Contig-U05044-1
Contig ID Contig-U05044-1
Contig update 2001. 8.29
Contig sequence
>Contig-U05044-1 (Contig-U05044-1Q) /CSM_Contig/Contig-U05044-1Q.Seq.d
AAATAAAGGTAATAACAACAATAATAATAATAAACAGTTTAATAAATAAG
AAAATAATAAAGATATAAAATGGTAAAACCAGTTAAAATTGGTGTAGATG
CAAAAGTTGAAAAGACAAAATCAGCAACAGCTGCCAGACATCATGAATTT
CAAATGAATAAAAGTTATGGTCAACATTTGTTAAANAATCGATTAATTAT
TGATGCAATTGTAGATAAATCACAACTTAAATCAACAGATACAGTACTTG
AAATTGGTCCAGGTACTGGTAATTTAACAATGAAATTATTAGAAAACTGT
AAAAAAGTTATTGCTATTGAAGTTGATCCACGTATGGCTGCTGAATTACA
AAAAAGAGTTGCCGCTTCACCATATGCACAACATCTTCAAATTATATTAG
GTGATTTAGTTGATCTACCATACTTTGATGTTTGCGTAGCAAATGTTCCA
TATCAAATTTCATCACCATTAACATTTAAATTATTAGCACATAGACCAAT
TTTTAGAACAGCAGTACTTATGTTTCAAAAGGAGTTTGCACTTCGTTTAG
GAGCAAAACCAGGTGATAGTTTATATTGTCGTTTATCAGTTAATACACAA
TTATTATCAAAAGTAACACATTTAATGAAAGTAGGTAAGAATAATTTCCT
TCCACCACCAAAAGTTGAGTCAGCAGTAGTTAGAATTGAACCATTCAATC
CACCACCACCAATTAATTTCGTTGAATGGGATGGGATGGTTTAGTTAAAT
TATGTTTCTCTAGAAAAAATAAAACATTATCAGGTATTTTCAGAGTTAGT
AGTGTAATTGAAACTTTAAATCAAAATTATAAAACTTATTGTGCTTTAGA
AGGTAAAATGAATACTGATGGTTCTGATGAACAAATGAAAGAATTAATCA
TTAAAACTTTAACTGATAATGACTTTTTAGATTCACGTTCTTCAAAATTA
GACATTAATGATTTCTTAAAATTATTAAATAAATTTCATGAAACTGGTAT
TCATTTCAAATAAACAAATAAAAAAAAAAAAAAAATAAAAAATAAATAAA
AAAAAATAAAAAAAAAAA

Gap no gap
Contig length 1068
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 1112131
End point 1113205
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 1
Link to clone list U05044
List of clone(s)

est1=SSE669E,1,1069
Translated Amino Acid sequence
k*r**qq****tv**irk**RYKMVKPVKIGVDAKVEKTKSATAARHHEFQMNKSYGQHL
LXNRLIIDAIVDKSQLKSTDTVLEIGPGTGNLTMKLLENCKKVIAIEVDPRMAAELQKRV
AASPYAQHLQIILGDLVDLPYFDVCVANVPYQISSPLTFKLLAHRPIFRTAVLMFQKEFA
LRLGAKPGDSLYCRLSVNTQLLSKVTHLMKVGKNNFLPPPKVESAVVRIEPFNPPPPINF
VEWDGMV*lnyvslekikhyqvfselvv*lkl*ikiiklivl*kvk*ilmvlmnk*kn*s
lkl*limtf*ihvlqn*tlmis*ny*infmklvfisnkqikkkkk*kinkkk*kkk


Translated Amino Acid sequence (All Frames)
Frame A:
k*r**qq****tv**irk**RYKMVKPVKIGVDAKVEKTKSATAARHHEFQMNKSYGQHL
LXNRLIIDAIVDKSQLKSTDTVLEIGPGTGNLTMKLLENCKKVIAIEVDPRMAAELQKRV
AASPYAQHLQIILGDLVDLPYFDVCVANVPYQISSPLTFKLLAHRPIFRTAVLMFQKEFA
LRLGAKPGDSLYCRLSVNTQLLSKVTHLMKVGKNNFLPPPKVESAVVRIEPFNPPPPINF
VEWDGMV*lnyvslekikhyqvfselvv*lkl*ikiiklivl*kvk*ilmvlmnk*kn*s
lkl*limtf*ihvlqn*tlmis*ny*infmklvfisnkqikkkkk*kinkkk*kkk


Frame B:
nkgnnnnnnnkqfnk*ennkdikw*nqlklv*mqklkrqnqqqlpdimnfk*ikvmvnic
*xid*llmql*inhnlnqqiqylklvqvlvi*q*ny*ktvkkllllklihvwllnykkel
plhhmhnifkly*vi*liyhtlmfa*qmfhikfhhh*hlny*hidqfleqqylcfkrslh
fv*eqnqvivyivvyqlihnyyqk*hi**k*vriisfhhqklsqq*lelnhsihhhqlis
lngmgwfs*imfl*kk*niiryfqs**cn*nfkskl*nllcfrr*ney*wf**tnerinh
*nfn***lfrftffkirh**flkiik*is*nwysfqink*kkkknkk*ikknkkk


Frame C:
ikvittiiiinslinkkiiki*ngkts*nwcrcks*kdkisnscqts*isne*klwstfv
kxsiny*cncr*itt*inryst*nwsryw*fnneiirkl*ksycy*s*stygc*itkksc
rfticttssnyir*fs*stil*clrskcsisnfitini*iist*tnf*nsstyvskgvct
sfrsktr**filsfis*ytiiiksntfnesr*e*fpsttks*vsss*n*tiqstttn*fr
*mgwdglvklcfsrknktlsgifrvssvietlnqnyktycalegkmntdgsdeqmkelii
ktltdndfldsrsskldindflkllnkfhetgihfk*tnkkkkkiknk*kkikkk


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U05044-1 (Contig-U05044-1Q)
/CSM_Contig/Contig-U05044-1Q.Seq.d
(1068 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U05044-1 (Contig-U05044-1Q) /CSM_Contig/Conti... 1838 0.0
Contig-U01660-1 (Contig-U01660-1Q) /CSM_Contig/Conti... 40 0.005
Contig-U12396-1 (Contig-U12396-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U12366-1 (Contig-U12366-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U11768-1 (Contig-U11768-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U09164-1 (Contig-U09164-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U06294-1 (Contig-U06294-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U04903-1 (Contig-U04903-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U14801-1 (Contig-U14801-1Q) /CSM_Contig/Conti... 36 0.075
Contig-U12974-1 (Contig-U12974-1Q) /CSM_Contig/Conti... 36 0.075

>Contig-U05044-1 (Contig-U05044-1Q) /CSM_Contig/Contig-U05044-1Q.Seq.d
Length = 1068

Score = 1838 bits (927), Expect = 0.0
Identities = 930/930 (100%)
Strand = Plus / Plus


Query: 90 tggtgtagatgcaaaagttgaaaagacaaaatcagcaacagctgccagacatcatgaatt 149
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 90 tggtgtagatgcaaaagttgaaaagacaaaatcagcaacagctgccagacatcatgaatt 149


Query: 150 tcaaatgaataaaagttatggtcaacatttgttaaanaatcgattaattattgatgcaat 209
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 150 tcaaatgaataaaagttatggtcaacatttgttaaanaatcgattaattattgatgcaat 209


Query: 210 tgtagataaatcacaacttaaatcaacagatacagtacttgaaattggtccaggtactgg 269
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 210 tgtagataaatcacaacttaaatcaacagatacagtacttgaaattggtccaggtactgg 269


Query: 270 taatttaacaatgaaattattagaaaactgtaaaaaagttattgctattgaagttgatcc 329
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 270 taatttaacaatgaaattattagaaaactgtaaaaaagttattgctattgaagttgatcc 329


Query: 330 acgtatggctgctgaattacaaaaaagagttgccgcttcaccatatgcacaacatcttca 389
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 330 acgtatggctgctgaattacaaaaaagagttgccgcttcaccatatgcacaacatcttca 389


Query: 390 aattatattaggtgatttagttgatctaccatactttgatgtttgcgtagcaaatgttcc 449
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 390 aattatattaggtgatttagttgatctaccatactttgatgtttgcgtagcaaatgttcc 449


Query: 450 atatcaaatttcatcaccattaacatttaaattattagcacatagaccaatttttagaac 509
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 450 atatcaaatttcatcaccattaacatttaaattattagcacatagaccaatttttagaac 509


Query: 510 agcagtacttatgtttcaaaaggagtttgcacttcgtttaggagcaaaaccaggtgatag 569
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 510 agcagtacttatgtttcaaaaggagtttgcacttcgtttaggagcaaaaccaggtgatag 569


Query: 570 tttatattgtcgtttatcagttaatacacaattattatcaaaagtaacacatttaatgaa 629
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 570 tttatattgtcgtttatcagttaatacacaattattatcaaaagtaacacatttaatgaa 629


Query: 630 agtaggtaagaataatttccttccaccaccaaaagttgagtcagcagtagttagaattga 689
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 630 agtaggtaagaataatttccttccaccaccaaaagttgagtcagcagtagttagaattga 689


Query: 690 accattcaatccaccaccaccaattaatttcgttgaatgggatgggatggtttagttaaa 749
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 690 accattcaatccaccaccaccaattaatttcgttgaatgggatgggatggtttagttaaa 749


Query: 750 ttatgtttctctagaaaaaataaaacattatcaggtattttcagagttagtagtgtaatt 809
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 750 ttatgtttctctagaaaaaataaaacattatcaggtattttcagagttagtagtgtaatt 809


Query: 810 gaaactttaaatcaaaattataaaacttattgtgctttagaaggtaaaatgaatactgat 869
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 810 gaaactttaaatcaaaattataaaacttattgtgctttagaaggtaaaatgaatactgat 869


Query: 870 ggttctgatgaacaaatgaaagaattaatcattaaaactttaactgataatgacttttta 929
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 870 ggttctgatgaacaaatgaaagaattaatcattaaaactttaactgataatgacttttta 929


Query: 930 gattcacgttcttcaaaattagacattaatgatttcttaaaattattaaataaatttcat 989
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 930 gattcacgttcttcaaaattagacattaatgatttcttaaaattattaaataaatttcat 989


Query: 990 gaaactggtattcatttcaaataaacaaat 1019
||||||||||||||||||||||||||||||
Sbjct: 990 gaaactggtattcatttcaaataaacaaat 1019


>Contig-U01660-1 (Contig-U01660-1Q) /CSM_Contig/Contig-U01660-1Q.Seq.d
Length = 529

Score = 40.1 bits (20), Expect = 0.005
Identities = 20/20 (100%)
Strand = Plus / Plus


Query: 815 tttaaatcaaaattataaaa 834
||||||||||||||||||||
Sbjct: 364 tttaaatcaaaattataaaa 383


>Contig-U12396-1 (Contig-U12396-1Q) /CSM_Contig/Contig-U12396-1Q.Seq.d
Length = 1387

Score = 38.2 bits (19), Expect = 0.019
Identities = 19/19 (100%)
Strand = Plus / Plus


Query: 911 aactgataatgacttttta 929
|||||||||||||||||||
Sbjct: 212 aactgataatgacttttta 230


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 21,053
Number of Sequences: 6905
Number of extensions: 21053
Number of successful extensions: 2194
Number of sequences better than 10.0: 263
length of query: 1068
length of database: 5,674,871
effective HSP length: 16
effective length of query: 1052
effective length of database: 5,564,391
effective search space: 5853739332
effective search space used: 5853739332
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 7. 9
Homology vs DNA
Query= Contig-U05044-1 (Contig-U05044-1Q) /CSM_Contig/Contig-U05044-1Q.Seq.d
(1068 letters)

Database: ddbj_B
105,743,758 sequences; 104,622,809,269 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(C84708) Dictyostelium discoideum slug cDNA, clone SSE669. 648 0.0 2
(AU072483) Dictyostelium discoideum slug cDNA, clone SSE669. 293 7e-75 1
(FE257380) CAPH6597.fwd CAPH Naegleria gruberi amoeba stage ... 62 1e-30 6
(FC818121) Sr_pAMT7_010p08_T7 S. ratti mixed stage pAMP Stro... 62 3e-26 6
(BI503598) BB170017A20G04.5 Bee Brain Normalized/Subtracted ... 60 1e-20 4
(ES510359) BIG_AF_18176 Brine Shrimp embryos, 10 hours after... 66 4e-19 3
(ES510931) BIG_AF_18748 Brine Shrimp embryos, 10 hours after... 66 4e-16 2
(FE257379) CAPH6597.rev CAPH Naegleria gruberi amoeba stage ... 62 8e-16 4
(DR915121) EST1106660 Aquilegia cDNA library Aquilegia formo... 56 8e-15 4
(FC731124) CBBG6436.fwd CBBG Lottia gigantea 12,15,18h embry... 42 1e-14 4
(DR916950) EST1108489 Aquilegia cDNA library Aquilegia formo... 56 1e-14 4
(DR945894) EST1137433 Aquilegia cDNA library Aquilegia formo... 56 2e-14 4
(DR913825) EST1105364 Aquilegia cDNA library Aquilegia formo... 56 2e-14 4
(DR953584) EST1145123 Aquilegia cDNA library Aquilegia formo... 56 2e-14 4
(DT741225) EST1175074 Aquilegia cDNA library Aquilegia formo... 56 2e-14 4
(DR925368) EST1116907 Aquilegia cDNA library Aquilegia formo... 56 2e-14 4
(ES469100) PC-A11 Brachionus plicatilis NHIL unnormalized cD... 42 5e-14 5
(BJ979928) Brachionus plicatilis NH1L mRNA, clone: BpA0459, ... 42 5e-14 5
(DY892103) CeleSEQ9015 Cunninghamella elegans pBluescript (E... 50 3e-13 4
(AM054435) Isotricha prostoma EST, clone Ip03_F07. 52 1e-12 4
(FF972179) CBWU94532.b1 Yutaka Satou unpublished cDNA librar... 48 2e-12 4
(FF974122) CBWU95697.b1 Yutaka Satou unpublished cDNA librar... 48 2e-12 4
(FK099588) XABT148176.b1 Gateway compatible cien cDNA librar... 48 2e-12 4
(FF957460) CBWU85100.b1 Yutaka Satou unpublished cDNA librar... 48 2e-12 4
(FF903352) CBWU35697.b1 Yutaka Satou unpublished cDNA librar... 48 2e-12 4
(FF749388) XABT58515.fwd Gateway compatible cien cDNA librar... 48 2e-12 4
(FF866623) CBWU12171.b1 Yutaka Satou unpublished cDNA librar... 48 2e-12 4
(FF950283) CBWU80693.b1 Yutaka Satou unpublished cDNA librar... 48 3e-12 4
(FF929059) CBWU66738.b1 Yutaka Satou unpublished cDNA librar... 48 3e-12 4
(DL173396) Methods for Identifying the Target of a Compound ... 44 9e-12 6
(AX488956) Sequence 6256 from Patent WO02053728. 44 9e-12 6
(AR548756) Sequence 3887 from patent US 6747137. 44 1e-11 6
(BX538350) Cryptosporidium parvum chromosome 6, complete seq... 70 2e-10 8
(AV845624) Ciona intestinalis cDNA, clone:rciad13b01, 3' end... 48 2e-10 3
(DW114719) CLRY2840.b1_P13.ab1 CLR(XYZ) lettuce serriola Lac... 50 4e-10 3
(DW113588) CLRY1686.b1_L13.ab1 CLR(XYZ) lettuce serriola Lac... 50 4e-10 3
(EW966903) LS_11_D18_T7 Headlice composite library with all ... 58 4e-10 3
(FF957461) CBWU85100.g1 Yutaka Satou unpublished cDNA librar... 48 1e-09 3
(FF950284) CBWU80693.g1 Yutaka Satou unpublished cDNA librar... 48 1e-09 3
(BW092217) Ciona intestinalis cDNA, clone:rciad103e06, 3' en... 48 1e-09 3
(FC717415) CBBG11495.rev CBBG Lottia gigantea 12,15,18h embr... 42 4e-09 3
(BH158964) ENTQY61TF Entamoeba histolytica Sheared DNA Entam... 54 4e-09 2
(AZ689196) ENTJQ94TR Entamoeba histolytica Sheared DNA Entam... 54 4e-09 2
(AZ550521) ENTEX76TF Entamoeba histolytica Sheared DNA Entam... 54 4e-09 2
(FC804447) CBGC6475.fwd CBGC Lottia gigantea 15h 18h embryos... 42 1e-08 3
(FC717416) CBBG11495.fwd CBBG Lottia gigantea 12,15,18h embr... 42 1e-08 3
(FC626072) CAXT4811.fwd CAXT Lottia gigantea from mantle Lot... 42 2e-08 3
(CI772847) Oryza sativa Japonica Group cDNA, clone: J10B0069... 62 4e-08 2
(ES224444) MpHnorm_ag5_O09 Myzus persicae, tobacco lineage, ... 42 4e-08 3
(BW232705) Ciona intestinalis cDNA, clone:ciad103e06, 5' end... 42 5e-08 4
(FF749387) XABT58515.rev Gateway compatible cien cDNA librar... 48 5e-08 3
(AR584244) Sequence 1 from patent US 6797466. 70 2e-07 1
(AR271569) Sequence 1 from patent US 6503729. 70 2e-07 1
(L77117) Methanocaldococcus jannaschii DSM 2661, complete ge... 70 2e-07 1
(CK560261) rswpb0_002540.y1 swp Bombyx mori cDNA, mRNA seque... 46 6e-07 3
(DC544761) Bombyx mori cDNA, clone:E_FL_dpe-_27I01_F_0, 5' e... 46 8e-07 3
(ES393973) MUS10-C14.x1d-t SHGC-MUS Mytilus californianus cD... 38 1e-06 3
(ES390196) MUS08-A20.x1d-t SHGC-MUS Mytilus californianus cD... 38 1e-06 3
(AW507178) EST00605 Plasmid Subtractive Library of Rat Cereb... 44 4e-06 3
(CV856711) gonad_EST04187 Embryonic gonad cDNA Library Gallu... 50 4e-06 3
(FG182182) AGN_PNL205af1_f12.trimmed.seq AGN_PNL Nicotiana t... 52 4e-06 2
(FG166426) AGN_RNC009xd09f1.ab1 AGN_RNC Nicotiana tabacum cD... 52 5e-06 2
(AZ674918) ENTLJ05TF Entamoeba histolytica Sheared DNA Entam... 42 5e-06 4
(BH138464) ENTOH15TR Entamoeba histolytica Sheared DNA Entam... 42 5e-06 4
(FM093038) Rattus norvegicus EST, 5'-end sequence, clone etn... 44 8e-06 3
(FK206144) XABT214727.g1 Gateway compatible cien cDNA librar... 48 8e-06 3
(FE352416) CBIC3364.fwd CBIC_Daphnia_pulex_Chosen_One_Librar... 46 1e-05 4
(FC812467) Sr_pASP6_010p08_SP6 S. ratti mixed stage pAMP Str... 44 2e-05 3
(EY215339) PRAG-aab21d03.g1 Sand_fly_EST_Normalized Phleboto... 54 2e-05 2
(DW062340) CLLY1984.b1_O15.ab1 CLL(XYZ) lettuce saligna Lact... 38 2e-05 4
(DV078490) H1SFmidgut_003_5prime Spodoptera frugiperda midgu... 36 2e-05 5
(BG350501) 092G01 Mature tuber lambda ZAP Solanum tuberosum ... 50 3e-05 3
(FK206143) XABT214727.b1 Gateway compatible cien cDNA librar... 38 3e-05 4
(BC158729) Rattus norvegicus DIM1 dimethyladenosine transfer... 44 4e-05 3
(DV624471) 94016.1 Cold Sweetening C Solanum tuberosum cDNA ... 50 4e-05 3
(BC098737) Rattus norvegicus cDNA clone IMAGE:7385418, conta... 44 4e-05 3
(CK487005) rswab0_004031.y1 swa Bombyx mori cDNA, mRNA seque... 46 4e-05 2
(CK544367) rswhb0_013875.y1 swh Bombyx mori cDNA, mRNA seque... 46 5e-05 2
(CK260820) EST706898 potato abiotic stress cDNA library Sola... 50 6e-05 3
(BW283608) Ciona intestinalis cDNA, clone:cigd022i01, 5' end... 42 8e-05 3
(AV951867) Ciona intestinalis cDNA, clone:cieg06i03, 5' end,... 42 8e-05 3
(BW293628) Ciona intestinalis cDNA, clone:cigd005c01, 5' end... 42 1e-04 3
(BW293170) Ciona intestinalis cDNA, clone:cigd049m09, 5' end... 42 1e-04 3
(AV959448) Ciona intestinalis cDNA, clone:ciad13b01, 5' end,... 42 1e-04 3
(BT013951) Lycopersicon esculentum clone 132974F, mRNA seque... 50 1e-04 3
(AK325980) Solanum lycopersicum cDNA, clone: LEFL2001BH03, H... 50 1e-04 3
(CF397791) RTDS3_1_A09.g1_A022 Drought-stressed loblolly pin... 48 1e-04 3
(BJ129466) Caenorhabditis elegans cDNA clone:yk1031b04 : 3' ... 38 1e-04 3
(FC731123) CBBG6436.rev CBBG Lottia gigantea 12,15,18h embry... 42 2e-04 2
(CK559829) rswpb0_002001.y1 swp Bombyx mori cDNA, mRNA seque... 44 2e-04 2
(DR389959) USDA-FP_149779 Adult Alate Aphis gossypii (WHAGA)... 60 2e-04 1
(GD125465) KS25018G10 KS25 Capsicum annuum cDNA, mRNA sequence. 60 2e-04 1
(CK292201) EST754915 Nicotiana benthamiana mixed tissue cDNA... 42 2e-04 3
(CK286557) EST749279 Nicotiana benthamiana mixed tissue cDNA... 42 2e-04 3
(CK285609) EST748331 Nicotiana benthamiana mixed tissue cDNA... 42 2e-04 3
(CK308441) SB02046B1D10.f1 normalized Keck-Tagu Library SB02... 54 2e-04 2
(CK293456) EST756170 Nicotiana benthamiana mixed tissue cDNA... 42 2e-04 3
(EV435212) 34524_65 Quinqueloculina sp. cDNA library Quinque... 48 3e-04 3
(BM879791) ku01a03.y1 Strongyloides ratti PA female naive pA... 42 3e-04 3
(DQ213400) Taeniopygia guttata clone 0064P0014B01 putative p... 54 4e-04 2
(GE742460) CBUG6514.b1 B.anynana_wing.LCPP_nosize Bicyclus a... 36 4e-04 4
(FE405254) CBTT3260.fwd CBTT_Daphnia_pulex_Chosen_One_Librar... 46 5e-04 3
(BW077492) Ciona intestinalis cDNA, clone:rcieg072n20, 3' en... 48 5e-04 2
(AV885885) Ciona intestinalis cDNA, clone:rcicl25i21, 3' end... 48 6e-04 2
(BW213201) Ciona intestinalis cDNA, clone:cieg072n20, 5' end... 48 6e-04 2
(FK099589) XABT148176.g1 Gateway compatible cien cDNA librar... 48 7e-04 2
(AV841916) Ciona intestinalis cDNA, clone:rcieg06i03, 3' end... 48 7e-04 2
(ES217822) MpFVN_ag1_P12 Myzus persicae, line F001, PLRV fre... 42 7e-04 2
(BW073071) Ciona intestinalis cDNA, clone:rcieg101f07, 3' en... 48 7e-04 2
(FF998072) CBWU114421.g1 Yutaka Satou unpublished cDNA libra... 48 7e-04 2
(FF972180) CBWU94532.g1 Yutaka Satou unpublished cDNA librar... 48 7e-04 2
(FN008400) Petunia axillaris subsp. axillaris EST, clone dr0... 58 7e-04 1
(FF974123) CBWU95697.g1 Yutaka Satou unpublished cDNA librar... 48 8e-04 2
(BW163727) Ciona intestinalis cDNA, clone:rcigd049m09, 3' en... 48 8e-04 2
(BW155178) Ciona intestinalis cDNA, clone:rcigd025m06, 3' en... 48 8e-04 2
(FF866624) CBWU12171.g1 Yutaka Satou unpublished cDNA librar... 48 8e-04 2
(EC388236) A09_A09gm4a17_pDNRf_491460 Myzus persicae, line G... 42 8e-04 2
(FF929060) CBWU66738.g1 Yutaka Satou unpublished cDNA librar... 48 8e-04 2
(FF903353) CBWU35697.g1 Yutaka Satou unpublished cDNA librar... 48 8e-04 2
(BW164186) Ciona intestinalis cDNA, clone:rcigd005c01, 3' en... 48 8e-04 2
(EY210407) PRAG-aaa13g11.g1 Sand_fly_EST_Normalized Phleboto... 48 8e-04 2
(BW160180) Ciona intestinalis cDNA, clone:rcigd039p01, 3' en... 48 9e-04 2
(EJ556699) 1092959507186 Global-Ocean-Sampling_GS-29-01-01-1... 42 0.001 2
(EJ554022) 1092959481122 Global-Ocean-Sampling_GS-29-01-01-1... 42 0.001 2
(FM928382) Brachionus plicatilis EST 5' end, clone sb103P003... 40 0.001 3
(DN602724) ACAB-aab00j05.g1 Hydra UCI6- barcoded EST's Hydra... 40 0.002 3
(DW271388) UI-S-GS1-ack-e-13-0-UI.s1 UI-S-GS1 Euprymna scolo... 44 0.003 2
(AV996474) Ciona intestinalis cDNA, clone:cicl25i21, 5' end,... 42 0.003 3
(DC442558) Gryllus bimaculatus mRNA, clone:GB00364-44_E03, 5... 46 0.004 3
(CP000678) Methanobrevibacter smithii ATCC 35061, complete g... 48 0.004 20
(BU383556) 603858678F1 CSEQCHN75 Gallus gallus cDNA clone Ch... 50 0.010 2
(EE128702) SiJWE08ABC Lausanne fire ant library Solenopsis i... 34 0.011 4
(FE725917) SB05019B1C06.f1 Normalized subtracted Keck-Tagu L... 54 0.012 1
(EJ127912) 1092343402430 Global-Ocean-Sampling_GS-27-01-01-1... 44 0.013 2
(CR389591) Gallus gallus finished cDNA, clone ChEST866l20. 50 0.020 2
(AC166514) Bos taurus clone CH240-178K4, WORKING DRAFT SEQUE... 36 0.030 2
(EC021947) 3831374 KZ41 Caenorhabditis elegans cDNA clone 14... 38 0.033 2
(FG582016) TpNBL010643 Trichinella pseudospiralis new born l... 38 0.034 2
(EW335295) rpliv0127_p8.y1 liv Sus scrofa cDNA 5', mRNA sequ... 36 0.037 3
(EC361278) IMMUNEF088883P14 POSSUM_01-C-POSSUM-IMMUNE-2KB Tr... 40 0.037 2
(ER858910) PPTHW77TF Solanum tuberosum RHPOTKEY BAC ends Sol... 50 0.038 2
(AC009226) Homo sapiens BAC clone RP11-167C7 from 2, complet... 52 0.046 1
(FH676603) CHO_OF5032xm09f1.ab1 CHO_OF5 Nicotiana tabacum ge... 52 0.046 1
(FH281077) CHO_OF4182xk08f1.ab1 CHO_OF4 Nicotiana tabacum ge... 52 0.046 1
(FG182270) AGN_PNL205ar1_f12.trimmed.seq AGN_PNL Nicotiana t... 52 0.046 1
(FG166490) AGN_RNC009xd09r1.ab1 AGN_RNC Nicotiana tabacum cD... 52 0.046 1
(FG165143) AGN_RNC011xi01r1.ab1 AGN_RNC Nicotiana tabacum cD... 52 0.046 1
(CP001056) Clostridium botulinum B str. Eklund 17B, complete... 36 0.050 19
(CO368299) RTK1_39_G01.g1_A029 Roots minus potassium Pinus t... 50 0.051 2
(FC626071) CAXT4811.rev CAXT Lottia gigantea from mantle Lot... 42 0.052 2
(DU850207) 45185 Tomato HindIII BAC Library Solanum lycopers... 50 0.052 2
(AM467695) Vitis vinifera contig VV78X054113.7, whole genome... 36 0.054 4
(AU303693) Zinnia elegans cDNA, clone:Z12592. 46 0.084 2
(DT757992) EST1191841 Aquilegia cDNA library Aquilegia formo... 32 0.099 4
(DT754414) EST1188263 Aquilegia cDNA library Aquilegia formo... 32 0.10 4
(DR912517) EST1104056 Aquilegia cDNA library Aquilegia formo... 32 0.11 4
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 34 0.11 15
(CK459153) 923623 MARC 4PIG Sus scrofa cDNA 5', mRNA sequence. 36 0.11 3
(AC105687) Rattus norvegicus clone CH230-11I1, *** SEQUENCIN... 44 0.12 5
(DT757388) EST1191237 Aquilegia cDNA library Aquilegia formo... 32 0.13 4
(CB388686) OSTF103E12_1 AD-wrmcDNA Caenorhabditis elegans cD... 38 0.13 2
(ES387564) MUS08-A20.y1d-s SHGC-MUS Mytilus californianus cD... 38 0.14 2
(ES393199) MUS10-C14.y1d-s SHGC-MUS Mytilus californianus cD... 38 0.14 2
(EX620934) 255413738 Pea aphid whole body normalized full le... 40 0.14 2
(FF293140) 279294309 Pea aphid whole body normalized full le... 40 0.14 2
(CB392630) OSTR103E12_1 AD-wrmcDNA Caenorhabditis elegans cD... 38 0.14 2
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 34 0.14 18
(CR392340) Zebrafish DNA sequence from clone DKEY-23G12 in l... 38 0.18 6
(AC187363) Gallus gallus BAC clone CH261-18N18 from chromoso... 50 0.18 1
(AV343971) Mus musculus adult male olfactory brain cDNA, RIK... 50 0.18 1
(BQ046329) EST595447 P. infestans-challenged potato leaf, in... 50 0.18 1
(BG353665) ps41d03.y1 Trichinella spiralis ML CMVsport jasme... 50 0.18 1
(EK107136) 1092963062468 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.21 2
(EK102911) 1092963027670 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.22 2
(AY609935) Sus scrofa clone Clu_4538.scr.msk.p1.Contig1, mRN... 36 0.22 3
(ES411120) HTAB-aaa58e10.b2 Heterorhabditis_bacteriophora_HT... 34 0.23 3
(AE017263) Mesoplasma florum L1 complete genome. 36 0.25 21
(CP001184) Ureaplasma urealyticum serovar 10 str. ATCC 33699... 38 0.29 16
(BW289656) Ciona intestinalis cDNA, clone:cigd039p01, 5' end... 42 0.30 2
(CX394408) JGI_XZT26885.fwd NIH_XGC_tropTad5 Xenopus (Silura... 40 0.31 3
(CX514157) JGI_XZG44465.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.31 3
(CX438830) JGI_XZG6866.fwd NIH_XGC_tropGas7 Xenopus (Siluran... 40 0.32 3
(BJ600286) Physcomitrella patens subsp. patens cDNA clone:pp... 40 0.32 3
(CJ000438) Sus scrofa mRNA, clone:LVR01B080088, 5' end, expr... 36 0.33 3
(AK232580) Sus scrofa mRNA, clone:LVR010088B08, expressed in... 36 0.33 3
(CR434348) Xenopus tropicalis EST, clone TTbA051k07 5'. 40 0.34 3
(AE015929) Staphylococcus epidermidis ATCC 12228, complete g... 34 0.35 2
(CT025780) Zebrafish DNA sequence from clone DKEY-203O10 in ... 42 0.35 4
(EL860455) CBXT16302.b1 NICHD_XGC_trop_25 Xenopus (Silurana)... 40 0.35 3
(CR434349) Xenopus tropicalis EST, clone TTbA051k09 5'. 40 0.36 3
(CR428654) Xenopus tropicalis EST, clone TTbA068d22 5'. 40 0.37 3
(CR439521) Xenopus tropicalis EST, clone TTbA036c03 5'. 40 0.37 3
(DT394426) JGI_CABH10412.fwd NIH_XGC_tropSkeMus1 Xenopus (Si... 40 0.37 3
(DC954162) Physcomitrella patens subsp. patens cDNA, clone:p... 40 0.37 3
(AC235861) Glycine max strain Williams 82 clone GM_WBb0101D1... 36 0.37 8
(FC434160) CBAW723.fwd CBAW Physcomitrella patens subsp. pat... 40 0.38 3
(EX445472) GQ04113.B7_L11 GQ041 - Shoot tip - Dormant (Norma... 40 0.38 3
(AC130835) Mus musculus BAC clone RP24-132F18 from chromosom... 40 0.38 6
(CX483882) JGI_XZG33872.fwd NIH_XGC_tropGas7 Xenopus (Silura... 40 0.38 3
(BX722134) Xenopus tropicalis EST, clone TTpA078m19 5'. 40 0.38 3
(DT454100) JGI_CABK11023.fwd NIH_XGC_tropSpl1 Xenopus (Silur... 40 0.38 3
(DR449518) WS00950.BR_E21 IS-B-N-A-10 Picea engelmannii x Pi... 40 0.38 3
(DR841251) JGI_CABC10547.fwd NIH_XGC_tropFat1 Xenopus (Silur... 40 0.39 3
(CX885476) JGI_CAAL23447.fwd NIH_XGC_tropBrn4 Xenopus (Silur... 40 0.39 3
(CR444319) Xenopus tropicalis EST, clone TTbA074c12 5'. 40 0.39 3
(CR932962) Medicago truncatula chromosome 5 clone mte1-70c24... 36 0.39 6
(CX398368) JGI_XZT57781.fwd NIH_XGC_tropTad5 Xenopus (Silura... 40 0.40 3
(CX877722) JGI_CAAL18627.fwd NIH_XGC_tropBrn4 Xenopus (Silur... 40 0.41 3
(CR416982) Xenopus tropicalis EST, clone TTbA009b08 5'. 40 0.42 3
(BX737413) Xenopus tropicalis EST, clone TTpA041g01 5'. 40 0.43 3
(FF739374) XABT51628.fwd Gateway compatible cien cDNA librar... 42 0.43 2
(BW208549) Ciona intestinalis cDNA, clone:cieg101f07, 5' end... 42 0.43 2
(BX703190) Xenopus tropicalis EST, clone TTpA022k20 5'. 40 0.46 3
(CP000102) Methanosphaera stadtmanae DSM 3091, complete genome. 32 0.46 22
(DT389271) JGI_CABH7611.fwd NIH_XGC_tropSkeMus1 Xenopus (Sil... 40 0.47 3
(CB078367) hj66g06.g1 Hedyotis terminalis flower - Stage 2 (... 36 0.48 2
(AX145019) Sequence 3741 from Patent WO0134809. 34 0.49 2
(AR485655) Sequence 3741 from patent US 6703492. 34 0.49 2
(AF269701) Staphylococcus epidermidis strain SR1 clone step.... 34 0.49 2
(GC558266) Sequence 1977 from patent US 7416862. 34 0.53 2
(EA074499) Sequence 1857 from patent US 7183083. 34 0.53 2
(AR888196) Sequence 1857 from patent US 7060458. 34 0.53 2
(Z68293) S.pombe of DIM1 gene encoding dimethylase. 40 0.55 3
(CU855912) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 38 0.61 3
(AC119022) Rattus norvegicus clone CH230-449N5, WORKING DRAF... 42 0.65 6
(Z47075) Caenorhabditis elegans Cosmid E02H1. 38 0.71 2
(AP009283) Solanum lycopersicum genomic DNA, chromosome 8, c... 48 0.72 1
(CS604787) Sequence 3773 from Patent WO2007039234. 48 0.72 1
(CS603139) Sequence 2125 from Patent WO2007039234. 48 0.72 1
(AC111386) Rattus norvegicus clone CH230-138O15, *** SEQUENC... 48 0.72 1
(AC110334) Rattus norvegicus clone CH230-140B23, *** SEQUENC... 48 0.72 1
(AC109690) Rattus norvegicus clone CH230-268H4, *** SEQUENCI... 48 0.72 1
(CU467736) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 0.72 1
(EJ926128) 1093018782636 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.72 1
(EJ840145) 1093017825164 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.72 1
(EJ569581) 1092960023405 Global-Ocean-Sampling_GS-29-01-01-1... 48 0.72 1
(EJ561994) 1092959666406 Global-Ocean-Sampling_GS-29-01-01-1... 48 0.72 1
(BZ301634) KD1386.q1 Kluyveromyces delphensis Random Genomic... 48 0.72 1
(ES272925) TPAF-aaa15g12.g1 T.spiralis_EST Trichinella spira... 48 0.72 1
(DB844031) Nilaparvata lugens mRNA, EST clone:NLEA6868, 5' e... 48 0.72 1
(DB830923) Nilaparvata lugens mRNA, EST clone:NLNB9223, 5' e... 48 0.72 1
(BW285522) Ciona intestinalis cDNA, clone:cigd028c18, 5' end... 48 0.72 1
(BW155970) Ciona intestinalis cDNA, clone:rcigd028c18, 3' en... 48 0.72 1
(FG107441) PRAG-aab70b05.b1 Sand_fly_EST_Normalized Phleboto... 48 0.72 1
(FE227832) O103A12 Antarctic fish Dissostichus mawsoni adult... 48 0.72 1
(FE225750) O075E09 Antarctic fish Dissostichus mawsoni adult... 48 0.72 1
(FE223711) O047B08 Antarctic fish Dissostichus mawsoni adult... 48 0.72 1
(FE216454) L080H03 Antarctic fish Dissostichus mawsoni adult... 48 0.72 1
(FE210314) L004B08 Antarctic fish Dissostichus mawsoni adult... 48 0.72 1
(AW697320) NF117E07ST1F1054 Developing stem Medicago truncat... 48 0.72 1
(ES570155) TPAF-aab60g07.g1 T.spiralis_EST Trichinella spira... 48 0.72 1
(ER504224) 1093015415321 Global-Ocean-Sampling_GS-35-01-01-1... 42 0.73 2
(ES575817) FPS013.CR_C23 LSG10-01 Lymnaea stagnalis cDNA clo... 42 0.73 2
(CT821283) Paramecium tetraurelia 5-PRIME EST from clone LK0... 34 0.78 3
(ER617215) 1093017294285 Global-Ocean-Sampling_GS-36-01-01-2... 42 0.80 2
(FB596459) Sequence 12182 from Patent WO2004081186. 42 0.88 3
(AM094197) Lutzomyia longipalpis EST clone NSFM-152c04, sequ... 44 0.93 2
(DV611307) EST1214303 Glossina morsitans morsitans Fat body ... 34 1.1 3
(AM094198) Lutzomyia longipalpis EST clone NSFM-152c04, sequ... 44 1.1 2
(AL110479) Caenorhabditis elegans YAC Y105C5B. 34 1.1 12
(EF676769) Picea sitchensis clone WS02751_I17 unknown mRNA. 40 1.3 3
(CN761196) ID0AAA2CF09RM1 ApMS Acyrthosiphon pisum cDNA clon... 38 1.3 3
(DV620077) EST1223073 Glossina morsitans morsitans Fat body ... 34 1.4 3
(DV607651) EST1210647 Glossina morsitans morsitans Fat body ... 34 1.4 3
(CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 36 1.6 17
(AC233158) Medicago truncatula clone mth2-8c16, WORKING DRAF... 36 1.6 6
(BC169134) Xenopus tropicalis hypothetical protein LOC779588... 40 1.6 3
(BJ937175) Cryptomeria japonica pollen cDNA, clone:CP10364, ... 40 1.7 2
(BC123077) Xenopus tropicalis hypothetical protein LOC779588... 40 1.8 3
(CU075813) Xenopus tropicalis finished cDNA, clone TTpA022k20. 40 1.8 3
(CE803186) tigr-gss-dog-17000317845483 Dog Library Canis lup... 38 1.9 2
(EV481474) Fc_nor_74H04_M13F Folsomia candida normalized cDN... 36 2.0 2
(EV481128) Fc_nor_61C11_M13F Folsomia candida normalized cDN... 36 2.0 2
(EA102689) Sequence 72 from patent US 7195870. 38 2.0 3
(AX323590) Sequence 78 from Patent WO0192565. 38 2.0 3
(AX277909) Sequence 72 from Patent WO0177375. 38 2.0 3
(GM995938) Sequence 78 from Patent EP2014776. 38 2.0 3
(AP010315) Lotus japonicus genomic DNA, chromosome 4, clone:... 32 2.0 10
(CW696192) OG_BBa0058B04.r OG_BBa Oryza glaberrima genomic c... 38 2.0 2
(FD451832) EGGAD85TR Haematobia irritans eggs Haematobia irr... 36 2.1 3
(CW669325) OG_BBa0025G24.r OG_BBa Oryza glaberrima genomic c... 38 2.1 2
(CJ742906) Ipomoea nil cDNA clone:jmsf25k08, 5' end. 38 2.2 2
(FD457845) EGGBG53TR Haematobia irritans eggs Haematobia irr... 36 2.2 3
(FD457742) EGGBF86TR Haematobia irritans eggs Haematobia irr... 36 2.3 3
(FD457844) EGGBG53TF Haematobia irritans eggs Haematobia irr... 36 2.4 3
(BC160444) Xenopus tropicalis hypothetical protein LOC779588... 40 2.4 3
(EK016272) 1092955235405 Global-Ocean-Sampling_GS-31-01-01-1... 44 2.5 2
(AC234821) Ateles geoffroyi clone UC1-65L15, WORKING DRAFT S... 42 2.6 4
(CL795269) OR_CBa0005A11.r OR_CBa Oryza rufipogon genomic cl... 38 2.6 2
(Z67753) Odontella sinensis complete chloroplast genome. 40 2.8 6
(CT574548) Zebrafish DNA sequence from clone CH211-26G6 in l... 46 2.9 1
(CR392362) Zebrafish DNA sequence from clone DKEY-5B19 in li... 46 2.9 1
(AM449370) Vitis vinifera contig VV78X183261.14, whole genom... 46 2.9 1
(AC151775) Ornithorhynchus anatinus chromosome UNK clone OAB... 46 2.9 1
(AC010203) Homo sapiens 12 BAC RP11-175P13 (Roswell Park Can... 46 2.9 1
(AC148510) Macropus eugenii clone ME_KBa-458L18, WORKING DRA... 46 2.9 1
(CU571116) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 2.9 1
(AQ437117) HS_5073_B1_D10_T7A RPCI-11 Human Male BAC Library... 46 2.9 1
(FI078077) CHO_OF7378xd19f1.ab1 CHO_OF7 Nicotiana tabacum ge... 46 2.9 1
(FH192110) CHO_OF3028xe20f1.ab1 CHO_OF3 Nicotiana tabacum ge... 46 2.9 1
(FH156059) CHO_OF3117xp19f1.ab1 CHO_OF3 Nicotiana tabacum ge... 46 2.9 1
(EJ440986) 1093015304468 Global-Ocean-Sampling_GS-28-01-01-1... 46 2.9 1
(EB547837) AGENCOURT_52967634 D. erecta EST Drosophila erect... 46 2.9 1
(BE578638) rk16c05.y1 Meloidogyne javanica Egg SL1 Topo1 Klo... 46 2.9 1
(AC020690) Homo sapiens chromosome 4 clone RP11-489J24 map 4... 40 3.1 3
(AL929190) Zebrafish DNA sequence from clone DKEY-77N11 in l... 40 3.2 5
(AC183617) Pan troglodytes BAC clone CH251-104G17 from chrom... 36 4.3 4
(BX088528) Zebrafish DNA sequence from clone CH211-226D23 in... 42 4.8 5
(AC171135) Helobdella robusta clone CH306-1A6, complete sequ... 40 5.0 5
(AC161479) Pan troglodytes BAC clone CH251-168J1 from chromo... 34 5.3 2
(AC024190) Homo sapiens chromosome 8 clone RP11-435E3, WORKI... 32 5.3 2
(BX470139) Zebrafish DNA sequence from clone CH211-141O12 in... 32 5.3 2
(AC092661) Homo sapiens BAC clone RP11-510D4 from 4, complet... 34 5.4 2
(CP000413) Lactobacillus gasseri ATCC 33323, complete genome. 34 5.4 19
(AC024353) Homo sapiens chromosome 4 clone RP11-778G8 map 4,... 34 5.4 2
(AC084879) Homo sapiens 12q BAC RP11-167N24 (Roswell Park Ca... 32 5.4 2
(BX005449) Zebrafish DNA sequence from clone CH211-174A15 in... 32 5.4 2
(CN774155) taf58h07.y2 Hydra EST Darmstadt I Hydra magnipapi... 40 5.5 2
(CS742018) Sequence 10014 from Patent WO2005083127. 32 5.6 2
(CP000029) Staphylococcus epidermidis RP62A, complete genome. 34 5.6 24
(CU915764) Zebrafish DNA sequence from clone CH73-167M14 in ... 32 5.8 6
(BP884799) Solanum lycopersicum cDNA, clone: FA29CG09, 5' en... 42 5.8 2
(AC096762) Homo sapiens BAC clone RP11-621I20 from 4, comple... 36 5.9 4
(DQ332468) Synthetic construct Saccharomyces cerevisiae clon... 32 6.1 3
(DL341756) METHODS FOR ANALYZING GENES OF INDUSTRIAL YEASTS. 32 6.1 3
(DJ208205) Method for identification of useful proteins deri... 32 6.1 3
(AX830620) Sequence 1340 from Patent WO03072602. 32 6.1 3
(AX819590) Sequence 1340 from Patent EP1338608. 32 6.1 3
(AX595478) Sequence 1132 from Patent EP1258494. 32 6.1 3
(HA285047) Sequence 78825 from Patent WO2006024892. 32 6.1 3
(BM884601) rc13a04.y1 Meloidogyne hapla egg pAMP1 v1 Meloido... 40 6.3 2
(AL953910) Zebrafish DNA sequence from clone DKEY-31E10 in l... 42 6.6 5
(AC225519) Medicago truncatula clone mth2-59d22, WORKING DRA... 32 6.7 7
(CP000976) Borrelia duttonii Ly, complete genome. 32 6.7 15
(BC066914) Homo sapiens 5'-nucleotidase, cytosolic III, mRNA... 34 7.0 2
(AC235911) Glycine max strain Williams 82 clone GM_WBc0218O2... 42 7.0 6
(AX191535) Sequence 57 from Patent WO0149728. 34 7.0 2
(CR617694) full-length cDNA clone CS0DA007YE08 of Neuroblast... 34 7.0 2
(DJ021948) NOVEL COMPOSITIONS AND METHODS FOR THE TREATMENT ... 34 7.0 2
(CS108385) Sequence 393 from Patent WO2005051988. 34 7.0 2
(GM014835) Sequence 393 from Patent EP1923400. 34 7.0 2
(BC013292) Homo sapiens 5'-nucleotidase, cytosolic III, mRNA... 34 7.0 2
(BC015856) Homo sapiens 5'-nucleotidase, cytosolic III, mRNA... 34 7.0 2
(AK290118) Homo sapiens cDNA FLJ76348 complete cds. 34 7.0 2
(GN082561) Sequence 9 from Patent WO2009028945. 34 7.0 2
(AF151067) Homo sapiens HSPC233 mRNA, complete cds. 34 7.0 2
(AR053364) Sequence 9 from patent US 5834235. 34 7.0 2
(AB173701) Macaca fascicularis brain cDNA clone: QflA-23807,... 34 7.0 2
(BC071652) Homo sapiens 5'-nucleotidase, cytosolic III, mRNA... 34 7.0 2
(AX086333) Sequence 285 from Patent WO0112659. 34 7.0 2
(AL136716) Homo sapiens mRNA; cDNA DKFZp566B1046 (from clone... 34 7.0 2
(AF312735) Homo sapiens pyrimidine 5'-nucleotidase mRNA, com... 34 7.1 2
(DC631903) Macaca fascicularis mRNA, clone: QbmA-07029, 5' e... 34 7.1 2
(DC637258) Macaca fascicularis mRNA, clone: QbmA-22130, 5' e... 34 7.1 2
(CR762391) Zebrafish DNA sequence from clone DKEYP-52F4 in l... 34 7.1 7
(DC850675) Macaca fascicularis mRNA, clone: QspA-07045, 5' e... 34 7.1 2
(BG167396) 602342647F1 NIH_MGC_89 Homo sapiens cDNA clone IM... 34 7.1 2
(CR594161) full-length cDNA clone CS0DJ001YB17 of T cells (J... 34 7.1 2
(CU677476) Synthetic construct Homo sapiens gateway clone IM... 34 7.1 2
(CU677475) Synthetic construct Homo sapiens gateway clone IM... 34 7.1 2
(AK314109) Homo sapiens cDNA, FLJ94799, Homo sapiens 5'-nucl... 34 7.1 2
(BG110988) 602284656F1 NIH_MGC_86 Homo sapiens cDNA clone IM... 34 7.1 2
(CR533518) Homo sapiens full open reading frame cDNA clone R... 34 7.1 2
(CR597528) full-length cDNA clone CS0CAP002YL07 of Thymus of... 34 7.1 2
(BG534757) 602553925F1 NIH_MGC_77 Homo sapiens cDNA clone IM... 34 7.1 2
(AM393481) Synthetic construct Homo sapiens clone IMAGE:1000... 34 7.1 2
(AL516762) human full-length cDNA 5-PRIME end of clone CS0DA... 34 7.1 2
(AX191525) Sequence 47 from Patent WO0149728. 34 7.1 2
(ER502573) 1093015408451 Global-Ocean-Sampling_GS-35-01-01-1... 34 7.1 2
(CO582835) ILLUMIGEN_MCQ_44049 Katze_MMJJ Macaca mulatta cDN... 34 7.1 2
(CA487640) AGENCOURT_10808996 MAPcL Homo sapiens cDNA clone ... 34 7.1 2
(BG249127) 602361731F1 NIH_MGC_89 Homo sapiens cDNA clone IM... 34 7.1 2
(DC850120) Macaca fascicularis mRNA, clone: QspA-05220, 5' e... 34 7.2 2
(DC854099) Macaca fascicularis mRNA, clone: QspA-16197, 5' e... 34 7.2 2
(BQ882013) AGENCOURT_8489644 Lupski_dorsal_root_ganglion Hom... 34 7.2 2
(BX414793) human full-length cDNA 3-PRIME end of clone CS0CA... 34 7.2 2
(CO583509) ILLUMIGEN_MCQ_44971 Katze_MMJJ Macaca mulatta cDN... 34 7.2 2
(BI771787) 603058561F1 NIH_MGC_122 Homo sapiens cDNA clone I... 34 7.2 2
(BQ231842) AGENCOURT_7594864 NIH_MGC_72 Homo sapiens cDNA cl... 34 7.2 2
(DC857053) Macaca fascicularis mRNA, clone: QspA-24241, 5' e... 34 7.2 2
(BG286193) 602383015F1 NIH_MGC_93 Homo sapiens cDNA clone IM... 34 7.2 2
(BE881588) 601490006F1 NIH_MGC_69 Homo sapiens cDNA clone IM... 34 7.2 2
(EU176737) Synthetic construct Homo sapiens clone IMAGE:1000... 34 7.2 2
(DQ892843) Synthetic construct clone IMAGE:100005473; FLH190... 34 7.2 2
(AM393316) Synthetic construct Homo sapiens clone IMAGE:1000... 34 7.2 2
(AM393138) Synthetic construct Homo sapiens clone IMAGE:1000... 34 7.2 2
(BU928842) AGENCOURT_10422524 NIH_MGC_57 Homo sapiens cDNA c... 34 7.2 2
(AR053363) Sequence 1 from patent US 5834235. 34 7.2 2
(BF671595) 602152337F1 NIH_MGC_81 Homo sapiens cDNA clone IM... 34 7.2 2
(BG288708) 602385522F1 NIH_MGC_93 Homo sapiens cDNA clone IM... 34 7.2 2
(BF576462) 602133880F1 NIH_MGC_81 Homo sapiens cDNA clone IM... 34 7.2 2
(DC858067) Macaca fascicularis mRNA, clone: QspA-27171, 5' e... 34 7.2 2
(AX511527) Sequence 50 from Patent WO0246465. 34 7.2 2
(DR159201) HESC2_99_F03.g1_A035 NIH_MGC_258 Homo sapiens cDN... 34 7.2 2
(CK848183) 970906 BARC 5BOV Bos taurus cDNA 3', mRNA sequence. 34 7.2 2
(CJ481440) Macaca fascicularis mRNA, clone: QtrA-17117, 5' e... 34 7.2 2
(BG165462) 602345846F1 NIH_MGC_89 Homo sapiens cDNA clone IM... 34 7.2 2
(DR763506) HESC4_153_C11.g1_A037 NIH_MGC_262 Homo sapiens cD... 34 7.2 2
(BG570172) 602591162F1 NIH_MGC_77 Homo sapiens cDNA clone IM... 34 7.2 2
(DC526353) Pan troglodytes verus mRNA, clone: PorA1348, 5' e... 34 7.2 2
(CN363415) 17000600181352 GRN_PRENEU Homo sapiens cDNA 5', m... 34 7.2 2
(FH070908) CHO_OF3666xa22f1.ab1 CHO_OF3 Nicotiana tabacum ge... 32 7.2 2
(BI765028) 603051170F1 NIH_MGC_116 Homo sapiens cDNA clone I... 34 7.2 2
(BF693826) 602082375F1 NIH_MGC_81 Homo sapiens cDNA clone IM... 34 7.2 2
(BE297412) 601178043F1 NIH_MGC_17 Homo sapiens cDNA clone IM... 34 7.2 2
(BX345042) human full-length cDNA 5-PRIME end of clone CS0DC... 34 7.2 2
(DY755363) 177535 Pigtailed macaque ovary library Macaca nem... 34 7.2 2
(CR629041) Pongo abelii mRNA; EST DKFZp468C1328_r1 (from clo... 34 7.2 2
(BG715422) 602675570F1 NIH_MGC_96 Homo sapiens cDNA clone IM... 34 7.3 2
(CN363416) 17000600111281 GRN_PRENEU Homo sapiens cDNA 5', m... 34 7.3 2
(DT217906) KB-EST0002990 BNS6 Homo sapiens cDNA, mRNA sequence. 34 7.3 2
(DT215167) KB-EST0000251 BNS6 Homo sapiens cDNA, mRNA sequence. 34 7.3 2
(BI835639) 603087603F1 NIH_MGC_120 Homo sapiens cDNA clone I... 34 7.3 2
(BI835398) 603087503F1 NIH_MGC_120 Homo sapiens cDNA clone I... 34 7.3 2
(BI552980) 603193613F1 NIH_MGC_95 Homo sapiens cDNA clone IM... 34 7.3 2
(AU297706) Pan troglodytes verus mRNA, clone:PorB1349, 5' en... 34 7.3 2
(DC526836) Pan troglodytes verus mRNA, clone: PorB1349, 5' e... 34 7.3 2
(CB127877) K-EST0177222 C1SNU17 Homo sapiens cDNA clone C1SN... 34 7.3 2
(BM990660) UI-H-DI0-atr-a-17-0-UI.s1 NCI_CGAP_DI0 Homo sapie... 34 7.3 2
(DT215120) KB-EST0000204 BNS6 Homo sapiens cDNA, mRNA sequence. 34 7.3 2
(EL736933) 14396 Full Length cDNA from the Mammalian Gene Co... 34 7.3 2
(CV029072) 7746 Full Length cDNA from the Mammalian Gene Col... 34 7.3 2
(BI715207) ic30c01.y1 HR85 islet Homo sapiens cDNA 5' simila... 34 7.3 2
(AA748650) ny10c01.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone ... 34 7.3 2
(DA672962) Homo sapiens cDNA clone NETRP2003496, 5' end, mRN... 34 7.3 2
(BF790086) 602249888F1 NIH_MGC_81 Homo sapiens cDNA clone IM... 34 7.3 2
(DY460997) 1593684 MARC 11BOV Bos taurus cDNA 5', mRNA seque... 36 7.3 2
(DA749929) Homo sapiens cDNA clone NT2RP7015547, 5' end, mRN... 34 7.3 2
(BJ990338) Homo sapiens cDNA, clone:hkmt-0872, 5'end. 34 7.3 2
(DA824982) Homo sapiens cDNA clone PERIC2005961, 5' end, mRN... 34 7.3 2
(DA537306) Homo sapiens cDNA clone FEKID1000071, 5' end, mRN... 34 7.3 2
(DA896031) Homo sapiens cDNA clone SKMUS2003720, 5' end, mRN... 34 7.3 2
(DA375969) Homo sapiens cDNA clone BRTHA2007447, 5' end, mRN... 34 7.3 2
(CB151185) K-EST0208048 C1SNU17 Homo sapiens cDNA clone C1SN... 34 7.3 2
(DA143262) Homo sapiens cDNA clone BRALZ2018685, 5' end, mRN... 34 7.3 2
(DA899666) Homo sapiens cDNA clone SKMUS2008271, 5' end, mRN... 34 7.3 2
(BU078109) im64b10.y1 HR85 islet Homo sapiens cDNA clone IMA... 34 7.3 2
(DB128074) Homo sapiens cDNA clone THYMU2038157, 5' end, mRN... 34 7.3 2
(DA666934) Homo sapiens cDNA clone NCRRP2000234, 5' end, mRN... 34 7.3 2
(CN363414) 17000424021692 GRN_ES Homo sapiens cDNA 5', mRNA ... 34 7.3 2
(DA131994) Homo sapiens cDNA clone BRALZ2003774, 5' end, mRN... 34 7.3 2
(DA982632) Homo sapiens cDNA clone SYNOV2014924, 5' end, mRN... 34 7.4 2
(DA511958) Homo sapiens cDNA clone FCBBF4000387, 5' end, mRN... 34 7.4 2
(BF695001) 602083029F1 NIH_MGC_81 Homo sapiens cDNA clone IM... 34 7.4 2
(BG163649) 602338826F1 NIH_MGC_89 Homo sapiens cDNA clone IM... 34 7.4 2
(DB011240) Homo sapiens cDNA clone TCOLN2002452, 5' end, mRN... 34 7.4 2
(DA794064) Homo sapiens cDNA clone OCBBF2034296, 5' end, mRN... 34 7.4 2
(T54916) yb45c04.s1 Stratagene fetal spleen (#937205) Homo s... 34 7.4 2
(CN363417) 17000600180983 GRN_PREHEP Homo sapiens cDNA 5', m... 34 7.4 2
(DA129596) Homo sapiens cDNA clone BRALZ2000568, 5' end, mRN... 34 7.4 2
(CB127255) K-EST0176472 C1SNU17 Homo sapiens cDNA clone C1SN... 34 7.4 2
(BM689748) UI-E-CK1-abm-e-11-0-UI.r1 UI-E-CK1 Homo sapiens c... 34 7.4 2
(DA900347) Homo sapiens cDNA clone SKMUS2009123, 5' end, mRN... 34 7.4 2
(CU929775) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 32 7.4 8
(DN916258) MCF7RNAL21H07TF Human MCF7 breast cancer cell lin... 34 7.4 2
(AA778116) zf45h11.s1 Soares_fetal_heart_NbHH19W Homo sapien... 34 7.4 2
(CQ716768) Sequence 2702 from Patent WO02068579. 34 7.5 2
(BG941894) ax18f03.x1 Hembase; Erythroid Progenitor Cells (L... 34 7.5 2
(EA720551) Sequence 99430 from patent US 7365185. 38 7.5 2
(AX341519) Sequence 1766 from Patent WO0196388. 34 7.5 2
(DD016254) COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAG... 34 7.5 2
(AX347055) Sequence 2126 from Patent WO0200928. 38 7.6 3
(AX339183) Sequence 50 from Patent WO0176451. 38 7.6 3
(AX341004) Sequence 1251 from Patent WO0196388. 34 7.6 2
(DD015739) COMPOSITIONS AND METHODS FOR THE THERAPY AND DIAG... 34 7.6 2
(AC108196) Felis catus clone RP86-591N22, WORKING DRAFT SEQU... 40 7.6 6
(AL595491) Xenopus tropicalis EST, clone TGas005h13 5'. 40 7.6 2
(CS776978) Sequence 44974 from Patent WO2005083127. 32 7.7 2
(AL631515) Xenopus tropicalis EST, clone TGas019k11 5'. 40 7.8 2
(EL730079) CBSS8828.fwd NICHD_XGC_tropSp1 Xenopus (Silurana)... 40 8.0 2
(AE017243) Mycoplasma hyopneumoniae J, complete genome. 30 8.5 19
(EX645388) 256671030 Pea aphid whole body normalized full le... 34 8.5 2
(DV129822) CV03055A1F07.f1 CV03-normalized library Euphorbia... 36 8.5 2
(BZ061560) llf03b07.b1 B.oleracea002 Brassica oleracea genom... 34 8.7 2
(DV126165) CV03044A2G08.f1 CV03-normalized library Euphorbia... 36 8.9 2
(FG187043) AGN_PNL211cr1_g12.trimmed.seq AGN_PNL Nicotiana t... 38 8.9 2
(EL806743) CBSW9531.b1 NICHD_XGC_tropTail_m Xenopus (Siluran... 40 9.1 2
(AP003499) Homo sapiens genomic DNA, chromosome 11q clone:RP... 44 9.2 3
(CX210330) MNS29271 Mouse Neurosphere Normalized cDNA librar... 38 9.2 2
(FK904027) EST_lsal_evj_875304 lsalevj mixed_tissue_mixed_st... 34 9.3 2
(EY179941) CBTI7138.b1_C10.ab1:P Triphysaria pusilla root ti... 38 9.3 2
(EJ438319) 1093015292164 Global-Ocean-Sampling_GS-28-01-01-1... 40 9.3 2
(AM493668) Aspidytes niobe completemitochondrial genome. 36 9.4 2
(BX248583) Blochmannia floridanus complete genome. 36 9.4 16
(AG870470) Oryza sativa Indica Group genomic DNA, BAC end se... 38 9.6 2
(DV684949) CGN-26082 Seed of Middle Development Stage Coffea... 32 9.7 3
(DR525556) WS0272.B21_G01 SS-IL-A-FL-14 Picea sitchensis cDN... 40 9.7 2
(FK907898) EST_lsal_evj_935104 lsalevj mixed_tissue_mixed_st... 34 9.9 2

>(C84708) Dictyostelium discoideum slug cDNA, clone SSE669.
Length = 668

Score = 648 bits (327), Expect(2) = 0.0
Identities = 327/327 (100%)
Strand = Plus / Plus


Query: 408 agttgatctaccatactttgatgtttgcgtagcaaatgttccatatcaaatttcatcacc 467
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 agttgatctaccatactttgatgtttgcgtagcaaatgttccatatcaaatttcatcacc 60


Query: 468 attaacatttaaattattagcacatagaccaatttttagaacagcagtacttatgtttca 527
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 attaacatttaaattattagcacatagaccaatttttagaacagcagtacttatgtttca 120


Query: 528 aaaggagtttgcacttcgtttaggagcaaaaccaggtgatagtttatattgtcgtttatc 587
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 aaaggagtttgcacttcgtttaggagcaaaaccaggtgatagtttatattgtcgtttatc 180


Query: 588 agttaatacacaattattatcaaaagtaacacatttaatgaaagtaggtaagaataattt 647
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 agttaatacacaattattatcaaaagtaacacatttaatgaaagtaggtaagaataattt 240


Query: 648 ccttccaccaccaaaagttgagtcagcagtagttagaattgaaccattcaatccaccacc 707
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 ccttccaccaccaaaagttgagtcagcagtagttagaattgaaccattcaatccaccacc 300


Query: 708 accaattaatttcgttgaatgggatgg 734
|||||||||||||||||||||||||||
Sbjct: 301 accaattaatttcgttgaatgggatgg 327

Score = 573 bits (289), Expect(2) = 0.0
Identities = 289/289 (100%)
Strand = Plus / Plus


Query: 731 atgggatggtttagttaaattatgtttctctagaaaaaataaaacattatcaggtatttt 790
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 319 atgggatggtttagttaaattatgtttctctagaaaaaataaaacattatcaggtatttt 378


Query: 791 cagagttagtagtgtaattgaaactttaaatcaaaattataaaacttattgtgctttaga 850
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 379 cagagttagtagtgtaattgaaactttaaatcaaaattataaaacttattgtgctttaga 438


Query: 851 aggtaaaatgaatactgatggttctgatgaacaaatgaaagaattaatcattaaaacttt 910
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 439 aggtaaaatgaatactgatggttctgatgaacaaatgaaagaattaatcattaaaacttt 498


Query: 911 aactgataatgactttttagattcacgttcttcaaaattagacattaatgatttcttaaa 970
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 499 aactgataatgactttttagattcacgttcttcaaaattagacattaatgatttcttaaa 558


Query: 971 attattaaataaatttcatgaaactggtattcatttcaaataaacaaat 1019
|||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 559 attattaaataaatttcatgaaactggtattcatttcaaataaacaaat 607

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 105743758
Number of Hits to DB: 1,372,752,420
Number of extensions: 92485427
Number of successful extensions: 7733863
Number of sequences better than 10.0: 488
Length of query: 1068
Length of database: 104,622,809,269
Length adjustment: 24
Effective length of query: 1044
Effective length of database: 102,084,959,077
Effective search space: 106576697276388
Effective search space used: 106576697276388
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.31
Homology vs Protein
Query= Contig-U05044-1 (Contig-U05044-1Q) /CSM_Contig/Contig-U05044-1Q.Seq.d
(1068 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(Q54QK7) RecName: Full=Probable dimethyladenosine transferase; ... 394 e-159
CP001575_503(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 263 7e-90
EF676769_1(EF676769|pid:none) Picea sitchensis clone WS02751_I17... 270 1e-87
AM480051_3(AM480051|pid:none) Vitis vinifera contig VV78X039319.... 267 2e-87
CR954208_286(CR954208|pid:none) Ostreococcus tauri strain OTTH05... 256 1e-86
CP000588_275(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 256 2e-85
EU966922_1(EU966922|pid:none) Zea mays clone 298154 dimethyladen... 248 2e-79
AM472995_1(AM472995|pid:none) Vitis vinifera contig VV78X173870.... 236 5e-78
T20417(T20417)hypothetical protein E02H1.1 - Caenorhabditis eleg... 220 1e-74
AC013353_15(AC013353|pid:none) Trypanosoma brucei chromosome 6 c... 228 1e-69
BC158729_1(BC158729|pid:none) Rattus norvegicus DIM1 dimethylade... 262 1e-68
(Q2KHT8) RecName: Full=Probable dimethyladenosine transferase; ... 262 2e-68
(Q9D0D4) RecName: Full=Probable dimethyladenosine transferase; ... 261 3e-68
AM502248_20(AM502248|pid:none) Leishmania infantum chromosome 30. 226 4e-68
AM494967_22(AM494967|pid:none) Leishmania braziliensis chromosom... 226 7e-68
(Q9UNQ2) RecName: Full=Probable dimethyladenosine transferase; ... 259 9e-68
AK299480_1(AK299480|pid:none) Homo sapiens cDNA FLJ56719 complet... 259 9e-68
AK292723_1(AK292723|pid:none) Homo sapiens cDNA FLJ75823 complet... 258 3e-67
(Q95KJ0) RecName: Full=Probable dimethyladenosine transferase; ... 258 3e-67
CT005267_21(CT005267|pid:none) Leishmania major strain Friedlin,... 222 6e-67
BC123077_1(BC123077|pid:none) Xenopus tropicalis hypothetical pr... 256 1e-66
BC106332_1(BC106332|pid:none) Xenopus laevis hypothetical protei... 256 1e-66
BX465215_3(BX465215|pid:none) Zebrafish DNA sequence from clone ... 256 1e-66
BT050150_1(BT050150|pid:none) Salmo salar clone ssal-eve-502-133... 255 2e-66
BT074048_1(BT074048|pid:none) Oncorhynchus mykiss clone omyk-evo... 255 2e-66
BT073467_1(BT073467|pid:none) Oncorhynchus mykiss clone omyk-evn... 254 5e-66
BC078286_1(BC078286|pid:none) Danio rerio zgc:101122, mRNA (cDNA... 253 6e-66
BT080069_1(BT080069|pid:none) Esox lucius clone eluc-evq-520-115... 253 8e-66
(Q9USU2) RecName: Full=Dimethyladenosine transferase; E... 249 1e-64
AM920437_804(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 247 6e-64
T43249(T43249) rRNA (adenine-N6,N6-)-dimethyltransferase (EC 2.1... 246 8e-64
AM270040_72(AM270040|pid:none) Aspergillus niger contig An02c046... 245 2e-63
AC002535_26(AC002535|pid:none) Arabidopsis thaliana chromosome 2... 243 8e-63
BT052247_1(BT052247|pid:none) Medicago truncatula clone MTYF9_FA... 239 9e-62
(P78697) RecName: Full=Dimethyladenosine transferase; E... 236 8e-61
(Q6C7H6) RecName: Full=Dimethyladenosine transferase; E... 236 1e-60
(Q6FKY3) RecName: Full=Dimethyladenosine transferase; E... 233 9e-60
CU928178_5(CU928178|pid:none) Zygosaccharomyces rouxii strain CB... 232 2e-59
CU928167_486(CU928167|pid:none) Kluyveromyces thermotolerans str... 231 3e-59
AL590444_45(AL590444|pid:none) chromosome IV of strain GB-M1 of ... 203 5e-59
(Q09522) RecName: Full=Probable dimethyladenosine transferase; ... 224 5e-57
T09625(T09625) rRNA (adenine-N6,N6-)-dimethyltransferase (EC 2.1... 213 9e-54
AB013389_1(AB013389|pid:none) Arabidopsis thaliana genomic DNA, ... 182 9e-53
FN357554_43(FN357554|pid:none) Schistosoma mansoni genome sequen... 198 3e-49
AM429218_1(AM429218|pid:none) Vitis vinifera contig VV78X029745.... 173 8e-48
AE014187_153(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 189 2e-46
AM910995_316(AM910995|pid:none) Plasmodium knowlesi strain H chr... 186 2e-45
AY120713_1(AY120713|pid:none) Arabidopsis thaliana dimethyladeno... 158 2e-45
CU640366_1401(CU640366|pid:none) Podospora anserina genomic DNA ... 140 2e-39
AY548910_1(AY548910|pid:none) Antonospora locustae putative dime... 120 6e-35
(Q12XH7) RecName: Full=Probable dimethyladenosine transferase; ... 139 2e-31
(Q8TH24) RecName: Full=Probable dimethyladenosine transferase; ... 134 7e-30
(O59487) RecName: Full=Probable dimethyladenosine transferase; ... 133 1e-29
BA000001_1877(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 133 1e-29
(O27381) RecName: Full=Probable dimethyladenosine transferase; ... 132 3e-29
(Q466S6) RecName: Full=Probable dimethyladenosine transferase; ... 130 1e-28
(B6YTK7) RecName: Full=Probable dimethyladenosine transferase; ... 129 1e-28
CP000678_1374(CP000678|pid:none) Methanobrevibacter smithii ATCC... 126 1e-27
(Q5JI54) RecName: Full=Probable dimethyladenosine transferase; ... 124 4e-27
(Q3ARC0) RecName: Full=Dimethyladenosine transferase; E... 123 1e-26
CP001615_1684(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 123 1e-26
(A6UTZ1) RecName: Full=Probable dimethyladenosine transferase; ... 122 2e-26
(Q8TWU7) RecName: Full=Probable dimethyladenosine transferase; ... 120 1e-25
(Q2NE42) RecName: Full=Probable dimethyladenosine transferase; ... 117 5e-25
AM778957_71(AM778957|pid:none) Microcystis aeruginosa PCC 7806 g... 116 1e-24
(Q6NIA2) RecName: Full=Dimethyladenosine transferase; E... 115 2e-24
CU179680_51(CU179680|pid:none) Mycoplasma agalactiae PG2 chromos... 115 2e-24
(B7JWJ7) RecName: Full=Dimethyladenosine transferase; E... 115 3e-24
(Q98RJ3) RecName: Full=Dimethyladenosine transferase; E... 115 3e-24
(Q4FT44) RecName: Full=Dimethyladenosine transferase; E... 106 5e-24
GM016639_250(GM016639|pid:none) Sequence 1469 from Patent EP1923... 114 6e-24
CP000939_81(CP000939|pid:none) Clostridium botulinum B1 str. Okr... 114 6e-24
CP000728_76(CP000728|pid:none) Clostridium botulinum F str. Lang... 114 6e-24
AM412317_83(AM412317|pid:none) Clostridium botulinum A str. ATCC... 114 8e-24
CP001581_83(CP001581|pid:none) Clostridium botulinum A2 str. Kyo... 114 8e-24
CP000726_77(CP000726|pid:none) Clostridium botulinum A str. ATCC... 114 8e-24
(B4S787) RecName: Full=Dimethyladenosine transferase; E... 113 1e-23
AP009153_1882(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 113 1e-23
CP001147_1501(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 113 1e-23
(Q31RH6) RecName: Full=Dimethyladenosine transferase; E... 112 2e-23
(A8MK56) RecName: Full=Dimethyladenosine transferase; E... 112 2e-23
(A9VN54) RecName: Full=Dimethyladenosine transferase; E... 112 3e-23
CP001634_48(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, com... 112 3e-23
(Q58435) RecName: Full=Probable dimethyladenosine transferase; ... 112 3e-23
AX064765_1(AX064765|pid:none) Sequence 1047 from Patent WO0100843. 111 4e-23
AP008957_4360(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 111 4e-23
(B4RBS4) RecName: Full=Dimethyladenosine transferase; E... 111 4e-23
(B7HPV2) RecName: Full=Dimethyladenosine transferase; E... 111 4e-23
(Q8NRY1) RecName: Full=Dimethyladenosine transferase; E... 111 5e-23
(B0R506) RecName: Full=Probable dimethyladenosine transferase; ... 111 5e-23
(A6TJK9) RecName: Full=Dimethyladenosine transferase; E... 110 6e-23
(Q0S4T6) RecName: Full=Dimethyladenosine transferase; E... 110 6e-23
CP000806_2494(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 110 8e-23
(A1BFM9) RecName: Full=Dimethyladenosine transferase; E... 110 8e-23
AP005185_6(AP005185|pid:none) Oryza sativa Japonica Group genomi... 98 9e-23
(Q3AKE0) RecName: Full=Dimethyladenosine transferase; E... 110 1e-22
(B7GFH0) RecName: Full=Dimethyladenosine transferase; E... 110 1e-22
AM743169_776(AM743169|pid:none) Stenotrophomonas maltophilia K27... 109 1e-22
CP000477_978(CP000477|pid:none) Methanosaeta thermophila PT, com... 109 1e-22
(Q6LYK4) RecName: Full=Probable dimethyladenosine transferase; ... 109 2e-22
CP000962_75(CP000962|pid:none) Clostridium botulinum A3 str. Loc... 109 2e-22
(Q31F24) RecName: Full=Dimethyladenosine transferase; E... 108 2e-22
(A5GLH7) RecName: Full=Dimethyladenosine transferase; E... 108 2e-22
CP001638_37(CP001638|pid:none) Geobacillus sp. WCH70, complete g... 108 2e-22
CP001056_105(CP001056|pid:none) Clostridium botulinum B str. Ekl... 108 2e-22
CP001338_527(CP001338|pid:none) Candidatus Methanosphaerula palu... 108 3e-22
(Q5WLW2) RecName: Full=Dimethyladenosine transferase; E... 108 3e-22
AP011115_5733(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 108 4e-22
CP001111_668(CP001111|pid:none) Stenotrophomonas maltophilia R55... 108 4e-22
(Q87C85) RecName: Full=Dimethyladenosine transferase; E... 108 4e-22
(Q04C60) RecName: Full=Dimethyladenosine transferase; E... 105 5e-22
CP000382_2176(CP000382|pid:none) Clostridium novyi NT, complete ... 107 5e-22
AM181176_5460(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 107 5e-22
CT573326_385(CT573326|pid:none) Pseudomonas entomophila str. L48... 107 5e-22
(Q2FSA9) RecName: Full=Probable dimethyladenosine transferase; ... 107 5e-22
(B3EIC2) RecName: Full=Dimethyladenosine transferase; E... 107 7e-22
(A7GJV3) RecName: Full=Dimethyladenosine transferase; E... 107 7e-22
AP008955_90(AP008955|pid:none) Brevibacillus brevis NBRC 100599 ... 107 7e-22
CP000916_1057(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 107 7e-22
(B3QMU5) RecName: Full=Dimethyladenosine transferase; E... 107 7e-22
(A9AAW1) RecName: Full=Probable dimethyladenosine transferase; ... 107 7e-22
CP000949_4771(CP000949|pid:none) Pseudomonas putida W619, comple... 107 7e-22
(Q3A8X5) RecName: Full=Dimethyladenosine transferase; E... 107 9e-22
CP000560_43(CP000560|pid:none) Bacillus amyloliquefaciens FZB42,... 107 9e-22
(A5GTK9) RecName: Full=Dimethyladenosine transferase; E... 106 1e-21
CP001340_1755(CP001340|pid:none) Caulobacter crescentus NA1000, ... 106 1e-21
AP009049_3325(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 106 2e-21
AP009608_525(AP009608|pid:none) Mycoplasma fermentans PG18 DNA, ... 106 2e-21
(A6VFS2) RecName: Full=Probable dimethyladenosine transferase; ... 106 2e-21
CP001344_3216(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 106 2e-21
(P37468) RecName: Full=Dimethyladenosine transferase; E... 106 2e-21
(A4FY32) RecName: Full=Probable dimethyladenosine transferase; ... 106 2e-21
AE016828_1908(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 105 2e-21
(A9KGZ8) RecName: Full=Dimethyladenosine transferase; E... 105 2e-21
CU466930_1728(CU466930|pid:none) Candidatus Cloacamonas acidamin... 105 2e-21
(A1TEH3) RecName: Full=Dimethyladenosine transferase; E... 105 2e-21
(B1LBH5) RecName: Full=Dimethyladenosine transferase; E... 105 2e-21
(Q5YPY6) RecName: Full=Dimethyladenosine transferase; E... 105 2e-21
(A4IJB8) RecName: Full=Dimethyladenosine transferase; E... 105 2e-21
CP001291_4367(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 105 3e-21
(B1HS82) RecName: Full=Dimethyladenosine transferase; E... 105 3e-21
(Q5L3V8) RecName: Full=Dimethyladenosine transferase; E... 105 3e-21
(P72666) RecName: Full=Dimethyladenosine transferase; E... 105 3e-21
(Q74C12) RecName: Full=Dimethyladenosine transferase; E... 105 4e-21
(A5D673) RecName: Full=Dimethyladenosine transferase; E... 105 4e-21
(B0RUI3) RecName: Full=Dimethyladenosine transferase; E... 105 4e-21
(Q9X1F1) RecName: Full=Dimethyladenosine transferase; E... 105 4e-21
(Q3AXF3) RecName: Full=Dimethyladenosine transferase; E... 105 4e-21
CP000721_59(CP000721|pid:none) Clostridium beijerinckii NCIMB 80... 105 4e-21
(A4T6P3) RecName: Full=Dimethyladenosine transferase; E... 105 4e-21
(Q4UR39) RecName: Full=Dimethyladenosine transferase; E... 104 5e-21
(B6J641) RecName: Full=Dimethyladenosine transferase; E... 104 6e-21
(Q88QT6) RecName: Full=Dimethyladenosine transferase; E... 104 6e-21
CP001322_3102(CP001322|pid:none) Desulfatibacillum alkenivorans ... 104 6e-21
CP001185_462(CP001185|pid:none) Thermosipho africanus TCF52B, co... 103 8e-21
(B0CC89) RecName: Full=Dimethyladenosine transferase; E... 103 8e-21
CP000607_1021(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 103 8e-21
CP001644_402(CP001644|pid:none) Ralstonia pickettii 12D chromoso... 103 1e-20
CP001614_2812(CP001614|pid:none) Teredinibacter turnerae T7901, ... 103 1e-20
(Q8FQZ5) RecName: Full=Dimethyladenosine transferase; E... 103 1e-20
(Q0AQC3) RecName: Full=Dimethyladenosine transferase; E... 103 1e-20
(A1WS95) RecName: Full=Dimethyladenosine transferase; E... 103 1e-20
AM942444_563(AM942444|pid:none) Corynebacterium urealyticum DSM ... 103 1e-20
CP001098_2155(CP001098|pid:none) Halothermothrix orenii H 168, c... 103 1e-20
(Q3K5T2) RecName: Full=Dimethyladenosine transferase; E... 103 1e-20
CP001390_2895(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 103 1e-20
(Q88A46) RecName: Full=Dimethyladenosine transferase; E... 103 1e-20
(A5IME8) RecName: Full=Dimethyladenosine transferase; E... 103 1e-20
(Q4ZMG5) RecName: Full=Dimethyladenosine transferase; E... 102 2e-20
(B2SPT3) RecName: Full=Dimethyladenosine transferase; E... 102 2e-20
CP001251_1425(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 102 2e-20
CP000744_735(CP000744|pid:none) Pseudomonas aeruginosa PA7, comp... 102 2e-20
(A1KHE8) RecName: Full=Dimethyladenosine transferase; E... 102 2e-20
(B1Y7L9) RecName: Full=Dimethyladenosine transferase; E... 102 2e-20
CP000712_428(CP000712|pid:none) Pseudomonas putida F1, complete ... 102 2e-20
AM285301_42(AM285301|pid:none) Spiroplasma citri GII3-3X chromos... 102 3e-20
(Q0SQ34) RecName: Full=Dimethyladenosine transferase; E... 102 3e-20
(Q9A7N5) RecName: Full=Dimethyladenosine transferase; E... 102 3e-20
(Q5ZZN4) RecName: Full=Dimethyladenosine transferase; E... 102 3e-20
(Q47SX4) RecName: Full=Dimethyladenosine transferase; E... 101 4e-20
CP001157_4520(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 101 4e-20
CP000698_2270(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 101 4e-20
(Q8Y219) RecName: Full=Dimethyladenosine transferase; E... 101 4e-20
(Q741W2) RecName: Full=Dimethyladenosine transferase; E... 101 4e-20
(Q8KE87) RecName: Full=Dimethyladenosine transferase; E... 101 4e-20
CP000053_256(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 101 5e-20
(Q475Q1) RecName: Full=Dimethyladenosine transferase; E... 101 5e-20
(Q4UMV1) RecName: Full=Dimethyladenosine transferase; E... 101 5e-20
(Q4K4X5) RecName: Full=Dimethyladenosine transferase; E... 101 5e-20
(Q8YS62) RecName: Full=Dimethyladenosine transferase; E... 101 5e-20
(A8GPG7) RecName: Full=Dimethyladenosine transferase; E... 101 5e-20
(Q7V7W0) RecName: Full=Dimethyladenosine transferase; E... 101 5e-20
(B1N079) RecName: Full=Dimethyladenosine transferase; E... 101 5e-20
CP001229_1145(CP001229|pid:none) Sulfurihydrogenibium azorense A... 100 7e-20
(A2CA51) RecName: Full=Dimethyladenosine transferase; E... 100 7e-20
(Q97EX0) RecName: Full=Dimethyladenosine transferase; E... 100 7e-20
(Q4A775) RecName: Full=Dimethyladenosine transferase; E... 100 9e-20
(Q48NT7) RecName: Full=Dimethyladenosine transferase; E... 100 9e-20
(Q4A936) RecName: Full=Dimethyladenosine transferase; E... 100 1e-19
(Q1RK29) RecName: Full=Dimethyladenosine transferase; E... 100 1e-19
CP000750_1041(CP000750|pid:none) Kineococcus radiotolerans SRS30... 100 1e-19
CP000438_610(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA1... 100 1e-19
AY658567_1(AY658567|pid:none) Synthetic construct Peudomonas aer... 100 1e-19
CP000771_448(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 100 1e-19
(Q68W66) RecName: Full=Dimethyladenosine transferase; E... 100 1e-19
(A1R4F7) RecName: Full=Dimethyladenosine transferase; E... 100 1e-19
(A9A0E0) RecName: Full=Dimethyladenosine transferase; E... 100 1e-19
(Q3M3F3) RecName: Full=Dimethyladenosine transferase; E... 100 1e-19
(A6QEE6) RecName: Full=Dimethyladenosine transferase; E... 100 1e-19
(Q3JAF3) RecName: Full=Dimethyladenosine transferase; E... 99 2e-19
(Q8DXR8) RecName: Full=Dimethyladenosine transferase; E... 99 2e-19
CP000521_3297(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 99 2e-19
(Q18GB5) RecName: Full=Probable dimethyladenosine transferase; ... 99 2e-19
(Q6GJH8) RecName: Full=Dimethyladenosine transferase; E... 99 2e-19
(Q2LSQ6) RecName: Full=Dimethyladenosine transferase; E... 99 2e-19
(A8EZN3) RecName: Full=Dimethyladenosine transferase; E... 99 3e-19
(Q9CHN8) RecName: Full=Dimethyladenosine transferase; E... 99 3e-19
(Q2YVV2) RecName: Full=Dimethyladenosine transferase; E... 99 3e-19
CP000425_643(CP000425|pid:none) Lactococcus lactis subsp. cremor... 99 3e-19
(A6UP00) RecName: Full=Probable dimethyladenosine transferase; ... 99 3e-19
AP009178_61(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomic... 99 3e-19
(A1U6F8) RecName: Full=Dimethyladenosine transferase; E... 99 3e-19
CP000480_5254(CP000480|pid:none) Mycobacterium smegmatis str. MC... 99 3e-19
(Q5LQN0) RecName: Full=Dimethyladenosine transferase; E... 98 4e-19
(Q1LRA1) RecName: Full=Dimethyladenosine transferase; E... 98 4e-19
(A1WD86) RecName: Full=Dimethyladenosine transferase; E... 98 6e-19
(B2J0A6) RecName: Full=Dimethyladenosine transferase; E... 98 6e-19
CP000304_723(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 98 6e-19
(B1XIV9) RecName: Full=Dimethyladenosine transferase; E... 98 6e-19
(P59156) RecName: Full=Dimethyladenosine transferase; E... 98 6e-19
(Q7VCH7) RecName: Full=Dimethyladenosine transferase; E... 98 6e-19
(Q3JZA5) RecName: Full=Dimethyladenosine transferase; E... 98 6e-19
(Q47VJ8) RecName: Full=Dimethyladenosine transferase; E... 98 6e-19
(Q9RED9) RecName: Full=Dimethyladenosine transferase; E... 97 7e-19
CP001087_265(CP001087|pid:none) Desulfobacterium autotrophicum H... 97 7e-19
CP000850_709(CP000850|pid:none) Salinispora arenicola CNS-205, c... 97 7e-19
AM406671_1843(AM406671|pid:none) Lactococcus lactis subsp. cremo... 97 7e-19
(Q67JB9) RecName: Full=Dimethyladenosine transferase; E... 97 1e-18
CP001635_5212(CP001635|pid:none) Variovorax paradoxus S110 chrom... 97 1e-18
CP000613_1519(CP000613|pid:none) Rhodospirillum centenum SW, com... 97 1e-18
CP000612_75(CP000612|pid:none) Desulfotomaculum reducens MI-1, c... 97 1e-18
CP000934_845(CP000934|pid:none) Cellvibrio japonicus Ueda107, co... 97 1e-18
CP001146_1314(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 97 1e-18
CP001620_499(CP001620|pid:none) Corynebacterium kroppenstedtii D... 97 1e-18
(Q837A7) RecName: Full=Dimethyladenosine transferase; E... 97 1e-18
(Q2N8W9) RecName: Full=Dimethyladenosine transferase; E... 97 1e-18
AM946015_1603(AM946015|pid:none) Streptococcus uberis 0140J comp... 97 1e-18
AE017261_386(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 97 1e-18
CP000968_1392(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 96 2e-18
(B4TWT6) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(B4T6L6) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(B5EL84) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(B3PLS2) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(Q1B416) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
FP236842_711(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 96 2e-18
(Q8K8N6) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(B1VUF9) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
CP000003_254(CP000003|pid:none) Streptococcus pyogenes MGAS10394... 96 2e-18
(Q1JIN6) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(Q5NMX2) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(Q1JDL6) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
(Q1J8J4) RecName: Full=Dimethyladenosine transferase; E... 96 2e-18
CP001014_1684(CP001014|pid:none) Thermoproteus neutrophilus V24S... 96 2e-18
CT573071_642(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 96 2e-18
(Q5QVN7) RecName: Full=Dimethyladenosine transferase; E... 96 3e-18
(Q03IR2) RecName: Full=Dimethyladenosine transferase; E... 96 3e-18
CP001080_834(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 95 4e-18
CU458896_1116(CU458896|pid:none) Mycobacterium abscessus chromos... 95 4e-18
(Q6AAD7) RecName: Full=Dimethyladenosine transferase; E... 95 4e-18
AP009247_483(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 95 4e-18
(B1AJP2) RecName: Full=Dimethyladenosine transferase; E... 95 5e-18
(A2SC77) RecName: Full=Dimethyladenosine transferase; E... 95 5e-18
(A0KGT8) RecName: Full=Dimethyladenosine transferase; E... 95 5e-18
AM420293_788(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 95 5e-18
CP000263_80(CP000263|pid:none) Buchnera aphidicola str. Cc (Cina... 95 5e-18
(A7ZHE4) RecName: Full=Dimethyladenosine transferase; E... 94 6e-18
(B7N7S6) RecName: Full=Dimethyladenosine transferase; E... 94 6e-18
CP000774_3324(CP000774|pid:none) Parvibaculum lavamentivorans DS... 94 6e-18
(B5ZCB6) RecName: Full=Dimethyladenosine transferase; E... 94 6e-18
(P43038) RecName: Full=Dimethyladenosine transferase; E... 94 8e-18
AE009440_1096(AE009440|pid:none) Chlamydophila pneumoniae TW-183... 94 8e-18
(Q32K43) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(B5Y1Z4) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(Q87ST6) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(Q1GI39) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(A6T4I7) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(Q88Z93) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(Q9Z6K0) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(Q164G1) RecName: Full=Dimethyladenosine transferase; E... 94 1e-17
(A7MIA7) RecName: Full=Dimethyladenosine transferase; E... 93 1e-17
CP000920_1825(CP000920|pid:none) Streptococcus pneumoniae P1031,... 93 1e-17
FM954972_322(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 93 1e-17
(Q8R6B1) RecName: Full=Dimethyladenosine transferase; E... 93 1e-17
(Q479U6) RecName: Full=Dimethyladenosine transferase; E... 93 1e-17
(A8HVI9) RecName: Full=Dimethyladenosine transferase; E... 93 1e-17
(A5F8N2) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
(A8AUQ4) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
(B3Q9S4) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
(A8ALP9) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
(Q83MG8) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
CP000716_229(CP000716|pid:none) Thermosipho melanesiensis BI429,... 93 2e-17
AE003852_438(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 93 2e-17
(B6HZ32) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
(Q0HLT2) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
(A7ZW03) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
(B7LVU5) RecName: Full=Dimethyladenosine transferase; E... 93 2e-17
CP001114_1145(CP001114|pid:none) Deinococcus deserti VCD115, com... 93 2e-17
CU928162_51(CU928162|pid:none) Escherichia coli ED1a chromosome,... 92 2e-17
AM711867_2396(AM711867|pid:none) Clavibacter michiganensis subsp... 92 2e-17
CP001107_235(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 92 2e-17
(Q1DAP2) RecName: Full=Dimethyladenosine transferase; E... 92 2e-17
(Q97NN5) RecName: Full=Dimethyladenosine transferase; E... 92 2e-17
(Q1AXL9) RecName: Full=Dimethyladenosine transferase; E... 92 2e-17
AE005672_1884(AE005672|pid:none) Streptococcus pneumoniae TIGR4,... 92 2e-17
CP000909_873(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 92 2e-17
(Q11HG9) RecName: Full=Dimethyladenosine transferase; E... 92 2e-17
(A7MWC6) RecName: Full=Dimethyladenosine transferase; E... 92 2e-17
(Q8EB93) RecName: Full=Dimethyladenosine transferase; E... 92 3e-17
(Q724M5) RecName: Full=Dimethyladenosine transferase; E... 92 3e-17
(A5FLP4) RecName: Full=Dimethyladenosine transferase; E... 92 3e-17
(A1TWF5) RecName: Full=Dimethyladenosine transferase; E... 92 3e-17
CR378664_47(CR378664|pid:none) Photobacterium profundum SS9; seg... 92 3e-17
FM204883_318(FM204883|pid:none) Streptococcus equi subsp. equi 4... 92 3e-17
CP000780_1862(CP000780|pid:none) Candidatus Methanoregula boonei... 92 3e-17
CP001616_2337(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 92 3e-17
(A1WVT7) RecName: Full=Dimethyladenosine transferase; E... 92 3e-17
(B2IM67) RecName: Full=Dimethyladenosine transferase; E... 92 4e-17
CP001365_2075(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 92 4e-17
CP000388_3394(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 92 4e-17
(Q7N8V7) RecName: Full=Dimethyladenosine transferase; E... 92 4e-17
CP000699_403(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 92 4e-17
(Q2YBP5) RecName: Full=Dimethyladenosine transferase; E... 92 4e-17
(Q181C1) RecName: Full=Dimethyladenosine transferase; E... 91 5e-17
(Q82HC3) RecName: Full=Dimethyladenosine transferase; E... 91 5e-17
CP000407_1993(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 91 5e-17
AP009152_1737(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 91 5e-17
CP000236_622(CP000236|pid:none) Ehrlichia chaffeensis str. Arkan... 91 5e-17
DQ361583_1(DQ361583|pid:none) Shigella boydii strain G1287 KsgA ... 91 5e-17
AM849034_2267(AM849034|pid:none) Clavibacter michiganensis subsp... 91 5e-17
CP000854_4413(CP000854|pid:none) Mycobacterium marinum M, comple... 91 7e-17
DQ121375_14(DQ121375|pid:none) Uncultured bacterium clone YC01A0... 91 7e-17
(A5IIC0) RecName: Full=Dimethyladenosine transferase; E... 91 7e-17
CP000860_45(CP000860|pid:none) Candidatus Desulforudis audaxviat... 91 7e-17
(Q9K3R5) RecName: Full=Dimethyladenosine transferase; E... 91 7e-17
DQ361582_1(DQ361582|pid:none) Shigella boydii strain G1191 KsgA ... 91 9e-17
DQ361616_1(DQ361616|pid:none) Shigella flexneri strain 579 KsgA ... 91 9e-17
DQ361618_1(DQ361618|pid:none) Shigella flexneri strain 581 KsgA ... 91 9e-17
CP000918_1931(CP000918|pid:none) Streptococcus pneumoniae 70585,... 91 9e-17
DQ361584_1(DQ361584|pid:none) Shigella boydii strain G1226 KsgA ... 91 9e-17
(B6EL48) RecName: Full=Dimethyladenosine transferase; E... 91 9e-17
CP000589_84(CP000589|pid:none) Ostreococcus lucimarinus CCE9901 ... 91 9e-17
(Q135P2) RecName: Full=Dimethyladenosine transferase; E... 90 1e-16
(Q6ME80) RecName: Full=Dimethyladenosine transferase; E... 90 1e-16
DQ361613_1(DQ361613|pid:none) Shigella flexneri strain 576 KsgA ... 90 1e-16
(A3D188) RecName: Full=Dimethyladenosine transferase; E... 90 1e-16
(Q223E6) RecName: Full=Dimethyladenosine transferase; E... 90 1e-16
(Q1GZB8) RecName: Full=Dimethyladenosine transferase; E... 90 1e-16
(Q6LV41) RecName: Full=Dimethyladenosine transferase; E... 90 1e-16
(Q5ZRF4) RecName: Full=Dimethyladenosine transferase; E... 90 1e-16
(Q1LSS2) RecName: Full=Dimethyladenosine transferase; E... 90 2e-16
CP000249_3919(CP000249|pid:none) Frankia sp. CcI3, complete geno... 90 2e-16
(B3DP38) RecName: Full=Dimethyladenosine transferase; E... 90 2e-16
(A6WK59) RecName: Full=Dimethyladenosine transferase; E... 90 2e-16
CP001472_508(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 88 2e-16
(O67680) RecName: Full=Dimethyladenosine transferase; E... 89 2e-16
CP001154_25(CP001154|pid:none) Laribacter hongkongensis HLHK9, c... 89 2e-16
CP001213_1514(CP001213|pid:none) Bifidobacterium animalis subsp.... 89 2e-16
(A1B0G4) RecName: Full=Dimethyladenosine transferase; E... 89 2e-16
FM872308_361(FM872308|pid:none) Chlamydia trachomatis JALI20 ser... 89 2e-16
(Q3Z9F0) RecName: Full=Dimethyladenosine transferase; E... 89 2e-16
CP000910_2955(CP000910|pid:none) Renibacterium salmoninarum ATCC... 89 2e-16
(Q2T114) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
(A6L1N4) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
AC093568_20(AC093568|pid:none) Oryza sativa chromosome 10 clone ... 89 3e-16
(Q984S7) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
(Q7P1U1) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
(P45438) RecName: Full=rRNA adenine N-6-methyltransferase; ... 89 3e-16
(Q1ILA1) RecName: Full=Dimethyladenosine transferase; E... 84 3e-16
CP001655_551(CP001655|pid:none) Dickeya zeae Ech1591, complete g... 89 3e-16
(A3CQN5) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
(Q5HBC6) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
CP000812_1056(CP000812|pid:none) Thermotoga lettingae TMO, compl... 89 3e-16
(B1V9I5) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
(A8FRV2) RecName: Full=Dimethyladenosine transferase; E... 89 3e-16
FM872307_362(FM872307|pid:none) Chlamydia trachomatis B/TZ1A828/... 89 3e-16
(A1RMU8) RecName: Full=Dimethyladenosine transferase; E... 88 5e-16
(Q07YJ8) RecName: Full=Dimethyladenosine transferase; E... 88 5e-16
(Q1QZ31) RecName: Full=Dimethyladenosine transferase; E... 88 5e-16
(B5FGG5) RecName: Full=Dimethyladenosine transferase; E... 88 5e-16
(Q6F2B4) RecName: Full=Dimethyladenosine transferase; E... 88 5e-16
(Q215S4) RecName: Full=Dimethyladenosine transferase; E... 88 5e-16
CP000448_52(CP000448|pid:none) Syntrophomonas wolfei subsp. wolf... 88 5e-16
(Q03HF6) RecName: Full=Dimethyladenosine transferase; E... 88 6e-16
AP010872_303(AP010872|pid:none) Candidatus Ishikawaella capsulat... 88 6e-16
FJ236519_1(FJ236519|pid:none) Neisseria gonorrhoeae isolate PID ... 88 6e-16
CP001337_2218(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 88 6e-16
(Q2G9Z2) RecName: Full=Dimethyladenosine transferase; E... 88 6e-16
(Q2NIH8) RecName: Full=Dimethyladenosine transferase; E... 88 6e-16
(A8G4P1) RecName: Full=Dimethyladenosine transferase; E... 87 8e-16
(Q92GV0) RecName: Full=Dimethyladenosine transferase; E... 87 8e-16
(Q03T56) RecName: Full=Dimethyladenosine transferase; E... 87 8e-16
(A1JJF4) RecName: Full=Dimethyladenosine transferase; E... 87 8e-16
(Q9JVC2) RecName: Full=Dimethyladenosine transferase; E... 87 8e-16
(A3MZB7) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
(A7FMC1) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
(B4RJV5) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
AM494475_438(AM494475|pid:none) Orientia tsutsugamushi Boryong c... 87 1e-15
AE000513_1497(AE000513|pid:none) Deinococcus radiodurans R1 chro... 87 1e-15
FJ236543_1(FJ236543|pid:none) Neisseria gonorrhoeae isolate ksgA... 87 1e-15
(Q1GT31) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
FJ236544_1(FJ236544|pid:none) Neisseria gonorrhoeae isolate PID ... 87 1e-15
(Q9RU68) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
(A0Q5E0) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
CP001281_1413(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 87 1e-15
(A4TQD8) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
FJ236541_1(FJ236541|pid:none) Neisseria gonorrhoeae isolate ksgA... 87 1e-15
(Q8RDC8) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
(A4IZF1) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
(Q493R7) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
AB024564_2(AB024564|pid:none) Bacillus halodurans gene for TNPA,... 87 1e-15
(Q92F79) RecName: Full=Dimethyladenosine transferase; E... 87 1e-15
(Q39D37) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
(A1STS1) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
CP001124_2267(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 86 2e-15
(B2RHC2) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
(B0BTQ4) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
(Q11UL8) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
(Q145L1) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
CP000264_1809(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 86 2e-15
(Q28RD6) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
(Q7V1E1) RecName: Full=Dimethyladenosine transferase; E... 86 2e-15
(A6LF39) RecName: Full=Dimethyladenosine transferase; E... 86 3e-15
AF051326_1(AF051326|pid:none) Arabidopsis thaliana dimethyladeno... 86 3e-15
(B0URM7) RecName: Full=Dimethyladenosine transferase; E... 86 3e-15
(Q5LHC9) RecName: Full=Dimethyladenosine transferase; E... 86 3e-15
CP001150_1221(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 86 3e-15
CP001607_2054(CP001607|pid:none) Aggregatibacter aphrophilus NJ8... 85 4e-15
(A9AFE4) RecName: Full=Dimethyladenosine transferase; E... 85 4e-15
(B4UDZ6) RecName: Full=Dimethyladenosine transferase; E... 85 4e-15
(A4WRK3) RecName: Full=Dimethyladenosine transferase; E... 85 4e-15
(A6U7I6) RecName: Full=Dimethyladenosine transferase; E... 85 4e-15
(Q6ADP1) RecName: Full=Dimethyladenosine transferase; E... 85 4e-15
CP001277_722(CP001277|pid:none) Candidatus Hamiltonella defensa ... 85 4e-15
CP001358_1077(CP001358|pid:none) Desulfovibrio desulfuricans sub... 79 5e-15
BA000011_317(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 85 5e-15
FJ236535_1(FJ236535|pid:none) Neisseria gonorrhoeae isolate ksgA... 85 5e-15
FJ236536_1(FJ236536|pid:none) Neisseria gonorrhoeae isolate ksgA... 85 5e-15
CP000875_4072(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 84 7e-15
EU016576_3(EU016576|pid:none) Uncultured marine microorganism HF... 84 7e-15
CP000804_279(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 84 7e-15
CP000679_255(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 84 7e-15
(Q9PK40) RecName: Full=Dimethyladenosine transferase; E... 84 7e-15
(Q07LF4) RecName: Full=Dimethyladenosine transferase; E... 84 8e-15
A47697(A47697)probable methyltransferase (EC 2.1.1.-) - Bacillus... 84 8e-15
(A7GVW6) RecName: Full=Dimethyladenosine transferase; E... 84 8e-15
(Q3IFD1) RecName: Full=Dimethyladenosine transferase; E... 84 8e-15
CP001622_1189(CP001622|pid:none) Rhizobium leguminosarum bv. tri... 84 1e-14
CP001321_676(CP001321|pid:none) Haemophilus parasuis SH0165, com... 84 1e-14
(A1VUN7) RecName: Full=Dimethyladenosine transferase; E... 84 1e-14
(Q2IX80) RecName: Full=Dimethyladenosine transferase; E... 84 1e-14
CP000976_568(CP000976|pid:none) Borrelia duttonii Ly, complete g... 84 1e-14
(Q03986) RecName: Full=rRNA adenine N-6-methyltransferase; ... 84 1e-14
(Q04720) RecName: Full=rRNA adenine N-6-methyltransferase; ... 84 1e-14
(Q6MQ47) RecName: Full=Dimethyladenosine transferase; E... 83 1e-14
AY966999_1(AY966999|pid:none) Synthetic construct isolate FTT046... 83 1e-14
(P57241) RecName: Full=Dimethyladenosine transferase; E... 83 1e-14
CP001145_1210(CP001145|pid:none) Coprothermobacter proteolyticus... 83 1e-14
CP000924_2084(CP000924|pid:none) Thermoanaerobacter pseudethanol... 83 1e-14
(B2UVG9) RecName: Full=Dimethyladenosine transferase; E... 82 2e-14
(A5EIA8) RecName: Full=Dimethyladenosine transferase; E... 83 2e-14
(B0TZ54) RecName: Full=Dimethyladenosine transferase; E... 83 2e-14
(B7J2F3) RecName: Full=Dimethyladenosine transferase; E... 83 2e-14
CP001628_504(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 83 2e-14
CP000923_67(CP000923|pid:none) Thermoanaerobacter sp. X514, comp... 83 2e-14
AY774695_1(AY774695|pid:none) Synthetic construct Francisella tu... 83 2e-14
(Q0BC07) RecName: Full=Dimethyladenosine transferase; E... 83 2e-14
(Q823V2) RecName: Full=Dimethyladenosine transferase; E... 82 2e-14
(A4YT90) RecName: Full=Dimethyladenosine transferase; E... 82 2e-14
(B3CPY6) RecName: Full=Dimethyladenosine transferase; E... 82 3e-14
AP010904_2063(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 82 3e-14
(B0CL06) RecName: Full=Dimethyladenosine transferase; E... 82 3e-14
(A5VPL7) RecName: Full=Dimethyladenosine transferase; E... 82 3e-14
(Q65UX3) RecName: Full=Dimethyladenosine transferase; E... 82 3e-14
(A2BWR2) RecName: Full=Dimethyladenosine transferase; E... 82 4e-14
CP001158_127(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 82 4e-14
(Q5L6H5) RecName: Full=Dimethyladenosine transferase; E... 82 4e-14
FJ236542_1(FJ236542|pid:none) Neisseria gonorrhoeae isolate ksgA... 81 6e-14
CP000048_568(CP000048|pid:none) Borrelia hermsii DAH, complete g... 81 6e-14
(Q2GE45) RecName: Full=Dimethyladenosine transferase; E... 81 7e-14
AC155886_26(AC155886|pid:none) Medicago truncatula chromosome 7 ... 80 9e-14
AP009510_761(AP009510|pid:none) Uncultured Termite group 1 bacte... 80 9e-14
CP000820_756(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 80 9e-14
(A4G256) RecName: Full=Dimethyladenosine transferase; E... 80 9e-14
CP000993_557(CP000993|pid:none) Borrelia recurrentis A1, complet... 80 1e-13
(Q3SRZ8) RecName: Full=Dimethyladenosine transferase; E... 80 1e-13
CP000896_15(CP000896|pid:none) Acholeplasma laidlawii PG-8A, com... 80 1e-13
(Q9CLL5) RecName: Full=Dimethyladenosine transferase; E... 80 1e-13
EU016600_25(EU016600|pid:none) Uncultured Group I marine crenarc... 80 1e-13
CP001389_884(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 80 1e-13
(Q9ZJI7) RecName: Full=Dimethyladenosine transferase; E... 79 1e-13

>(Q54QK7) RecName: Full=Probable dimethyladenosine transferase;
EC=2.1.1.-; AltName:
Full=S-adenosylmethionine-6-N',N'-adenosyl(rRNA)
dimethyltransferase; AltName: Full=18S rRNA dimethylase;
Length = 314

Score = 394 bits (1012), Expect(2) = e-159
Identities = 204/226 (90%), Positives = 205/226 (90%), Gaps = 2/226 (0%)
Frame = +1

Query: 70 MVKPVKIGVDAKVEKTKSATAARHHEFQMNKSYGQHLLXNRLIIDAIVDKSQLKSTDTVL 249
MVKPVKIGVDAKVEKTKSATAARHHEFQMNKSYGQHLL N LIIDAIVDKSQLKSTDTVL
Sbjct: 1 MVKPVKIGVDAKVEKTKSATAARHHEFQMNKSYGQHLLKNPLIIDAIVDKSQLKSTDTVL 60

Query: 250 EIGPGTGNLTMKLLENCKKVIAIEVDPRMAAELQKRVAASPYAQHLQIILGDL--VDLPY 423
EIGPGTGNLTMKLLENCKKVIAIEVDPRMAAELQKRVAASPYAQHLQIILGD VDLPY
Sbjct: 61 EIGPGTGNLTMKLLENCKKVIAIEVDPRMAAELQKRVAASPYAQHLQIILGDFLKVDLPY 120

Query: 424 FDVCVANVPYQISSPLTFKLLAHRPIFRTAVLMFQKEFALRLGAKPGDSLYCRLSVNTQL 603
FDVCVANVPYQISSPLTFKLLAHRPIFRTAVLMFQKEFALRLGAKPGDSLYCRLSVNTQL
Sbjct: 121 FDVCVANVPYQISSPLTFKLLAHRPIFRTAVLMFQKEFALRLGAKPGDSLYCRLSVNTQL 180

Query: 604 LSKVTHLMKVGKNNFLPPPKVESAVXXXXXXXXXXXXXXXXWDGMV 741
LSKVTHLMKVGKNNFLPPPKVESAV WDG+V
Sbjct: 181 LSKVTHLMKVGKNNFLPPPKVESAVVRIEPFNPPPPINFVEWDGLV 226

Score = 191 bits (485), Expect(2) = e-159
Identities = 93/93 (100%), Positives = 93/93 (100%)
Frame = +3

Query: 732 WDGLVKLCFSRKNKTLSGIFRVSSVIETLNQNYKTYCALEGKMNTDGSDEQMKELIIKTL 911
WDGLVKLCFSRKNKTLSGIFRVSSVIETLNQNYKTYCALEGKMNTDGSDEQMKELIIKTL
Sbjct: 222 WDGLVKLCFSRKNKTLSGIFRVSSVIETLNQNYKTYCALEGKMNTDGSDEQMKELIIKTL 281

Query: 912 TDNDFLDSRSSKLDINDFLKLLNKFHETGIHFK 1010
TDNDFLDSRSSKLDINDFLKLLNKFHETGIHFK
Sbjct: 282 TDNDFLDSRSSKLDINDFLKLLNKFHETGIHFK 314

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,254,864,880
Number of extensions: 20564524
Number of successful extensions: 67852
Number of sequences better than 10.0: 1150
Number of HSP's gapped: 67002
Number of HSP's successfully gapped: 1226
Length of query: 356
Length of database: 1,061,185,681
Length adjustment: 130
Effective length of query: 226
Effective length of database: 636,287,441
Effective search space: 143800961666
Effective search space used: 143800961666
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.60 gvh: 0.30 alm: 0.36 top: 0.53 tms: 0.00 mit: 0.24 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

48.0 %: cytoplasmic
32.0 %: nuclear
8.0 %: mitochondrial
4.0 %: cytoskeletal
4.0 %: vacuolar
4.0 %: vesicles of secretory system

>> prediction for Contig-U05044-1 is cyt

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 1
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0