Contig-U04900-1
Contig ID Contig-U04900-1
Contig update 2001. 8.29
Contig sequence
>Contig-U04900-1 (Contig-U04900-1Q) /CSM_Contig/Contig-U04900-1Q.Seq.d
GAAATATTTAAACTATCAACACCACCACTATAATTATAAAAAAAAAATGT
CAAAAAATGGAGAAGCATTTATTTTAGATGATCGTGCAAGAGCACTTGCA
AATTATCCACATATGAGAAAAGCAGGTGACTTTTTATTTGTATCAGGTAT
TTCATCACGTAGACCAGATAATACTTATGAAGGTGTTCATGTCGATGAAA
ATGGTAAAGTTACACTCAACATTGAACAACAAACTAGAGCAGTCATTGAA
AACATTAGAACCATCTTAAAATCAGCAGGAGCTGATCTCGAAAATATCAT
TGATCTCACTGTTTTCTTAGTAGATATGAAAGATTACAATGGTTTCAATT
TAGCATACAATGATTATTTCAAAATTGAAACTGGTCCAACTAGAACCACC
GTTGCTGTTCATCAATTACCAAATCCAAATCTTTTAATTGAAATTAAAGC
AACTGCATTATGTAATAAATAAAATAGAAAATAAAATAAAATAAAATAAA
TAAAAAAAAAAAATAATATAAAATTATAAAAAAAAAATAAAAAAAAAATA
AAAAAAAAATAAAT

Gap no gap
Contig length 564
Chromosome number (1..6, M) 2
Chromosome length 8467578
Start point 5120642
End point 5121206
Strand (PLUS/MINUS) PLUS
Number of clones 3
Number of EST 3
Link to clone list U04900
List of clone(s)

est1=VSC845Z,1,565
est2=SSI760E,6,538
est3=SSD637E,326,527
Translated Amino Acid sequence
KYLNYQHHHYNYKKKMSKNGEAFILDDRARALANYPHMRKAGDFLFVSGISSRRPDNTYE
GVHVDENGKVTLNIEQQTRAVIENIRTILKSAGADLENIIDLTVFLVDMKDYNGFNLAYN
DYFKIETGPTRTTVAVHQLPNPNLLIEIKATALCNK*nrk*nkik*ikkknnikl*kknk
kkikkk*


Translated Amino Acid sequence (All Frames)
Frame A:
eifklstppl*l*kknvkkwrsiyfr*sckstcklstyeksr*lficiryfit*tr*yl*
rcscr*kw*sytqh*ttn*ssh*kh*nhlkisrs*srkyh*shcflsryerlqwfqfsiq
*lfqn*nwsn*nhrccssitksksfn*n*sncim**ik*kik*nkinkkkk*ykiikkk*
kknkkkin


Frame B:
KYLNYQHHHYNYKKKMSKNGEAFILDDRARALANYPHMRKAGDFLFVSGISSRRPDNTYE
GVHVDENGKVTLNIEQQTRAVIENIRTILKSAGADLENIIDLTVFLVDMKDYNGFNLAYN
DYFKIETGPTRTTVAVHQLPNPNLLIEIKATALCNK*nrk*nkik*ikkknnikl*kknk
kkikkk*


Frame C:
ni*tintttiiikkkcqkmekhlf*mivqehlqiihi*ekqvtfylyqvfhhvdqiilmk
vfmsmkmvklhstlnnkleqslktleps*nqqeliskislislfs**i*kitmvsi*htm
iisklklvqleppllfinyqiqif*lklkqlhyvinkienkik*nk*kkkii*nykkkik
kk*kknk


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U04900-1 (Contig-U04900-1Q)
/CSM_Contig/Contig-U04900-1Q.Seq.d
(564 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U04900-1 (Contig-U04900-1Q) /CSM_Contig/Conti... 854 0.0
Contig-U13931-1 (Contig-U13931-1Q) /CSM_Contig/Conti... 36 0.039
Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Conti... 36 0.039
Contig-U14691-1 (Contig-U14691-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U13057-1 (Contig-U13057-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U10538-1 (Contig-U10538-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U06946-1 (Contig-U06946-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U14436-1 (Contig-U14436-1Q) /CSM_Contig/Conti... 32 0.61
Contig-U13836-1 (Contig-U13836-1Q) /CSM_Contig/Conti... 32 0.61
Contig-U12322-1 (Contig-U12322-1Q) /CSM_Contig/Conti... 32 0.61

>Contig-U04900-1 (Contig-U04900-1Q) /CSM_Contig/Contig-U04900-1Q.Seq.d
Length = 564

Score = 854 bits (431), Expect = 0.0
Identities = 451/461 (97%)
Strand = Plus / Plus


Query: 1 gaaatatttaaactatcaacaccaccactataattatnnnnnnnnnntgtcaaaaaatgg 60
||||||||||||||||||||||||||||||||||||| |||||||||||||
Sbjct: 1 gaaatatttaaactatcaacaccaccactataattataaaaaaaaaatgtcaaaaaatgg 60


Query: 61 agaagcatttattttagatgatcgtgcaagagcacttgcaaattatccacatatgagaaa 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 agaagcatttattttagatgatcgtgcaagagcacttgcaaattatccacatatgagaaa 120


Query: 121 agcaggtgactttttatttgtatcaggtatttcatcacgtagaccagataatacttatga 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 agcaggtgactttttatttgtatcaggtatttcatcacgtagaccagataatacttatga 180


Query: 181 aggtgttcatgtcgatgaaaatggtaaagttacactcaacattgaacaacaaactagagc 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aggtgttcatgtcgatgaaaatggtaaagttacactcaacattgaacaacaaactagagc 240


Query: 241 agtcattgaaaacattagaaccatcttaaaatcagcaggagctgatctcgaaaatatcat 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 agtcattgaaaacattagaaccatcttaaaatcagcaggagctgatctcgaaaatatcat 300


Query: 301 tgatctcactgttttcttagtagatatgaaagattacaatggtttcaatttagcatacaa 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tgatctcactgttttcttagtagatatgaaagattacaatggtttcaatttagcatacaa 360


Query: 361 tgattatttcaaaattgaaactggtccaactagaaccaccgttgctgttcatcaattacc 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 tgattatttcaaaattgaaactggtccaactagaaccaccgttgctgttcatcaattacc 420


Query: 421 aaatccaaatcttttaattgaaattaaagcaactgcattat 461
|||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aaatccaaatcttttaattgaaattaaagcaactgcattat 461


>Contig-U13931-1 (Contig-U13931-1Q) /CSM_Contig/Contig-U13931-1Q.Seq.d
Length = 1359

Score = 36.2 bits (18), Expect = 0.039
Identities = 21/22 (95%)
Strand = Plus / Plus


Query: 193 cgatgaaaatggtaaagttaca 214
|||||||||||||||| |||||
Sbjct: 350 cgatgaaaatggtaaaattaca 371


>Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U09694-1Q.Seq.d
Length = 1139

Score = 36.2 bits (18), Expect = 0.039
Identities = 21/22 (95%)
Strand = Plus / Plus


Query: 427 aaatcttttaattgaaattaaa 448
||||| ||||||||||||||||
Sbjct: 1064 aaatcgtttaattgaaattaaa 1085


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 6465
Number of Sequences: 6905
Number of extensions: 6465
Number of successful extensions: 691
Number of sequences better than 10.0: 215
length of query: 564
length of database: 5,674,871
effective HSP length: 16
effective length of query: 548
effective length of database: 5,564,391
effective search space: 3049286268
effective search space used: 3049286268
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2009. 7. 5
Homology vs DNA
Query= Contig-U04900-1 (Contig-U04900-1Q) /CSM_Contig/Contig-U04900-1Q.Seq.d
(564 letters)

Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 803 0.0 2
(AU262833) Dictyostelium discoideum vegetative cDNA clone:VS... 803 0.0 2
(C90295) Dictyostelium discoideum slug cDNA, clone SSI760. 773 0.0 1
(AU073926) Dictyostelium discoideum slug cDNA, clone SSI760. 373 e-112 2
(AU072193) Dictyostelium discoideum slug cDNA, clone SSD637. 272 1e-68 1
(AU037435) Dictyostelium discoideum slug cDNA, clone SSD637. 98 4e-16 1
(EC744847) PSE00003199 rw_mgpallid Polysphondylium pallidum ... 58 4e-04 1
(AE017263) Mesoplasma florum L1 complete genome. 36 0.47 9
(AL807247) Mouse DNA sequence from clone RP23-178D3 on chrom... 46 0.52 2
(BX005039) Mouse DNA sequence from clone RP23-391M18 on chro... 46 1.4 1
(AC012147) Mus musculus, clone RP23-191A4, complete sequence. 46 1.4 1
(BX004757) Mouse DNA sequence *** SEQUENCING IN PROGRESS ***... 46 1.4 1
(AJ004828) Mouse DNA sequence *** SEQUENCING CANCELLED *** f... 46 1.4 1
(AC210977) Zea mays chromosome 3 clone CH201-363J3; ZMMBBc03... 46 1.4 1
(AC193755) Zea mays chromosome 3 clone CH201-166A14; ZMMBBc0... 46 1.4 1
(AC015797) Mus musculus clone RP23-191A4, WORKING DRAFT SEQU... 46 1.4 1
(EY062395) CATF609.rev CATF Artemisia annua, Tanzanian, from... 46 1.4 1
(CU915249) Brassica rapa subsp. pekinensis clone KBrB119D15,... 34 2.9 2
(AP008217) Oryza sativa (japonica cultivar-group) genomic DN... 44 5.7 1
(AC146522) Oryza sativa Japonica Group chromosome 11 clone O... 44 5.7 1
(BZ518937) BOMQB25TF BO_2_3_KB Brassica oleracea genomic clo... 44 5.7 1

>(AC116305) Dictyostelium discoideum chromosome 2 map 1005175-1418323
strain AX4, complete sequence.
Length = 413138

Score = 803 bits (405), Expect(2) = 0.0
Identities = 405/405 (100%)
Strand = Plus / Minus


Query: 58 tggagaagcatttattttagatgatcgtgcaagagcacttgcaaattatccacatatgag 117
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 200298 tggagaagcatttattttagatgatcgtgcaagagcacttgcaaattatccacatatgag 200239


Query: 118 aaaagcaggtgactttttatttgtatcaggtatttcatcacgtagaccagataatactta 177
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 200238 aaaagcaggtgactttttatttgtatcaggtatttcatcacgtagaccagataatactta 200179


Query: 178 tgaaggtgttcatgtcgatgaaaatggtaaagttacactcaacattgaacaacaaactag 237
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 200178 tgaaggtgttcatgtcgatgaaaatggtaaagttacactcaacattgaacaacaaactag 200119


Query: 238 agcagtcattgaaaacattagaaccatcttaaaatcagcaggagctgatctcgaaaatat 297
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 200118 agcagtcattgaaaacattagaaccatcttaaaatcagcaggagctgatctcgaaaatat 200059


Query: 298 cattgatctcactgttttcttagtagatatgaaagattacaatggtttcaatttagcata 357
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 200058 cattgatctcactgttttcttagtagatatgaaagattacaatggtttcaatttagcata 199999


Query: 358 caatgattatttcaaaattgaaactggtccaactagaaccaccgttgctgttcatcaatt 417
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 199998 caatgattatttcaaaattgaaactggtccaactagaaccaccgttgctgttcatcaatt 199939


Query: 418 accaaatccaaatcttttaattgaaattaaagcaactgcattatg 462
|||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 199938 accaaatccaaatcttttaattgaaattaaagcaactgcattatg 199894

Score = 73.8 bits (37), Expect(2) = 0.0
Identities = 37/37 (100%)
Strand = Plus / Minus


Query: 1 gaaatatttaaactatcaacaccaccactataattat 37
|||||||||||||||||||||||||||||||||||||
Sbjct: 200355 gaaatatttaaactatcaacaccaccactataattat 200319

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 586,036,293
Number of extensions: 34207720
Number of successful extensions: 2675961
Number of sequences better than 10.0: 21
Length of query: 564
Length of database: 101,790,757,118
Length adjustment: 23
Effective length of query: 541
Effective length of database: 99,442,330,388
Effective search space: 53798300739908
Effective search space used: 53798300739908
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.31
Homology vs Protein
Query= Contig-U04900-1 (Contig-U04900-1Q) /CSM_Contig/Contig-U04900-1Q.Seq.d
(564 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

AC116305_72(AC116305|pid:none) Dictyostelium discoideum chromoso... 279 3e-74
CP000353_1583(CP000353|pid:none) Ralstonia metallidurans CH34 me... 165 7e-40
CP001052_1432(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 158 1e-37
AM747721_2136(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 157 2e-37
CP000150_1112(CP000150|pid:none) Burkholderia sp. 383 chromosome... 153 3e-36
AB088043_13(AB088043|pid:none) Pseudomonas fluorescens 3-hydroxy... 151 1e-35
CP000317_221(CP000317|pid:none) Polaromonas sp. JS666 plasmid 1,... 149 4e-35
CP000270_3262(CP000270|pid:none) Burkholderia xenovorans LB400 c... 148 9e-35
AF319593_8(AF319593|pid:none) Pseudomonas putida plasmid pNB1 am... 147 1e-34
CP000949_2003(CP000949|pid:none) Pseudomonas putida W619, comple... 145 6e-34
CP000360_684(CP000360|pid:none) Acidobacteria bacterium Ellin345... 145 6e-34
CP000699_3495(CP000699|pid:none) Sphingomonas wittichii RW1, com... 144 2e-33
AP008957_5935(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 141 1e-32
AP008957_472(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 141 1e-32
CP000850_3753(CP000850|pid:none) Salinispora arenicola CNS-205, ... 137 2e-31
AM167904_553(AM167904|pid:none) Bordetella avium 197N complete g... 137 2e-31
CP000270_2593(CP000270|pid:none) Burkholderia xenovorans LB400 c... 110 2e-23
AM920437_218(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 93 4e-18
CP000113_895(CP000113|pid:none) Myxococcus xanthus DK 1622, comp... 91 3e-17
AM920435_234(AM920435|pid:none) Penicillium chrysogenum Wisconsi... 91 3e-17
AP007151_587(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 86 9e-16
CP000968_513(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 79 8e-14
CP000353_1575(CP000353|pid:none) Ralstonia metallidurans CH34 me... 78 1e-13
CP001146_1163(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 75 9e-13
(O58584) RecName: Full=UPF0076 protein PH0854; 75 9e-13
CP001399_2148(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 75 9e-13
CP001400_2001(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 75 1e-12
(Q9UZA3) RecName: Full=UPF0076 protein PYRAB12510; &AJ248287_13... 75 2e-12
CP001279_1354(CP001279|pid:none) Nautilia profundicola AmH, comp... 73 6e-12
CP000252_2701(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 71 2e-11
(Q97U19) RecName: Full=UPF0076 protein SSO3206; &AE006641_2954(... 71 2e-11
AJ304448_5(AJ304448|pid:none) Treponema maltophilum ORF232, mspA... 70 3e-11
AP009179_1785(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 70 4e-11
AP008955_95(AP008955|pid:none) Brevibacillus brevis NBRC 100599 ... 70 4e-11
CT573071_938(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 70 5e-11
CP001291_1274(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 70 5e-11
CP000359_228(CP000359|pid:none) Deinococcus geothermalis DSM 113... 69 7e-11
CP000812_266(CP000812|pid:none) Thermotoga lettingae TMO, comple... 69 7e-11
BX548174_615(BX548174|pid:none) Prochlorococcus marinus MED4 com... 69 9e-11
AE015929_2286(AE015929|pid:none) Staphylococcus epidermidis ATCC... 69 9e-11
AM180355_2585(AM180355|pid:none) Clostridium difficile 630 compl... 69 1e-10
CP000117_1820(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 69 1e-10
CP001365_2570(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 69 1e-10
BA000039_728(BA000039|pid:none) Thermosynechococcus elongatus BP... 69 1e-10
CP001037_5305(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 69 1e-10
CP000239_2468(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 69 1e-10
CP000923_1850(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 68 1e-10
AL646053_1247(AL646053|pid:none) Ralstonia solanacearum GMI1000 ... 68 1e-10
BT039439_1(BT039439|pid:none) Zea mays full-length cDNA clone ZM... 68 1e-10
AE008691_1490(AE008691|pid:none) Thermoanaerobacter tengcongensi... 68 2e-10
AY872009_1(AY872009|pid:none) Synthetic construct hypothetical p... 68 2e-10
CP000510_3257(CP000510|pid:none) Psychromonas ingrahamii 37, com... 68 2e-10
CP001472_1728(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 67 3e-10
AF2289(AF2289) hypothetical protein all3869 [imported] - Nostoc ... 67 3e-10
CP001014_1678(CP001014|pid:none) Thermoproteus neutrophilus V24S... 67 3e-10
CP001357_1151(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 67 3e-10
CP000487_1678(CP000487|pid:none) Campylobacter fetus subsp. fetu... 67 3e-10
CP000686_2882(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 67 3e-10
AM167904_1261(AM167904|pid:none) Bordetella avium 197N complete ... 67 3e-10
(O66689) RecName: Full=UPF0076 protein aq_364; &AE000657_262(AE... 67 4e-10
CP000551_613(CP000551|pid:none) Prochlorococcus marinus str. AS9... 67 4e-10
CP000504_408(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 67 4e-10
CP000612_408(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 67 4e-10
CP000576_585(CP000576|pid:none) Prochlorococcus marinus str. MIT... 66 6e-10
AY056454_2(AY056454|pid:none) Staphylococcus epidermidis PurR (p... 66 6e-10
AP008230_1335(AP008230|pid:none) Desulfitobacterium hafniense Y5... 66 6e-10
CP000909_3655(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 66 7e-10
CP000804_1890(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 66 7e-10
BA000040_6667(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 66 7e-10
CP000382_2149(CP000382|pid:none) Clostridium novyi NT, complete ... 66 7e-10
CU928175_329(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 66 7e-10
AM942759_3396(AM942759|pid:none) Proteus mirabilis strain HI4320... 66 7e-10
DQ889600_1(DQ889600|pid:none) Arachis hypogaea clone XX20 perchl... 65 1e-09
CP000724_2230(CP000724|pid:none) Alkaliphilus metalliredigens QY... 65 1e-09
CP000111_584(CP000111|pid:none) Prochlorococcus marinus str. MIT... 65 1e-09
CR380959_540(CR380959|pid:none) Candida glabrata strain CBS138 c... 65 1e-09
AP009484_1917(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 65 1e-09
CP000688_919(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 65 1e-09
CP000825_636(CP000825|pid:none) Prochlorococcus marinus str. MIT... 65 1e-09
CP001229_404(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 65 1e-09
CP000141_2382(CP000141|pid:none) Carboxydothermus hydrogenoforma... 65 2e-09
AJ965256_854(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 65 2e-09
(P52761) RecName: Full=UPF0076 protein slr0709; &BA000022_2786(... 65 2e-09
CP000702_700(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 65 2e-09
CP000936_1538(CP000936|pid:none) Streptococcus pneumoniae Hungar... 65 2e-09
(Q973T6) RecName: Full=UPF0076 protein ST0811; &BA000023_883(BA... 65 2e-09
CP001323_274(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 64 2e-09
CP000685_4548(CP000685|pid:none) Flavobacterium johnsoniae UW101... 64 2e-09
CP000922_41(CP000922|pid:none) Anoxybacillus flavithermus WK1, c... 64 2e-09
AK061373_1(AK061373|pid:none) Oryza sativa Japonica Group cDNA c... 64 2e-09
AM435277_1(AM435277|pid:none) Vitis vinifera contig VV78X044672.... 64 2e-09
CP000439_621(CP000439|pid:none) Francisella tularensis subsp. no... 64 2e-09
CP000148_2299(CP000148|pid:none) Geobacter metallireducens GS-15... 64 2e-09
BA000004_63(BA000004|pid:none) Bacillus halodurans C-125 DNA, co... 64 2e-09
AM180355_3270(AM180355|pid:none) Clostridium difficile 630 compl... 64 2e-09
(P40185) RecName: Full=Protein MMF1, mitochondrial; AltName: Ful... 64 3e-09
AE017180_2223(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 64 3e-09
AP006627_76(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, com... 64 3e-09
CP000493_208(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 64 3e-09
AE004437_1599(AE004437|pid:none) Halobacterium sp. NRC-1, comple... 64 3e-09
AE014292_722(AE014292|pid:none) Brucella suis 1330 chromosome II... 64 3e-09
AJ749949_1338(AJ749949|pid:none) Francisella tularensis subsp. t... 64 4e-09
CP000561_1081(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 64 4e-09
CP001186_42(CP001186|pid:none) Bacillus cereus G9842, complete g... 64 4e-09
CP000939_1899(CP000939|pid:none) Clostridium botulinum B1 str. O... 64 4e-09
CP001287_478(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 64 4e-09
CR378672_277(CR378672|pid:none) Photobacterium profundum SS9; se... 64 4e-09
CP000951_605(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 64 4e-09
CP000937_188(CP000937|pid:none) Francisella philomiragia subsp. ... 63 5e-09
CP000027_1012(CP000027|pid:none) Dehalococcoides ethenogenes 195... 63 5e-09
AE017333_50(AE017333|pid:none) Bacillus licheniformis DSM 13, co... 63 5e-09
AE000513_2460(AE000513|pid:none) Deinococcus radiodurans R1 chro... 63 5e-09
BA000045_4007(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 63 5e-09
CR555308_159(CR555308|pid:none) Azoarcus sp. EbN1 plasmid 2. 63 5e-09
CP000431_1311(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 63 5e-09
AB024036_15(AB024036|pid:none) Arabidopsis thaliana genomic DNA,... 63 5e-09
CP000612_313(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 63 6e-09
CP000859_180(CP000859|pid:none) Desulfococcus oleovorans Hxd3, c... 63 6e-09
CP000875_144(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2... 63 6e-09
BX927148_154(BX927148|pid:none) Corynebacterium glutamicum ATCC ... 63 6e-09
BA000036_152(BA000036|pid:none) Corynebacterium glutamicum ATCC ... 63 6e-09
AP009324_494(AP009324|pid:none) Staphylococcus aureus subsp. aur... 63 6e-09
CP000612_2301(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 63 6e-09
CP000921_1388(CP000921|pid:none) Streptococcus pneumoniae Taiwan... 63 6e-09
AD0989(AD0989) probable regulatory protein STY4220 [imported] - ... 62 8e-09
AJ938182_446(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 62 8e-09
CP000462_1572(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 62 8e-09
AP009552_1111(AP009552|pid:none) Microcystis aeruginosa NIES-843... 62 8e-09
AE009952_1801(AE009952|pid:none) Yersinia pestis KIM, complete g... 62 8e-09
AL646053_1323(AL646053|pid:none) Ralstonia solanacearum GMI1000 ... 62 8e-09
BA000028_3060(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 62 8e-09
DQ117527_1(DQ117527|pid:none) Lycopersicon esculentum constituti... 62 8e-09
A72404(A72404) hypothetical protein TM0215 - Thermotoga maritima... 62 1e-08
CP000240_547(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 62 1e-08
AB082518_1(AB082518|pid:none) Gentiana triflora GtTIP gene for t... 62 1e-08
CP000153_1438(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 62 1e-08
EF146564_1(EF146564|pid:none) Populus trichocarpa clone WS0119_I... 62 1e-08
CP000644_257(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 62 1e-08
CP000387_770(CP000387|pid:none) Streptococcus sanguinis SK36, co... 62 1e-08
AM412317_2989(AM412317|pid:none) Clostridium botulinum A str. AT... 62 1e-08
AP006716_2514(AP006716|pid:none) Staphylococcus haemolyticus JCS... 62 1e-08
CR936503_444(CR936503|pid:none) Lactobacillus sakei strain 23K c... 62 1e-08
BX572604_193(BX572604|pid:none) Rhodopseudomonas palustris CGA00... 62 1e-08
AM778958_367(AM778958|pid:none) Microcystis aeruginosa PCC 7806 ... 62 1e-08
CP001154_2256(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 62 1e-08
AP009351_465(AP009351|pid:none) Staphylococcus aureus subsp. aur... 62 1e-08
CP001098_2074(CP001098|pid:none) Halothermothrix orenii H 168, c... 62 1e-08
AP009153_2311(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 61 2e-08
AP009386_2080(AP009386|pid:none) Burkholderia multivorans ATCC 1... 61 2e-08
AE016877_40(AE016877|pid:none) Bacillus cereus ATCC 14579, compl... 61 2e-08
BA000033_452(BA000033|pid:none) Staphylococcus aureus subsp. aur... 61 2e-08
AM412317_1949(AM412317|pid:none) Clostridium botulinum A str. AT... 61 2e-08
CP001130_150(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 61 2e-08
CP000916_470(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 61 2e-08
CP001635_1201(CP001635|pid:none) Variovorax paradoxus S110 chrom... 61 2e-08
CP001083_2074(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 61 2e-08
AE017226_2053(AE017226|pid:none) Treponema denticola ATCC 35405,... 61 2e-08
BX908789_3(BX908789|pid:none) Neurospora crassa DNA linkage grou... 61 2e-08
EU016667_17(EU016667|pid:none) Uncultured marine microorganism H... 61 2e-08
CP001348_2533(CP001348|pid:none) Clostridium cellulolyticum H10,... 61 2e-08
CP001393_177(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 61 2e-08
AG0203(AG0203) YjgF-family lipoprotein [imported] - Yersinia pes... 61 2e-08
CP000159_2435(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 60 3e-08
CP000884_5302(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 60 3e-08
CP001080_1610(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 60 3e-08
AE014133_1192(AE014133|pid:none) Streptococcus mutans UA159, com... 60 3e-08
CP000557_41(CP000557|pid:none) Geobacillus thermodenitrificans N... 60 3e-08
CU928165_167(CU928165|pid:none) Kluyveromyces thermotolerans str... 60 3e-08
BA000043_41(BA000043|pid:none) Geobacillus kaustophilus HTA426 D... 60 4e-08
CP001581_2038(CP001581|pid:none) Clostridium botulinum A2 str. K... 60 4e-08
CP001638_43(CP001638|pid:none) Geobacillus sp. WCH70, complete g... 60 4e-08
(P40037) RecName: Full=Protein HMF1; AltName: Full=High dosage g... 60 4e-08
CP001634_2038(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 60 5e-08
CP001020_451(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 59 7e-08
CP000612_261(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 59 7e-08
CP000587_121(CP000587|pid:none) Ostreococcus lucimarinus CCE9901... 59 7e-08
AM747722_488(AM747722|pid:none) Burkholderia cenocepacia J2315 c... 59 7e-08
CP001344_1009(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 59 7e-08
AE014299_1382(AE014299|pid:none) Shewanella oneidensis MR-1, com... 59 7e-08
AM398681_734(AM398681|pid:none) Flavobacterium psychrophilum JIP... 59 7e-08
BX842650_273(BX842650|pid:none) Bdellovibrio bacteriovorus compl... 59 7e-08
CP000510_1919(CP000510|pid:none) Psychromonas ingrahamii 37, com... 59 7e-08
CP000828_3205(CP000828|pid:none) Acaryochloris marina MBIC11017,... 59 9e-08
CP001115_52(CP001115|pid:none) Deinococcus deserti VCD115 plasmi... 59 9e-08
CP001078_524(CP001078|pid:none) Clostridium botulinum E3 str. Al... 59 9e-08
CP000682_1384(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 59 9e-08
CR382123_359(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 59 9e-08
CP000769_1300(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 59 1e-07
CR522870_1384(CR522870|pid:none) Desulfotalea psychrophila LSv54... 59 1e-07
(Q9UR06) RecName: Full=Protein mmf2, mitochondrial; AltName: Ful... 59 1e-07
CP000442_1004(CP000442|pid:none) Burkholderia ambifaria AMMD chr... 59 1e-07
AE017194_45(AE017194|pid:none) Bacillus cereus ATCC 10987, compl... 59 1e-07
AE009952_3503(AE009952|pid:none) Yersinia pestis KIM, complete g... 59 1e-07
CP000485_40(CP000485|pid:none) Bacillus thuringiensis str. Al Ha... 59 1e-07
CP000739_165(CP000739|pid:none) Sinorhizobium medicae WSM419 pla... 59 1e-07
CP001365_416(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 58 2e-07
(P0AGL2) RecName: Full=Protein tdcF; &(P0AGL3) RecName: Fu &(P0... 58 2e-07
AE015924_1578(AE015924|pid:none) Porphyromonas gingivalis W83, c... 58 2e-07
CP000036_2758(CP000036|pid:none) Shigella boydii Sb227, complete... 58 2e-07
CP000435_1907(CP000435|pid:none) Synechococcus sp. CC9311, compl... 58 2e-07
CP001072_955(CP001072|pid:none) Helicobacter pylori Shi470, comp... 58 2e-07
FN392319_1012(FN392319|pid:none) Pichia pastoris GS115 chromosom... 58 2e-07
AE014075_3781(AE014075|pid:none) Escherichia coli CFT073, comple... 58 2e-07
CU928163_3524(CU928163|pid:none) Escherichia coli UMN026 chromos... 58 2e-07
AM260522_1180(AM260522|pid:none) Helicobacter acinonychis str. S... 58 2e-07
CP001654_3511(CP001654|pid:none) Dickeya dadantii Ech703, comple... 58 2e-07
CP001139_1509(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 58 2e-07
CP000510_402(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 58 2e-07
(P37552) RecName: Full=UPF0076 protein yabJ; &AL009126_48(AL009... 58 2e-07
CP000112_809(CP000112|pid:none) Desulfovibrio desulfuricans G20,... 58 2e-07
AM295250_145(AM295250|pid:none) Staphylococcus carnosus subsp. c... 58 2e-07
AY596296_292(AY596296|pid:none) Haloarcula marismortui ATCC 4304... 58 2e-07
CP000023_770(CP000023|pid:none) Streptococcus thermophilus LMG 1... 58 2e-07
CP000776_1584(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 58 2e-07
CP000269_165(CP000269|pid:none) Janthinobacterium sp. Marseille,... 58 2e-07
(Q9L6B5) RecName: Full=UPF0076 protein PM1466; &AE004439_1466(A... 58 2e-07
CP000031_2646(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 58 2e-07
AP008230_4354(AP008230|pid:none) Desulfitobacterium hafniense Y5... 58 2e-07
CP000885_1476(CP000885|pid:none) Clostridium phytofermentans ISD... 58 2e-07
CP000020_1469(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 57 3e-07
CP001078_571(CP001078|pid:none) Clostridium botulinum E3 str. Al... 57 3e-07
DQ117525_1(DQ117525|pid:none) Cucumis sativus plastid-lipid asso... 57 3e-07
AM902716_1399(AM902716|pid:none) Bordetella petrii strain DSM 12... 57 3e-07
CP000444_2853(CP000444|pid:none) Shewanella sp. MR-7, complete g... 57 3e-07
DQ117528_1(DQ117528|pid:none) Lycopersicon esculentum inducible ... 57 3e-07
(Q10121) RecName: Full=UPF0076 protein C23G10.2; &U39851_11(U39... 57 3e-07
AY426768_8(AY426768|pid:none) Streptomyces clavuligerus putative... 57 3e-07
CR543861_27(CR543861|pid:none) Acinetobacter sp. ADP1 complete g... 57 3e-07
CP000960_120(CP000960|pid:none) Burkholderia cenocepacia MC0-3 c... 57 3e-07
FM211050_3(FM211050|pid:none) Photorhabdus asymbiotica subsp. as... 57 3e-07
(O25598) RecName: Full=UPF0076 protein HP_0944; &AE000511_928(A... 57 3e-07
AE017143_1034(AE017143|pid:none) Haemophilus ducreyi strain 3500... 57 3e-07
CP001124_1694(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 57 3e-07
CP000712_3440(CP000712|pid:none) Pseudomonas putida F1, complete... 57 3e-07
CP000473_581(CP000473|pid:none) Solibacter usitatus Ellin6076, c... 57 3e-07
CR522870_2242(CR522870|pid:none) Desulfotalea psychrophila LSv54... 57 3e-07
CP000241_928(CP000241|pid:none) Helicobacter pylori HPAG1, compl... 57 3e-07
AE009951_443(AE009951|pid:none) Fusobacterium nucleatum subsp. n... 57 3e-07
AP009049_798(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 57 3e-07
CP000446_2781(CP000446|pid:none) Shewanella sp. MR-4, complete g... 57 3e-07
CP001114_2218(CP001114|pid:none) Deinococcus deserti VCD115, com... 57 4e-07
CP000616_361(CP000616|pid:none) Burkholderia vietnamiensis G4 ch... 57 4e-07
CU234118_5410(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 57 4e-07
CP000563_3013(CP000563|pid:none) Shewanella baltica OS155, compl... 57 4e-07
CP000377_2753(CP000377|pid:none) Silicibacter sp. TM1040, comple... 57 4e-07
BX950851_375(BX950851|pid:none) Erwinia carotovora subsp. atrose... 57 4e-07
CP000020_396(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 57 4e-07
CP001398_471(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 56 6e-07
AE007870_909(AE007870|pid:none) Agrobacterium tumefaciens str. C... 56 6e-07
CP000554_815(CP000554|pid:none) Prochlorococcus marinus str. MIT... 56 6e-07
CP000817_59(CP000817|pid:none) Lysinibacillus sphaericus C3-41, ... 56 6e-07
CP000025_1533(CP000025|pid:none) Campylobacter jejuni RM1221, co... 56 6e-07
BX548175_1556(BX548175|pid:none) Prochlorococcus marinus MIT9313... 56 6e-07
CP001649_1703(CP001649|pid:none) Desulfovibrio salexigens DSM 26... 56 6e-07
AE008689_918(AE008689|pid:none) Agrobacterium tumefaciens str. C... 56 6e-07
FM178379_517(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 56 6e-07
CR541652_1(CR541652|pid:none) Homo sapiens full open reading fra... 56 8e-07
CP000512_1100(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 56 8e-07
CP001027_769(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch... 56 8e-07
AP008231_571(AP008231|pid:none) Synechococcus elongatus PCC 6301... 56 8e-07
CP000814_1303(CP000814|pid:none) Campylobacter jejuni subsp. jej... 56 8e-07
CP000092_222(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 56 8e-07
AP011115_2185(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 56 8e-07
BC076217_1(BC076217|pid:none) Danio rerio zgc:92739, mRNA (cDNA ... 56 8e-07
CP000931_166(CP000931|pid:none) Shewanella halifaxensis HAW-EB4,... 56 8e-07
AM942759_3421(AM942759|pid:none) Proteus mirabilis strain HI4320... 56 8e-07
AM920421_145(AM920421|pid:none) Penicillium chrysogenum Wisconsi... 56 8e-07
CP001618_2961(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 56 8e-07
CP001217_934(CP001217|pid:none) Helicobacter pylori P12, complet... 56 8e-07
BX571874_39(BX571874|pid:none) Photorhabdus luminescens subsp. l... 56 8e-07
FN357439_1(FN357439|pid:none) Schistosoma mansoni genome sequenc... 56 8e-07
CP000926_1865(CP000926|pid:none) Pseudomonas putida GB-1, comple... 56 8e-07
AM902716_4904(AM902716|pid:none) Bordetella petrii strain DSM 12... 55 1e-06
CP000569_426(CP000569|pid:none) Actinobacillus pleuropneumoniae ... 55 1e-06
CP000112_2577(CP000112|pid:none) Desulfovibrio desulfuricans G20... 55 1e-06
CP000038_3049(CP000038|pid:none) Shigella sonnei Ss046, complete... 55 1e-06
CP001192_606(CP001192|pid:none) Rhizobium leguminosarum bv. trif... 55 1e-06
CP000150_521(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 55 1e-06
CP001649_1382(CP001649|pid:none) Desulfovibrio salexigens DSM 26... 55 1e-06
BA000012_3424(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 55 1e-06
CR522870_1878(CR522870|pid:none) Desulfotalea psychrophila LSv54... 55 1e-06
BT082223_1(BT082223|pid:none) Anoplopoma fimbria clone afim-evh-... 55 1e-06
BT083138_1(BT083138|pid:none) Anoplopoma fimbria clone afim-evh-... 55 1e-06
CP000891_3202(CP000891|pid:none) Shewanella baltica OS195, compl... 55 1e-06
CP000494_5845(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 55 1e-06
CP000436_661(CP000436|pid:none) Haemophilus somnus 129PT, comple... 55 1e-06
CR378675_241(CR378675|pid:none) Photobacterium profundum SS9 chr... 55 2e-06
AM167904_1909(AM167904|pid:none) Bordetella avium 197N complete ... 55 2e-06
CP000851_4060(CP000851|pid:none) Shewanella pealeana ATCC 700345... 55 2e-06
CP000094_2734(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 55 2e-06
CP000482_2363(CP000482|pid:none) Pelobacter propionicus DSM 2379... 55 2e-06
CP001104_1762(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 55 2e-06
AM236084_422(AM236084|pid:none) Rhizobium leguminosarum bv. vici... 54 2e-06
FJ362376_3(FJ362376|pid:none) Caenorhabditis sp. PS1010 contig J... 54 2e-06
DQ000518_1(DQ000518|pid:none) Synthetic construct clone PSF:1041... 54 2e-06
CP000721_1959(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 54 2e-06
CP000431_2426(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 54 2e-06
CP000238_231(CP000238|pid:none) Baumannia cicadellinicola str. H... 54 2e-06
CP001600_3350(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 54 3e-06
AP010904_355(AP010904|pid:none) Desulfovibrio magneticus RS-1 DN... 54 3e-06
AL939127_220(AL939127|pid:none) Streptomyces coelicolor A3(2) co... 54 3e-06
CP001091_454(CP001091|pid:none) Actinobacillus pleuropneumoniae ... 54 3e-06
CP000091_2237(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 54 3e-06
AX553840_1(AX553840|pid:none) Sequence 174 from Patent WO02075507. 54 3e-06
CT573326_1682(CT573326|pid:none) Pseudomonas entomophila str. L4... 54 3e-06
BX936398_3531(BX936398|pid:none) Yersinia pseudotuberculosis IP3... 54 3e-06
CP000826_539(CP000826|pid:none) Serratia proteamaculans 568, com... 54 3e-06
CP000698_3102(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 54 3e-06
CP000910_812(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 54 3e-06
CP000270_3507(CP000270|pid:none) Burkholderia xenovorans LB400 c... 54 3e-06
CP000653_443(CP000653|pid:none) Enterobacter sp. 638, complete g... 54 3e-06
CP000512_561(CP000512|pid:none) Acidovorax citrulli AAC00-1, com... 54 4e-06
CP000393_2103(CP000393|pid:none) Trichodesmium erythraeum IMS101... 54 4e-06
CP000325_2635(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 54 4e-06
CR954205_328(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 54 4e-06
CP000473_6484(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 54 4e-06
CP000879_301(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 54 4e-06
CP001622_768(CP001622|pid:none) Rhizobium leguminosarum bv. trif... 53 5e-06
BA000002_988(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 53 5e-06
CP000431_799(CP000431|pid:none) Rhodococcus jostii RHA1, complet... 53 5e-06
BT083325_1(BT083325|pid:none) Anoplopoma fimbria clone afim-evh-... 53 5e-06
F72630(F72630)hypothetical protein APE1501 - Aeropyrum pernix (s... 53 5e-06
CP001655_1944(CP001655|pid:none) Dickeya zeae Ech1591, complete ... 53 5e-06
AM286415_3611(AM286415|pid:none) Yersinia enterocolitica subsp. ... 53 5e-06
CP000514_627(CP000514|pid:none) Marinobacter aquaeolei VT8, comp... 53 5e-06
CP000542_3259(CP000542|pid:none) Verminephrobacter eiseniae EF01... 53 5e-06
CP000932_272(CP000932|pid:none) Campylobacter lari RM2100, compl... 53 6e-06
CP000880_3076(CP000880|pid:none) Salmonella enterica subsp. ariz... 53 6e-06
CR522870_1508(CR522870|pid:none) Desulfotalea psychrophila LSv54... 53 6e-06
CP000562_869(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 53 6e-06
CP001107_684(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 53 6e-06
DQ228179_1(DQ228179|pid:none) Prototheca wickerhamii strain SAG ... 53 6e-06
CP000389_247(CP000389|pid:none) Mesorhizobium sp. BNC1 plasmid 1... 53 6e-06
(Q89AG0) RecName: Full=UPF0076 protein bbp_334; &AE016826_311(A... 53 6e-06
CP000672_1129(CP000672|pid:none) Haemophilus influenzae PittGG, ... 53 6e-06
AP008232_2117(AP008232|pid:none) Sodalis glossinidius str. 'mors... 53 6e-06
CP000903_2393(CP000903|pid:none) Bacillus weihenstephanensis KBA... 53 6e-06
CP000227_2448(CP000227|pid:none) Bacillus cereus Q1, complete ge... 52 8e-06
CP001177_2583(CP001177|pid:none) Bacillus cereus AH187, complete... 52 8e-06
CP001607_1809(CP001607|pid:none) Aggregatibacter aphrophilus NJ8... 52 8e-06
FM992688_637(FM992688|pid:none) Candida dubliniensis CD36 chromo... 52 8e-06
AE009952_161(AE009952|pid:none) Yersinia pestis KIM, complete ge... 52 8e-06
AM260479_854(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 52 8e-06
CP000822_3464(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 52 8e-06
AB110004_3(AB110004|pid:none) Bordetella sp. 10d ahdA, ahdR, ahd... 52 8e-06
FP236842_376(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 52 8e-06
CU633901_379(CU633901|pid:none) Podospora anserina genomic DNA c... 52 8e-06
CU468135_1625(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 52 8e-06
CP000136_176(CP000136|pid:none) Rhizobium etli CFN 42 plasmid p4... 52 8e-06
CP000285_3215(CP000285|pid:none) Chromohalobacter salexigens DSM... 52 1e-05
CP000912_908(CP000912|pid:none) Brucella suis ATCC 23445 chromos... 52 1e-05
CU234118_1445(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 52 1e-05
BT075402_1(BT075402|pid:none) Osmerus mordax clone omor-eva-512-... 52 1e-05
BX569693_124(BX569693|pid:none) Synechococcus sp. WH8102 complet... 52 1e-05
CP000095_595(CP000095|pid:none) Prochlorococcus marinus str. NAT... 52 1e-05
AE008918_304(AE008918|pid:none) Brucella melitensis 16M chromoso... 52 1e-05
AY596296_304(AY596296|pid:none) Haloarcula marismortui ATCC 4304... 52 1e-05
CP000671_1500(CP000671|pid:none) Haemophilus influenzae PittEE, ... 52 1e-05
CP000553_612(CP000553|pid:none) Prochlorococcus marinus str. NAT... 52 1e-05
CP000075_236(CP000075|pid:none) Pseudomonas syringae pv. syringa... 52 1e-05
CP000100_2406(CP000100|pid:none) Synechococcus elongatus PCC 794... 51 2e-05
AE016879_2476(AE016879|pid:none) Bacillus anthracis str. Ames, c... 51 2e-05
CP000251_2541(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 51 2e-05
CP000444_305(CP000444|pid:none) Shewanella sp. MR-7, complete ge... 51 2e-05
CP000112_1265(CP000112|pid:none) Desulfovibrio desulfuricans G20... 51 2e-05
AM181176_2556(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 51 2e-05
AM167904_1093(AM167904|pid:none) Bordetella avium 197N complete ... 51 2e-05
CP000485_2290(CP000485|pid:none) Bacillus thuringiensis str. Al ... 51 2e-05
CP000746_1276(CP000746|pid:none) Actinobacillus succinogenes 130... 51 2e-05
AE016853_99(AE016853|pid:none) Pseudomonas syringae pv. tomato s... 51 2e-05
AB204721_6(AB204721|pid:none) Pseudomonas fluorescens genes for ... 51 2e-05
CP000469_3807(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 51 2e-05
AM181176_3977(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 51 2e-05
CP001052_3033(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 51 2e-05
AE017194_2702(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 51 2e-05
CP001351_40(CP001351|pid:none) Methylobacterium nodulans ORS 206... 51 2e-05
CP001053_2858(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 51 2e-05
CP000494_6112(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 51 2e-05
CP000094_5520(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 51 2e-05
CP000949_170(CP000949|pid:none) Pseudomonas putida W619, complet... 50 3e-05
AE017346_153(AE017346|pid:none) Cryptococcus neoformans var. neo... 50 3e-05
AM270210_16(AM270210|pid:none) Aspergillus niger contig An09c021... 50 3e-05
CP000931_3440(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 50 3e-05
(O52178) RecName: Full=Protein dfrA; &AF025847_3(AF025847|pid:n... 50 3e-05
CP000672_1625(CP000672|pid:none) Haemophilus influenzae PittGG, ... 50 3e-05
CP000480_3653(CP000480|pid:none) Mycobacterium smegmatis str. MC... 50 3e-05
CP000474_3900(CP000474|pid:none) Arthrobacter aurescens TC1, com... 50 4e-05
AP008231_1697(AP008231|pid:none) Synechococcus elongatus PCC 630... 50 4e-05
FN318919_1(FN318919|pid:none) Schistosoma japonicum isolate Anhu... 50 4e-05
CP000513_967(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 50 4e-05
CP000494_4515(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 50 4e-05
CP000323_884(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 50 4e-05
BA000040_4467(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 50 4e-05
CP000304_1589(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 50 4e-05
CR628337_1994(CR628337|pid:none) Legionella pneumophila str. Len... 50 4e-05
(P80601) RecName: Full=Ribonuclease UK114; EC=3.1.-.-; ... 50 4e-05
S74181(S74181)tumor antigen UK114 - goat 50 4e-05
CP001349_1153(CP001349|pid:none) Methylobacterium nodulans ORS 2... 50 5e-05
AY655709_4(AY655709|pid:none) Rubrivivax gelatinosus cytochrome ... 50 5e-05
(O43003) RecName: Full=Protein mmf1, mitochondrial; AltName: Ful... 50 5e-05
CP000947_1971(CP000947|pid:none) Haemophilus somnus 2336, comple... 50 5e-05
U50631_1(U50631|pid:none) Mus musculus heat-responsive protein (... 50 5e-05
(P55654) RecName: Full=UPF0076 protein y4sK; &U00090_158(U00090... 50 5e-05
CP000521_99(CP000521|pid:none) Acinetobacter baumannii ATCC 1797... 50 5e-05
(P52760) RecName: Full=Ribonuclease UK114; EC=3.1.-.-; ... 50 5e-05
AP008232_1331(AP008232|pid:none) Sodalis glossinidius str. 'mors... 49 7e-05
BX293980_758(BX293980|pid:none) Mycoplasma mycoides subsp. mycoi... 49 7e-05
CP000438_3529(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 49 7e-05
CP000076_3533(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 49 7e-05
CR954210_113(CR954210|pid:none) Ostreococcus tauri strain OTTH05... 49 7e-05
B44514(B44514)hypothetical protein 1 (vnfA 5' region) - Azotobac... 49 7e-05
(P40431) RecName: Full=UPF0076 protein in vnfA 5'region; AltName... 49 7e-05
CP000036_3894(CP000036|pid:none) Shigella boydii Sb227, complete... 49 7e-05
AY657131_1(AY657131|pid:none) Synthetic construct Peudomonas aer... 49 7e-05
CP000783_1400(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 49 7e-05
CU914166_495(CU914166|pid:none) Ralstonia solanacearum strain IP... 49 7e-05
CP000152_912(CP000152|pid:none) Burkholderia sp. 383 chromosome ... 49 7e-05
CP001096_930(CP001096|pid:none) Rhodopseudomonas palustris TIE-1... 49 9e-05
AE017285_2634(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 49 9e-05
CU458896_2885(CU458896|pid:none) Mycobacterium abscessus chromos... 49 9e-05
CP000472_304(CP000472|pid:none) Shewanella piezotolerans WP3, co... 49 9e-05
BX571868_98(BX571868|pid:none) Photorhabdus luminescens subsp. l... 49 9e-05
CR761367_1(CR761367|pid:none) Xenopus tropicalis finished cDNA, ... 49 9e-05
CR378681_33(CR378681|pid:none) Photobacterium profundum SS9 chro... 49 9e-05
FM954972_2714(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 49 9e-05
CP000474_549(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 49 9e-05
BC087800_1(BC087800|pid:none) Xenopus tropicalis hypothetical LO... 49 9e-05
AM236080_1176(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 49 9e-05
CP000821_333(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 49 9e-05
BA000040_5130(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 49 9e-05
BA000040_5457(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 49 9e-05
AE014295_995(AE014295|pid:none) Bifidobacterium longum NCC2705, ... 49 9e-05
A98282(A98282) hypothetical protein ECs5225 [imported] - Escheri... 49 1e-04
AE016877_2543(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 49 1e-04
CP000075_2886(CP000075|pid:none) Pseudomonas syringae pv. syring... 49 1e-04
BA000036_2219(BA000036|pid:none) Corynebacterium glutamicum ATCC... 49 1e-04
CP000568_1451(CP000568|pid:none) Clostridium thermocellum ATCC 2... 49 1e-04
CP000057_1233(CP000057|pid:none) Haemophilus influenzae 86-028NP... 49 1e-04
CP000058_2241(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 49 1e-04
AM181176_3039(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 49 1e-04
CP000964_2245(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 49 1e-04
BT056740_1(BT056740|pid:none) Salmo salar clone ssal-evf-579-284... 49 1e-04
CP000884_2162(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 49 1e-04
CP000826_2755(CP000826|pid:none) Serratia proteamaculans 568, co... 49 1e-04
CP000513_1257(CP000513|pid:none) Dichelobacter nodosus VCS1703A,... 49 1e-04
CP001358_1118(CP001358|pid:none) Desulfovibrio desulfuricans sub... 49 1e-04
S30349(S30349) perchloric acid-soluble protein, 23K - rat &X708... 49 1e-04
AM181176_5869(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 49 1e-04
CP000713_470(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 49 1e-04
CP000110_941(CP000110|pid:none) Synechococcus sp. CC9605, comple... 49 1e-04
(P52759) RecName: Full=Ribonuclease UK114; EC=3.1.-.-; ... 49 1e-04
CT573326_5062(CT573326|pid:none) Pseudomonas entomophila str. L4... 48 2e-04
CP000075_4326(CP000075|pid:none) Pseudomonas syringae pv. syring... 48 2e-04
CP000926_5316(CP000926|pid:none) Pseudomonas putida GB-1, comple... 48 2e-04
CP000076_5944(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 48 2e-04
CP000781_2360(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 48 2e-04
CP000094_2381(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 48 2e-04
CP000091_355(CP000091|pid:none) Ralstonia eutropha JMP134 chromo... 48 2e-04
CP000436_127(CP000436|pid:none) Haemophilus somnus 129PT, comple... 48 2e-04
CP000472_1246(CP000472|pid:none) Shewanella piezotolerans WP3, c... 48 2e-04
AE009952_2204(AE009952|pid:none) Yersinia pestis KIM, complete g... 48 2e-04
CP000020_635(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 48 2e-04
CP000509_1806(CP000509|pid:none) Nocardioides sp. JS614, complet... 48 2e-04
CR954246_1722(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 48 2e-04
CP000680_245(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 48 2e-04
CP001172_3268(CP001172|pid:none) Acinetobacter baumannii AB307-0... 48 2e-04
AE016853_2944(AE016853|pid:none) Pseudomonas syringae pv. tomato... 48 2e-04
AM286415_2256(AM286415|pid:none) Yersinia enterocolitica subsp. ... 48 2e-04
CT573326_2194(CT573326|pid:none) Pseudomonas entomophila str. L4... 48 2e-04
CP000031_3602(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 48 2e-04
CP000859_1172(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 48 2e-04
CP000058_4171(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 48 2e-04
BA000040_3976(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 48 2e-04
BT040981_1(BT040981|pid:none) Zea mays full-length cDNA clone ZM... 48 2e-04
AF015949_1(AF015949|pid:none) Rattus norvegicus perchloric acid ... 48 2e-04
CP000304_1296(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 48 2e-04
CP001213_607(CP001213|pid:none) Bifidobacterium animalis subsp. ... 48 2e-04
CP000774_2365(CP000774|pid:none) Parvibaculum lavamentivorans DS... 48 2e-04
CP000521_181(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 48 2e-04
AJ297529_13(AJ297529|pid:none) Pseudomonas stutzeri nif operon a... 48 2e-04
AP006725_2973(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 48 2e-04
AE015451_3463(AE015451|pid:none) Pseudomonas putida KT2440 compl... 48 2e-04
AE016825_3393(AE016825|pid:none) Chromobacterium violaceum ATCC ... 48 2e-04
AC2758(AC2758) conserved hypothetical protein Atu1475 [imported]... 47 3e-04
CP001189_713(CP001189|pid:none) Gluconacetobacter diazotrophicus... 47 3e-04
CR522870_489(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 47 3e-04
AE016853_2430(AE016853|pid:none) Pseudomonas syringae pv. tomato... 47 3e-04
CP000931_77(CP000931|pid:none) Shewanella halifaxensis HAW-EB4, ... 47 3e-04
CP000851_466(CP000851|pid:none) Shewanella pealeana ATCC 700345,... 47 3e-04
CP001193_104(CP001193|pid:none) Rhizobium leguminosarum bv. trif... 47 3e-04
CP000739_1058(CP000739|pid:none) Sinorhizobium medicae WSM419 pl... 47 3e-04
CP000647_2291(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 47 3e-04
CU694393_147(CU694393|pid:none) Ralstonia solanacearum strain Mo... 47 3e-04
AE016853_69(AE016853|pid:none) Pseudomonas syringae pv. tomato s... 47 3e-04
AM260480_2294(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 47 3e-04
AB262446_4(AB262446|pid:none) Pseudomonas sp. MIS38 genes for qu... 47 3e-04
AM902716_1739(AM902716|pid:none) Bordetella petrii strain DSM 12... 47 3e-04
CP000158_461(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 47 3e-04
AP009153_3130(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 47 3e-04
AM889285_2478(AM889285|pid:none) Gluconacetobacter diazotrophicu... 47 3e-04

>AC116305_72(AC116305|pid:none) Dictyostelium discoideum chromosome
2 map 1005175-1418323 strain AX4, complete sequence.
Length = 141

Score = 279 bits (714), Expect = 3e-74
Identities = 139/139 (100%), Positives = 139/139 (100%)
Frame = +2

Query: 47 MSKNGEAFILDDRARALANYPHMRKAGDFLFVSGISSRRPDNTYEGVHVDENGKVTLNIE 226
MSKNGEAFILDDRARALANYPHMRKAGDFLFVSGISSRRPDNTYEGVHVDENGKVTLNIE
Sbjct: 1 MSKNGEAFILDDRARALANYPHMRKAGDFLFVSGISSRRPDNTYEGVHVDENGKVTLNIE 60

Query: 227 QQTRAVIENIRTILKSAGADLENIIDLTVFLVDMKDYNGFNLAYNDYFKIETGPTRTTVA 406
QQTRAVIENIRTILKSAGADLENIIDLTVFLVDMKDYNGFNLAYNDYFKIETGPTRTTVA
Sbjct: 61 QQTRAVIENIRTILKSAGADLENIIDLTVFLVDMKDYNGFNLAYNDYFKIETGPTRTTVA 120

Query: 407 VHQLPNPNLLIEIKATALC 463
VHQLPNPNLLIEIKATALC
Sbjct: 121 VHQLPNPNLLIEIKATALC 139

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 679,112,536
Number of extensions: 11153141
Number of successful extensions: 31314
Number of sequences better than 10.0: 870
Number of HSP's gapped: 31022
Number of HSP's successfully gapped: 879
Length of query: 188
Length of database: 1,061,185,681
Length adjustment: 121
Effective length of query: 67
Effective length of database: 665,703,473
Effective search space: 44602132691
Effective search space used: 44602132691
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

PSORT

psg: 0.58 gvh: 0.49 alm: 0.43 top: 0.53 tms: 0.00 mit: 0.26 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

40.0 %: cytoplasmic
24.0 %: mitochondrial
24.0 %: nuclear
4.0 %: cytoskeletal
4.0 %: vacuolar
4.0 %: vesicles of secretory system

>> prediction for Contig-U04900-1 is cyt

VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 2
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0