP001291_4175(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    47   3e-10
CP001341_2245(CP001341|pid:none) Arthrobacter chlorophenolicus A...    45   3e-10
CP000110_2257(CP000110|pid:none) Synechococcus sp. CC9605, compl...    55   3e-10
BA000012_3(BA000012|pid:none) Mesorhizobium loti MAFF303099 DNA,...    50   3e-10
CP000383_1867(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334...    52   3e-10
CP000910_1013(CP000910|pid:none) Renibacterium salmoninarum ATCC...    48   3e-10
CP000473_3555(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    47   3e-10
CP000089_2339(CP000089|pid:none) Dechloromonas aromatica RCB, co...    51   3e-10
CP000492_855(CP000492|pid:none) Chlorobium phaeobacteroides DSM ...    50   3e-10
CP000633_1385(CP000633|pid:none) Agrobacterium vitis S4 chromoso...    48   3e-10
CP001108_756(CP001108|pid:none) Prosthecochloris aestuarii DSM 2...    48   3e-10
CP000553_1559(CP000553|pid:none) Prochlorococcus marinus str. NA...    44   3e-10
AE000516_1693(AE000516|pid:none) Mycobacterium tuberculosis CDC1...    46   4e-10
CR543861_767(CR543861|pid:none) Acinetobacter sp. ADP1 complete ...    46   5e-10
CP000923_1817(CP000923|pid:none) Thermoanaerobacter sp. X514, co...    54   6e-10
H72518(H72518)probable bacterioferritin comigratory protein APE2...    57   6e-10
CP000454_3669(CP000454|pid:none) Arthrobacter sp. FB24, complete...    54   6e-10
CP001191_1892(CP001191|pid:none) Rhizobium leguminosarum bv. tri...    49   6e-10
AP009493_4644(AP009493|pid:none) Streptomyces griseus subsp. gri...    54   6e-10
AM778900_3(AM778900|pid:none) Microcystis aeruginosa PCC 7806 ge...    47   6e-10
CP001131_2916(CP001131|pid:none) Anaeromyxobacter sp. K, complet...    47   7e-10
AE010300_3439(AE010300|pid:none) Leptospira interrogans serovar ...    44   7e-10
AE000512_768(AE000512|pid:none) Thermotoga maritima MSB8, comple...    53   7e-10
CP000644_3156(CP000644|pid:none) Aeromonas salmonicida subsp. sa...    47   7e-10
CP000462_860(CP000462|pid:none) Aeromonas hydrophila subsp. hydr...    47   7e-10
AE015925_965(AE015925|pid:none) Chlamydophila caviae GPIC, compl...    46   9e-10
AM746676_7117(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    45   9e-10
BA000039_1193(BA000039|pid:none) Thermosynechococcus elongatus B...    44   9e-10
EU016597_41(EU016597|pid:none) Uncultured Group I marine crenarc...    51   9e-10
AP009552_4489(AP009552|pid:none) Microcystis aeruginosa NIES-843...    47   9e-10
AL954747_772(AL954747|pid:none) Nitrosomonas europaea ATCC 19718...    47   9e-10
CU459003_1047(CU459003|pid:none) Magnetospirillum gryphiswaldens...    44   9e-10
CP000109_785(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ...    49   1e-09
CP000254_2513(CP000254|pid:none) Methanospirillum hungatei JF-1,...    47   1e-09
CP000016_502(CP000016|pid:none) Candidatus Blochmannia pennsylva...    45   1e-09
CP000524_756(CP000524|pid:none) Bartonella bacilliformis KC583, ...    44   1e-09
CP001103_2119(CP001103|pid:none) Alteromonas macleodii 'Deep eco...    46   1e-09
CP000284_1183(CP000284|pid:none) Methylobacillus flagellatus KT,...    44   2e-09
CP001359_3004(CP001359|pid:none) Anaeromyxobacter dehalogenans 2...    46   2e-09
CP000820_5517(CP000820|pid:none) Frankia sp. EAN1pec, complete g...    53   2e-09
CP001322_2187(CP001322|pid:none) Desulfatibacillum alkenivorans ...    47   2e-09
CP000108_1578(CP000108|pid:none) Chlorobium chlorochromatii CaD3...    49   2e-09
AM236080_2592(AM236080|pid:none) Rhizobium leguminosarum bv. vic...    48   2e-09
CP000312_232(CP000312|pid:none) Clostridium perfringens SM101, c...    54   2e-09
BA000016_267(BA000016|pid:none) Clostridium perfringens str. 13 ...    54   2e-09
CP000246_247(CP000246|pid:none) Clostridium perfringens ATCC 131...    54   2e-09
CP000628_1918(CP000628|pid:none) Agrobacterium radiobacter K84 c...    51   2e-09
CP000777_428(CP000777|pid:none) Leptospira biflexa serovar Patoc...    48   2e-09
CP000866_556(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c...    49   2e-09
AC116963_26(AC116963|pid:none) Dictyostelium discoideum chromoso...    44   2e-09
CP001101_1619(CP001101|pid:none) Chlorobium phaeobacteroides BS1...    47   3e-09
CP000758_2246(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918...    47   3e-09
BA000002_1386(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple...    54   3e-09
CP001280_1582(CP001280|pid:none) Methylocella silvestris BL2, co...    43   3e-09
CP000607_1126(CP000607|pid:none) Chlorobium phaeovibrioides DSM ...    49   3e-09
BA000030_5183(BA000030|pid:none) Streptomyces avermitilis MA-468...    51   3e-09
CP000377_1091(CP000377|pid:none) Silicibacter sp. TM1040, comple...    44   3e-09
AE015929_1547(AE015929|pid:none) Staphylococcus epidermidis ATCC...    47   3e-09
CP001341_3396(CP001341|pid:none) Arthrobacter chlorophenolicus A...    48   4e-09
CP000554_260(CP000554|pid:none) Prochlorococcus marinus str. MIT...    57   5e-09
CP001472_2179(CP001472|pid:none) Acidobacterium capsulatum ATCC ...    53   5e-09
CP000672_639(CP000672|pid:none) Haemophilus influenzae PittGG, c...    52   5e-09
CP000738_1460(CP000738|pid:none) Sinorhizobium medicae WSM419, c...    45   5e-09
CP000656_3581(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c...    43   5e-09
CP001037_2183(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    42   6e-09
DQ366739_8(DQ366739|pid:none) Uncultured Prochlorococcus marinus...    45   6e-09
CP000383_558(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340...    50   6e-09
BA000045_2376(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...    47   6e-09
CR378672_161(CR378672|pid:none) Photobacterium profundum SS9; se...    49   6e-09
CP000474_3372(CP000474|pid:none) Arthrobacter aurescens TC1, com...    48   6e-09
AL939131_102(AL939131|pid:none) Streptomyces coelicolor A3(2) co...    45   6e-09
CP000852_222(CP000852|pid:none) Caldivirga maquilingensis IC-167...    46   6e-09
CP000473_7602(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    45   6e-09
CP000111_956(CP000111|pid:none) Prochlorococcus marinus str. MIT...    44   7e-09
CP000916_1799(CP000916|pid:none) Thermotoga neapolitana DSM 4359...    49   8e-09
BX897699_848(BX897699|pid:none) Bartonella henselae strain Houst...    45   8e-09
CR848038_929(CR848038|pid:none) Chlamydophila abortus strain S26...    47   1e-08
CP000436_500(CP000436|pid:none) Haemophilus somnus 129PT, comple...    50   1e-08
CP000820_6065(CP000820|pid:none) Frankia sp. EAN1pec, complete g...    45   1e-08
AM398681_1069(AM398681|pid:none) Flavobacterium psychrophilum JI...    52   1e-08
CP001102_935(CP001102|pid:none) Candidatus Amoebophilus asiaticu...    48   1e-08
CU458896_2639(CU458896|pid:none) Mycobacterium abscessus chromos...    43   1e-08
CP000511_2769(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1...    44   1e-08
AP006861_34(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA, ...    44   1e-08
CP000552_984(CP000552|pid:none) Prochlorococcus marinus str. MIT...    48   1e-08
CP000825_986(CP000825|pid:none) Prochlorococcus marinus str. MIT...    47   1e-08
AP010904_3370(AP010904|pid:none) Desulfovibrio magneticus RS-1 D...    45   1e-08
BA000039_1450(BA000039|pid:none) Thermosynechococcus elongatus B...    45   1e-08
BX548174_1030(BX548174|pid:none) Prochlorococcus marinus MED4 co...    50   2e-08
AY033236_12(AY033236|pid:none) Propionibacterium freudenreichii ...    44   2e-08
CP000687_808(CP000687|pid:none) Actinobacillus pleuropneumoniae ...    50   2e-08
CP000667_1101(CP000667|pid:none) Salinispora tropica CNB-440, co...    47   2e-08
CP000850_980(CP000850|pid:none) Salinispora arenicola CNS-205, c...    46   2e-08
AE016825_2815(AE016825|pid:none) Chromobacterium violaceum ATCC ...    41   2e-08
CP001390_1955(CP001390|pid:none) Geobacter sp. FRC-32, complete ...    49   2e-08
CP000095_925(CP000095|pid:none) Prochlorococcus marinus str. NAT...    42   2e-08
CP000360_2811(CP000360|pid:none) Acidobacteria bacterium Ellin34...    45   2e-08
AH2118(AH2118) bacterioferritin comigratory protein [imported] -...    44   2e-08
AM711867_1079(AM711867|pid:none) Clavibacter michiganensis subsp...    50   3e-08
CP000117_435(CP000117|pid:none) Anabaena variabilis ATCC 29413, ...    43   3e-08
AE014291_896(AE014291|pid:none) Brucella suis 1330 chromosome I,...    46   3e-08
AC3383(AC3383) bacterioferritin comigratory protein [imported] -...    46   3e-08
CP000685_2429(CP000685|pid:none) Flavobacterium johnsoniae UW101...    54   3e-08
CP000097_1070(CP000097|pid:none) Synechococcus sp. CC9902, compl...    45   4e-08
CP001095_1418(CP001095|pid:none) Bifidobacterium longum subsp. i...    42   4e-08
CP000908_2944(CP000908|pid:none) Methylobacterium extorquens PA1...    44   4e-08
CP001628_799(CP001628|pid:none) Micrococcus luteus NCTC 2665, co...    50   4e-08
CP000030_473(CP000030|pid:none) Anaplasma marginale str. St. Mar...    43   4e-08
CP000454_2524(CP000454|pid:none) Arthrobacter sp. FB24, complete...    49   4e-08
EF552687_4(EF552687|pid:none) Streptomyces albus strain JA3453 o...    43   4e-08
CP001510_2963(CP001510|pid:none) Methylobacterium extorquens AM1...    44   4e-08
AE017283_1628(AE017283|pid:none) Propionibacterium acnes KPA1712...    43   5e-08
CP001281_2231(CP001281|pid:none) Thauera sp. MZ1T, complete geno...    45   5e-08
CP000362_2787(CP000362|pid:none) Roseobacter denitrificans OCh 1...    45   5e-08
CP000010_1190(CP000010|pid:none) Burkholderia mallei ATCC 23344 ...    42   5e-08
BX571965_1486(BX571965|pid:none) Burkholderia pseudomallei strai...    42   5e-08
AP009385_1802(AP009385|pid:none) Burkholderia multivorans ATCC 1...    41   5e-08
CP000828_1107(CP000828|pid:none) Acaryochloris marina MBIC11017,...    61   5e-08
CP000852_178(CP000852|pid:none) Caldivirga maquilingensis IC-167...    49   6e-08
AY142842_1(AY142842|pid:none) Heliobacillus mobilis bacterioferr...    48   6e-08
AE017282_636(AE017282|pid:none) Methylococcus capsulatus str. Ba...    42   6e-08
CP001091_903(CP001091|pid:none) Actinobacillus pleuropneumoniae ...    49   6e-08
CP001100_1460(CP001100|pid:none) Chloroherpeton thalassium ATCC ...    46   6e-08
CP000855_852(CP000855|pid:none) Thermococcus onnurineus NA1, com...    40   8e-08
AE017143_1415(AE017143|pid:none) Haemophilus ducreyi strain 3500...    50   8e-08
BA000011_289(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,...    49   8e-08
BA000037_2506(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch...    49   8e-08
CP000449_1302(CP000449|pid:none) Maricaulis maris MCS10, complet...    42   8e-08
CP000084_811(CP000084|pid:none) Candidatus Pelagibacter ubique H...    42   8e-08
CP000553_145(CP000553|pid:none) Prochlorococcus marinus str. NAT...    60   8e-08
CP001620_1335(CP001620|pid:none) Corynebacterium kroppenstedtii ...    45   1e-07
CP001230_359(CP001230|pid:none) Persephonella marina EX-H1, comp...    42   1e-07
CP000240_1346(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1...    43   1e-07
CP000151_1976(CP000151|pid:none) Burkholderia sp. 383 chromosome...    40   1e-07
CP001185_692(CP001185|pid:none) Thermosipho africanus TCF52B, co...    45   1e-07
CP001279_1348(CP001279|pid:none) Nautilia profundicola AmH, comp...    42   1e-07
CP000820_3599(CP000820|pid:none) Frankia sp. EAN1pec, complete g...    41   1e-07
CP001124_2927(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    60   1e-07
BA000022_148(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA, ...    43   1e-07
CP000553_971(CP000553|pid:none) Prochlorococcus marinus str. NAT...    41   1e-07
CR555306_3699(CR555306|pid:none) Azoarcus sp. EbN1 complete geno...    41   1e-07
AE016795_1766(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos...    49   1e-07
CP000096_627(CP000096|pid:none) Pelodictyon luteolum DSM 273, co...    44   1e-07
CP000613_1582(CP000613|pid:none) Rhodospirillum centenum SW, com...    45   2e-07
AP009552_1532(AP009552|pid:none) Microcystis aeruginosa NIES-843...    40   2e-07
CP000569_834(CP000569|pid:none) Actinobacillus pleuropneumoniae ...    47   2e-07
CP000951_1090(CP000951|pid:none) Synechococcus sp. PCC 7002, com...    45   2e-07
CP000319_2224(CP000319|pid:none) Nitrobacter hamburgensis X14, c...    49   3e-07
CP000112_1027(CP000112|pid:none) Desulfovibrio desulfuricans G20...    43   3e-07
CP000825_93(CP000825|pid:none) Prochlorococcus marinus str. MIT ...    53   3e-07
CP001185_1005(CP001185|pid:none) Thermosipho africanus TCF52B, c...    42   3e-07
CP001029_3124(CP001029|pid:none) Methylobacterium populi BJ001, ...    42   3e-07
CU207366_1762(CU207366|pid:none) Gramella forsetii KT0803 comple...    50   3e-07
CP001145_1040(CP001145|pid:none) Coprothermobacter proteolyticus...    43   3e-07
CP000771_1356(CP000771|pid:none) Fervidobacterium nodosum Rt17-B...    41   3e-07
CP001634_1217(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c...    45   4e-07
CP000111_85(CP000111|pid:none) Prochlorococcus marinus str. MIT ...    53   4e-07
AP009153_2500(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN...    40   4e-07
(P55979) RecName: Full=Putative peroxiredoxin bcp;          EC=1...    44   4e-07
EU016640_14(EU016640|pid:none) Uncultured Group I marine crenarc...    43   5e-07
BX569692_226(BX569692|pid:none) Synechococcus sp. WH8102 complet...    49   5e-07
CP001291_2857(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    39   5e-07
AM747720_1932(AM747720|pid:none) Burkholderia cenocepacia J2315 ...    39   5e-07
CP000241_135(CP000241|pid:none) Helicobacter pylori HPAG1, compl...    44   5e-07
CP001217_134(CP001217|pid:none) Helicobacter pylori P12, complet...    44   5e-07
CP001173_116(CP001173|pid:none) Helicobacter pylori G27, complet...    44   5e-07
AM420293_1844(AM420293|pid:none) Saccharopolyspora erythraea NRR...    43   5e-07
BA000040_4324(BA000040|pid:none) Bradyrhizobium japonicum USDA 1...    45   6e-07
CP001213_1384(CP001213|pid:none) Bifidobacterium animalis subsp....    42   6e-07
CP000142_2488(CP000142|pid:none) Pelobacter carbinolicus DSM 238...    52   6e-07
CP000440_1794(CP000440|pid:none) Burkholderia ambifaria AMMD chr...    40   6e-07
CP000380_726(CP000380|pid:none) Burkholderia cenocepacia AU 1054...    39   6e-07
CP000463_2950(CP000463|pid:none) Rhodopseudomonas palustris BisA...    49   8e-07
AE000513_1188(AE000513|pid:none) Deinococcus radiodurans R1 chro...    41   8e-07
A83520(A83520) bacterioferritin comigratory protein PA1008 [impo...    39   8e-07
AE004437_925(AE004437|pid:none) Halobacterium sp. NRC-1, complet...    50   8e-07
CP000943_5546(CP000943|pid:none) Methylobacterium sp. 4-46, comp...    42   8e-07
CP000143_1566(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c...    41   8e-07
CP001025_1756(CP001025|pid:none) Burkholderia ambifaria MC40-6 c...    40   8e-07
CP001099_235(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ...    57   9e-07
AY625502_1(AY625502|pid:none) Glossina morsitans morsitans clone...    40   1e-06
CP001463_1697(CP001463|pid:none) Thermococcus sibiricus MM 739, ...    43   1e-06
AM114193_1554(AM114193|pid:none) Uncultured methanogenic archaeo...    43   1e-06
AE000513_831(AE000513|pid:none) Deinococcus radiodurans R1 chrom...    47   1e-06
AE017354_2780(AE017354|pid:none) Legionella pneumophila subsp. p...    42   1e-06
CP001503_1343(CP001503|pid:none) Burkholderia glumae BGR1 chromo...    39   1e-06
CP001196_1960(CP001196|pid:none) Oligotropha carboxidovorans OM5...    45   1e-06
CP000115_1663(CP000115|pid:none) Nitrobacter winogradskyi Nb-255...    47   1e-06
CP001389_1498(CP001389|pid:none) Rhizobium sp. NGR234, complete ...    41   1e-06
CR628336_2904(CR628336|pid:none) Legionella pneumophila str. Par...    42   1e-06
CT573073_286(CT573073|pid:none) Kuenenia stuttgartiensis genome ...    40   2e-06
AE008384_849(AE008384|pid:none) Methanosarcina mazei strain Goe1...    44   2e-06
FM954972_2188(FM954972|pid:none) Vibrio splendidus LGP32 chromos...    42   2e-06
AD2801(AD2801) bacterioferritin comigratory protein bcp [importe...    38   2e-06
CP000285_178(CP000285|pid:none) Chromohalobacter salexigens DSM ...    39   2e-06
EU290170_12(EU290170|pid:none) Pseudomonas putida PsfG (psfG), P...    40   2e-06
CP000744_4345(CP000744|pid:none) Pseudomonas aeruginosa PA7, com...    38   2e-06
CP000661_1831(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17...    41   2e-06
CP000359_120(CP000359|pid:none) Deinococcus geothermalis DSM 113...    41   2e-06
AF055914_1(AF055914|pid:none) Crithidia fasciculata tryparedoxin...    43   3e-06
AP009384_3622(AP009384|pid:none) Azorhizobium caulinodans ORS 57...    48   3e-06
AE010301_117(AE010301|pid:none) Leptospira interrogans serovar L...    38   3e-06
CP001344_1288(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    46   3e-06
CP001618_2651(CP001618|pid:none) Beutenbergia cavernae DSM 12333...    44   3e-06
CP000103_1931(CP000103|pid:none) Nitrosospira multiformis ATCC 2...    39   3e-06
CP001349_5825(CP001349|pid:none) Methylobacterium nodulans ORS 2...    38   3e-06
CP000140_1413(CP000140|pid:none) Parabacteroides distasonis ATCC...    47   3e-06
CP001114_257(CP001114|pid:none) Deinococcus deserti VCD115, comp...    38   3e-06
AP006841_1215(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,...    43   3e-06
BA000045_506(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D...    39   3e-06
BX572600_289(BX572600|pid:none) Rhodopseudomonas palustris CGA00...    45   4e-06
AE017126_930(AE017126|pid:none) Prochlorococcus marinus subsp. m...    44   4e-06
CP000806_1294(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    37   4e-06
EU016643_30(EU016643|pid:none) Uncultured Group I marine crenarc...    44   4e-06
AM746676_5974(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    47   4e-06
CP000675_3010(CP000675|pid:none) Legionella pneumophila str. Cor...    42   4e-06
CP001391_1116(CP001391|pid:none) Wolbachia sp. wRi, complete gen...    40   4e-06
CP000716_740(CP000716|pid:none) Thermosipho melanesiensis BI429,...    37   4e-06
CP001131_285(CP001131|pid:none) Anaeromyxobacter sp. K, complete...    49   4e-06
AE015928_4609(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    42   4e-06
AE000513_2196(AE000513|pid:none) Deinococcus radiodurans R1 chro...    39   4e-06
CR954218_7(CR954218|pid:none) Ostreococcus tauri strain OTTH0595...    48   5e-06
AE002161_1076(AE002161|pid:none) Chlamydophila pneumoniae AR39, ...    42   5e-06
AE001363_758(AE001363|pid:none) Chlamydophila pneumoniae CWL029,...    42   5e-06
EU251502_1(EU251502|pid:none) Leishmania major strain MRHO/IR/75...    42   5e-06
CP000561_1393(CP000561|pid:none) Pyrobaculum calidifontis JCM 11...    41   5e-06
CP000931_2306(CP000931|pid:none) Shewanella halifaxensis HAW-EB4...    39   5e-06
CP000158_2582(CP000158|pid:none) Hyphomonas neptunium ATCC 15444...    39   5e-06
CP000559_639(CP000559|pid:none) Methanocorpusculum labreanum Z, ...    45   5e-06
CP000699_3892(CP000699|pid:none) Sphingomonas wittichii RW1, com...    38   5e-06
AP006618_1271(AP006618|pid:none) Nocardia farcinica IFM 10152 DN...    54   6e-06
AP007255_664(AP007255|pid:none) Magnetospirillum magneticum AMB-...    38   6e-06
CP000937_810(CP000937|pid:none) Francisella philomiragia subsp. ...    37   7e-06
AE017196_1160(AE017196|pid:none) Wolbachia endosymbiont of Droso...    39   7e-06
CP000359_983(CP000359|pid:none) Deinococcus geothermalis DSM 113...    39   7e-06
CP000236_517(CP000236|pid:none) Ehrlichia chaffeensis str. Arkan...    47   7e-06
CP000009_1603(CP000009|pid:none) Gluconobacter oxydans 621H, com...    40   8e-06
CP000510_900(CP000510|pid:none) Psychromonas ingrahamii 37, comp...    42   8e-06
AM746676_6186(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    37   8e-06
AE017321_126(AE017321|pid:none) Wolbachia endosymbiont strain TR...    42   9e-06
AE016853_3863(AE016853|pid:none) Pseudomonas syringae pv. tomato...    37   1e-05
EU016593_13(EU016593|pid:none) Uncultured Group I marine crenarc...    42   1e-05
CP000058_1476(CP000058|pid:none) Pseudomonas syringae pv. phaseo...    39   1e-05
CP000563_2510(CP000563|pid:none) Shewanella baltica OS155, compl...    39   1e-05
CP000096_226(CP000096|pid:none) Pelodictyon luteolum DSM 273, co...    52   2e-05
CP000698_1214(CP000698|pid:none) Geobacter uraniireducens Rf4, c...    52   2e-05
EU358103_1(EU358103|pid:none) Artemia franciscana thioredoxin pe...    42   2e-05
AE015924_768(AE015924|pid:none) Porphyromonas gingivalis W83, co...    40   2e-05
CP000270_2040(CP000270|pid:none) Burkholderia xenovorans LB400 c...    37   2e-05
CP001197_2837(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi...    39   2e-05
CP000789_3077(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch...    42   2e-05
BX842650_309(BX842650|pid:none) Bdellovibrio bacteriovorus compl...    40   2e-05
CP000075_1545(CP000075|pid:none) Pseudomonas syringae pv. syring...    39   2e-05
CP000891_2655(CP000891|pid:none) Shewanella baltica OS195, compl...    39   2e-05
CP000053_198(CP000053|pid:none) Rickettsia felis URRWXCal2, comp...    37   2e-05
CP001052_1751(CP001052|pid:none) Burkholderia phytofirmans PsJN ...    36   2e-05
AM494475_1124(AM494475|pid:none) Orientia tsutsugamushi Boryong ...    38   3e-05
CT978603_1384(CT978603|pid:none) Synechococcus sp. RCC307 genomi...    39   3e-05
AL157959_858(AL157959|pid:none) Neisseria meningitidis serogroup...    40   3e-05
CP000927_2569(CP000927|pid:none) Caulobacter sp. K31, complete g...    37   3e-05
CR555306_2814(CR555306|pid:none) Azoarcus sp. EbN1 complete geno...    37   3e-05
CP000605_557(CP000605|pid:none) Bifidobacterium longum DJO10A, c...    40   3e-05
AP008981_275(AP008981|pid:none) Orientia tsutsugamushi str. Iked...    38   4e-05
CP001100_2587(CP001100|pid:none) Chloroherpeton thalassium ATCC ...    35   4e-05
CP001252_1751(CP001252|pid:none) Shewanella baltica OS223, compl...    38   4e-05
CP000444_2393(CP000444|pid:none) Shewanella sp. MR-7, complete g...    37   4e-05
CP000446_2331(CP000446|pid:none) Shewanella sp. MR-4, complete g...    37   4e-05
CP000116_999(CP000116|pid:none) Thiobacillus denitrificans ATCC ...    38   4e-05
EU912438_85(EU912438|pid:none) Vaucheria litorea chloroplast, co...    37   5e-05
CP000828_5306(CP000828|pid:none) Acaryochloris marina MBIC11017,...    51   5e-05
AP009384_1350(AP009384|pid:none) Azorhizobium caulinodans ORS 57...    36   5e-05
CP000597_6(CP000597|pid:none) Ostreococcus lucimarinus CCE9901 c...    41   5e-05
CP000304_2731(CP000304|pid:none) Pseudomonas stutzeri A1501, com...    37   5e-05
CP000821_2428(CP000821|pid:none) Shewanella sediminis HAW-EB3, c...    36   5e-05
CP001472_201(CP001472|pid:none) Acidobacterium capsulatum ATCC 5...    44   7e-05
AP008231_1915(AP008231|pid:none) Synechococcus elongatus PCC 630...    50   7e-05
AE000657_336(AE000657|pid:none) Aquifex aeolicus VF5, complete g...    35   7e-05
CU695238_157(CU695238|pid:none) Ralstonia solanacearum strain Mo...    38   7e-05
CP000874_61(CP000874|pid:none) Rhizobium sp. NGR234 plasmid pNGR...    36   9e-05
CP000110_1378(CP000110|pid:none) Synechococcus sp. CC9605, compl...    50   9e-05
AP009493_3523(AP009493|pid:none) Streptomyces griseus subsp. gri...    35   9e-05
CP000087_179(CP000087|pid:none) Rickettsia bellii RML369-C, comp...    37   9e-05
CP001068_1169(CP001068|pid:none) Ralstonia pickettii 12J chromos...    35   9e-05
CR767821_508(CR767821|pid:none) Ehrlichia ruminantium strain Wel...    44   9e-05
AE014299_1842(AE014299|pid:none) Shewanella oneidensis MR-1, com...    37   1e-04
CP000875_3378(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ...    36   1e-04
CP000388_273(CP000388|pid:none) Pseudoalteromonas atlantica T6c,...    36   1e-04
CP000473_5314(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    36   1e-04
AE004969_301(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, c...    38   1e-04
CP001365_2022(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4...    35   1e-04
AM167904_2162(AM167904|pid:none) Bordetella avium 197N complete ...    35   1e-04
AE017125_1010(AE017125|pid:none) Helicobacter hepaticus ATCC 514...    35   1e-04
CP001050_481(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,...    38   1e-04
CP000283_2438(CP000283|pid:none) Rhodopseudomonas palustris BisB...    44   2e-04
AP006840_926(AP006840|pid:none) Symbiobacterium thermophilum IAM...    42   2e-04
CP001013_2019(CP001013|pid:none) Leptothrix cholodnii SP-6, comp...    37   2e-04
CP001114_986(CP001114|pid:none) Deinococcus deserti VCD115, comp...    37   2e-04
EU016667_6(EU016667|pid:none) Uncultured marine microorganism HF...    49   2e-04
(Q9Z0V6) RecName: Full=Thioredoxin-dependent peroxide reductase,...    40   2e-04
BC060567_1(BC060567|pid:none) Rattus norvegicus peroxiredoxin 3,...    40   2e-04
AE016817_383(AE016817|pid:none) Ashbya gossypii (= Eremothecium ...    43   2e-04
CP000494_3721(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl...    42   2e-04
(Q26695) RecName: Full=Thioredoxin peroxidase;          EC=1.11....    43   2e-04
CP000239_1852(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com...    36   2e-04
CP001230_1154(CP001230|pid:none) Persephonella marina EX-H1, com...    36   2e-04
CP000088_2353(CP000088|pid:none) Thermobifida fusca YX, complete...    37   2e-04
CP000474_2326(CP000474|pid:none) Arthrobacter aurescens TC1, com...    49   3e-04
AE015928_2811(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    39   3e-04
AM114193_1750(AM114193|pid:none) Uncultured methanogenic archaeo...    35   3e-04
CP000821_3535(CP000821|pid:none) Shewanella sediminis HAW-EB3, c...    37   4e-04
CP000472_4126(CP000472|pid:none) Shewanella piezotolerans WP3, c...    40   4e-04
CP000360_181(CP000360|pid:none) Acidobacteria bacterium Ellin345...    35   4e-04
CP000975_1821(CP000975|pid:none) Methylacidiphilum infernorum V4...    37   4e-04
DQ122920_1(DQ122920|pid:none) Chlamydomonas incerta chloroplast ...    37   5e-04
AB283025_1(AB283025|pid:none) Shewanella livingstonensis ahpC ge...    35   5e-04
CP000127_835(CP000127|pid:none) Nitrosococcus oceani ATCC 19707,...    36   5e-04
BX842655_294(BX842655|pid:none) Bdellovibrio bacteriovorus compl...    37   5e-04
CP001393_1820(CP001393|pid:none) Anaerocellum thermophilum DSM 6...    35   5e-04
CP000781_4157(CP000781|pid:none) Xanthobacter autotrophicus Py2,...    40   5e-04
AP009484_1595(AP009484|pid:none) Macrococcus caseolyticus JCSC54...    47   6e-04
AC146630_2(AC146630|pid:none) Medicago truncatula clone mth2-7f2...    35   7e-04
BC099274_1(BC099274|pid:none) Xenopus laevis hypothetical protei...    39   7e-04
CP000302_2076(CP000302|pid:none) Shewanella denitrificans OS217,...    35   7e-04
CP000975_2117(CP000975|pid:none) Methylacidiphilum infernorum V4...    38   7e-04
CP000555_1538(CP000555|pid:none) Methylibium petroleiphilum PM1,...    33   7e-04
CP000488_553(CP000488|pid:none) Candidatus Ruthia magnifica str....    37   7e-04
CU928175_215(CU928175|pid:none) Zygosaccharomyces rouxii strain ...    40   8e-04
CP000750_3728(CP000750|pid:none) Kineococcus radiotolerans SRS30...    40   9e-04
AM778957_15(AM778957|pid:none) Microcystis aeruginosa PCC 7806 g...    47   0.001
CR382131_796(CR382131|pid:none) Yarrowia lipolytica strain CLIB1...    35   0.001
CP001230_133(CP001230|pid:none) Persephonella marina EX-H1, comp...    38   0.001
CP000777_1279(CP000777|pid:none) Leptospira biflexa serovar Pato...    33   0.001
EF070579_1(EF070579|pid:none) Maconellicoccus hirsutus clone WHM...    40   0.001
CP000712_1249(CP000712|pid:none) Pseudomonas putida F1, complete...    36   0.001
CP000949_3951(CP000949|pid:none) Pseudomonas putida W619, comple...    36   0.001
CP001341_2166(CP001341|pid:none) Arthrobacter chlorophenolicus A...    46   0.001

>AC115598_28(AC115598|pid:none) Dictyostelium discoideum chromosome
           2 map 581427-735498 strain AX4, complete sequence.
          Length = 153

 Score = 85.1 bits (209), Expect(2) = 1e-28
 Identities = 47/96 (48%), Positives = 63/96 (65%), Gaps = 3/96 (3%)
 Frame = +2

Query: 323 KFIEMGAEVIGISPNTMDNHKKFHAAHRVNYTILSDKNGAIGKLYGVNG---LLPGXVTF 493
           +F E GA V+G+S +  ++H KF A +R+ +T+L+D  G + K YGV     L+PG  TF
Sbjct: 59  QFTEAGAVVVGVSSDDAESHSKFSAKYRLPFTLLTDNKGEMAKKYGVKKELLLIPGRSTF 118

Query: 494 VIDKNGKIALNHHTSWLSHSSHIENSLSVIELLNSQ 601
           +IDKN KIAL  H+S L+  SHI  SL VIE L SQ
Sbjct: 119 IIDKNQKIAL-IHSSLLNAESHITESLKVIEQLKSQ 153

 Score = 65.5 bits (158), Expect(2) = 1e-28
 Identities = 28/53 (52%), Positives = 40/53 (75%)
 Frame = +3

Query: 162 MKIGEIAPEFTLPNKDGKLFNLKDFAGKPLVIFFYPNNIGWVCTREVCYFRDS 320
           +K+G+ AP+FT  +KDGK ++LKDFA K LV++FYP +    CT+E C FRD+
Sbjct: 4   LKVGDQAPDFTASDKDGKSYSLKDFADKVLVLYFYPKDSTPGCTKEACSFRDN 56

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,069,804,599
Number of extensions: 20198653
Number of successful extensions: 38023
Number of sequences better than 10.0: 1090
Number of HSP's gapped: 37816
Number of HSP's successfully gapped: 1779
Length of query: 268
Length of database: 1,061,185,681
Length adjustment: 126
Effective length of query: 142
Effective length of database: 649,361,233
Effective search space: 92209295086
Effective search space used: 92209295086
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

 psg: 0.75  gvh: 0.49  alm: 0.43  top: 0.53  tms: 0.00  mit: 0.17  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 48.0 %: cytoplasmic
	 24.0 %: nuclear
	  8.0 %: cytoskeletal
	  8.0 %: Golgi
	  4.0 %: vacuolar
	  4.0 %: vesicles of secretory system
	  4.0 %: endoplasmic reticulum

>> prediction for Contig-U05198-1 is cyt