| Homology vs DNA |
 |
| Homology vs Protein |
Query= Contig-U04819-1 (Contig-U04819-1Q) /CSM_Contig/Contig-U04819-1Q.Seq.d
(869 letters)
Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CP000386_2942(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 166 1e-39
CP000744_192(CP000744|pid:none) Pseudomonas aeruginosa PA7, comp... 166 1e-39
CP000094_3902(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 164 5e-39
CP001635_807(CP001635|pid:none) Variovorax paradoxus S110 chromo... 162 1e-38
CP000680_2606(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 162 2e-38
CP000774_3626(CP000774|pid:none) Parvibaculum lavamentivorans DS... 160 4e-38
CP000926_2879(CP000926|pid:none) Pseudomonas putida GB-1, comple... 155 2e-36
CP001016_3488(CP001016|pid:none) Beijerinckia indica subsp. indi... 154 5e-36
CP001510_3906(CP001510|pid:none) Methylobacterium extorquens AM1... 153 6e-36
CP000494_4841(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 153 8e-36
BT033331_1(BT033331|pid:none) Zea mays full-length cDNA clone ZM... 153 8e-36
CU234118_863(CU234118|pid:none) Bradyrhizobium sp. ORS278,comple... 152 1e-35
CP000697_1406(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 151 3e-35
AM920436_309(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 150 4e-35
CP001029_4235(CP001029|pid:none) Methylobacterium populi BJ001, ... 150 5e-35
CP000908_3812(CP000908|pid:none) Methylobacterium extorquens PA1... 150 7e-35
CP000781_4262(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 149 1e-34
CP000356_496(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 149 2e-34
CP001090_65(CP001090|pid:none) Geobacter lovleyi SZ plasmid pGLO... 148 2e-34
CP000250_19(CP000250|pid:none) Rhodopseudomonas palustris HaA2, ... 147 3e-34
AK105359_1(AK105359|pid:none) Oryza sativa Japonica Group cDNA c... 147 3e-34
CP000494_301(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 147 5e-34
CP000928_179(CP000928|pid:none) Caulobacter sp. K31 plasmid pCAU... 146 8e-34
CP001053_1664(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 146 1e-33
CP000283_726(CP000283|pid:none) Rhodopseudomonas palustris BisB5... 146 1e-33
CP000271_1567(CP000271|pid:none) Burkholderia xenovorans LB400 c... 145 1e-33
CP000463_20(CP000463|pid:none) Rhodopseudomonas palustris BisA53... 142 1e-32
CP001001_73(CP001001|pid:none) Methylobacterium radiotolerans JC... 142 1e-32
CP000117_4729(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 142 1e-32
CP001191_208(CP001191|pid:none) Rhizobium leguminosarum bv. trif... 139 9e-32
CP001280_2423(CP001280|pid:none) Methylocella silvestris BL2, co... 139 9e-32
BA000012_5414(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 139 1e-31
CP001037_5735(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 139 2e-31
CP000555_908(CP000555|pid:none) Methylibium petroleiphilum PM1, ... 138 3e-31
CP000628_236(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 136 8e-31
AY087357_1(AY087357|pid:none) Arabidopsis thaliana clone 34560 m... 136 1e-30
AF439850_1(AF439850|pid:none) Arabidopsis thaliana AT3g50560/T20... 134 3e-30
A87329(A87329) hypothetical protein CC0644 [imported] - Caulobac... 134 4e-30
AM236080_596(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 134 4e-30
BX571966_862(BX571966|pid:none) Burkholderia pseudomallei strain... 134 4e-30
CP000571_1231(CP000571|pid:none) Burkholderia pseudomallei 668 c... 134 4e-30
CP000158_2314(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 134 5e-30
CP000011_682(CP000011|pid:none) Burkholderia mallei ATCC 23344 c... 133 7e-30
AP007157_80(AP007157|pid:none) Aspergillus oryzae RIB40 genomic ... 132 2e-29
CU638743_728(CU638743|pid:none) Podospora anserina genomic DNA c... 129 1e-28
BA000040_7157(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 129 1e-28
CP000521_2321(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 129 2e-28
CP000863_2286(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 129 2e-28
CU459141_1390(CU459141|pid:none) Acinetobacter baumannii str. AY... 129 2e-28
CP000840_224(CP000840|pid:none) Acaryochloris marina MBIC11017 p... 125 2e-27
CR543861_1413(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 123 7e-27
CP000774_1659(CP000774|pid:none) Parvibaculum lavamentivorans DS... 121 3e-26
CP000774_3623(CP000774|pid:none) Parvibaculum lavamentivorans DS... 113 1e-23
AM468990_1(AM468990|pid:none) Vitis vinifera contig VV78X164886.... 112 2e-23
CP000863_2285(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 87 1e-15
CP000521_2320(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 83 1e-14
CP001172_1341(CP001172|pid:none) Acinetobacter baumannii AB307-0... 81 4e-14
CP000804_2018(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 81 4e-14
CP001103_913(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 80 7e-14
CP000481_1147(CP000481|pid:none) Acidothermus cellulolyticus 11B... 80 1e-13
(O67610) RecName: Full=3-oxoacyl-[acyl-carrier-protein] reductas... 79 3e-13
CP000686_1433(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 77 1e-12
BT039132_1(BT039132|pid:none) Zea mays full-length cDNA clone ZM... 76 1e-12
CP000820_2196(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 76 2e-12
CP000828_5498(CP000828|pid:none) Acaryochloris marina MBIC11017,... 76 2e-12
CP000383_2164(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 75 2e-12
CP001291_479(CP001291|pid:none) Cyanothece sp. PCC 7424, complet... 74 5e-12
HB438246_1(HB438246|pid:none) Sequence 1064 from Patent WO200907... 74 6e-12
AP009493_5681(AP009493|pid:none) Streptomyces griseus subsp. gri... 74 6e-12
CP000943_3307(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 74 8e-12
AP011115_7001(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 73 1e-11
CP000325_1233(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 73 1e-11
CP000511_2708(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 73 1e-11
CP000713_1684(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 72 2e-11
EF085304_1(EF085304|pid:none) Picea sitchensis clone WS02725_A14... 72 2e-11
CP000656_3636(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 72 3e-11
CP001080_1617(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 72 3e-11
CP000817_1813(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 71 4e-11
CP001628_1089(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 71 4e-11
BA000004_1550(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 71 4e-11
AE015928_2380(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 71 4e-11
CS584570_1(CS584570|pid:none) Sequence 1 from Patent WO200703392... 71 5e-11
CP001052_945(CP001052|pid:none) Burkholderia phytofirmans PsJN c... 71 5e-11
CP000390_3732(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 70 7e-11
AP007170_104(AP007170|pid:none) Aspergillus oryzae RIB40 genomic... 70 7e-11
CS584572_1(CS584572|pid:none) Sequence 3 from Patent WO200703392... 70 9e-11
CP001634_160(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 70 1e-10
AP009152_1239(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 70 1e-10
CP000738_1201(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 69 2e-10
AF2466(AF2466) hypothetical protein alr5286 [imported] - Nostoc ... 69 2e-10
AE016958_3593(AE016958|pid:none) Mycobacterium avium subsp. para... 69 2e-10
(A4IFA7) RecName: Full=Carbonyl reductase 4; EC=1.1.1.-... 69 2e-10
CP000511_2205(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 69 2e-10
CU694393_451(CU694393|pid:none) Ralstonia solanacearum strain Mo... 69 2e-10
CP000117_2525(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 69 2e-10
CP000142_2214(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 69 3e-10
BA000012_1860(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 69 3e-10
(Q6GV12) RecName: Full=3-ketodihydrosphingosine reductase; ... 69 3e-10
AK170064_1(AK170064|pid:none) Mus musculus NOD-derived CD11c +ve... 69 3e-10
CP001337_718(CP001337|pid:none) Chloroflexus aggregans DSM 9485,... 69 3e-10
CP000082_1428(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 69 3e-10
AL646053_33(AL646053|pid:none) Ralstonia solanacearum GMI1000 me... 69 3e-10
CP000240_187(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 68 4e-10
AE009948_346(AE009948|pid:none) Streptococcus agalactiae 2603V/R... 68 4e-10
CP000854_398(CP000854|pid:none) Mycobacterium marinum M, complet... 68 4e-10
BA000045_1581(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 68 5e-10
CP000753_2676(CP000753|pid:none) Shewanella baltica OS185, compl... 67 6e-10
CP001069_70(CP001069|pid:none) Ralstonia pickettii 12J chromosom... 67 6e-10
CP000249_1878(CP000249|pid:none) Frankia sp. CcI3, complete geno... 67 6e-10
CP000440_2242(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 67 6e-10
AP006627_374(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 67 8e-10
CP000152_3160(CP000152|pid:none) Burkholderia sp. 383 chromosome... 67 8e-10
CP000356_869(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 67 8e-10
CP001656_3492(CP001656|pid:none) Paenibacillus sp. JDR-2, comple... 67 8e-10
CP000379_2139(CP000379|pid:none) Burkholderia cenocepacia AU 105... 67 8e-10
U66800_1(U66800|pid:none) Mycobacterium smegmatis 3-ketoacyl red... 67 8e-10
CP000151_2351(CP000151|pid:none) Burkholderia sp. 383 chromosome... 67 8e-10
(Q2KIJ5) RecName: Full=3-ketodihydrosphingosine reductase; ... 67 8e-10
CP000514_87(CP000514|pid:none) Marinobacter aquaeolei VT8, compl... 67 8e-10
CP001176_1826(CP001176|pid:none) Bacillus cereus B4264, complete... 67 1e-09
AX269024_1(AX269024|pid:none) Sequence 1 from Patent WO0175119. 67 1e-09
CP000270_1285(CP000270|pid:none) Burkholderia xenovorans LB400 c... 67 1e-09
AM746676_1685(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 67 1e-09
AB088224_114(AB088224|pid:none) Streptomyces rochei plasmid pSLA... 67 1e-09
BA000028_1843(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 67 1e-09
CP001635_2192(CP001635|pid:none) Variovorax paradoxus S110 chrom... 67 1e-09
AM747721_24(AM747721|pid:none) Burkholderia cenocepacia J2315 ch... 67 1e-09
AM747720_2300(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 67 1e-09
CP000503_1596(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 66 1e-09
AF267243_4(AF267243|pid:none) Azotobacter vinelandii PhbF (phbF)... 66 1e-09
B83926(B83926) 3-oxoacyl-(acyl-carrier-protein) reductase BH2210... 66 1e-09
AY692351_1(AY692351|pid:none) Uncultured soil bacterium clone RC... 66 1e-09
BC033650_1(BC033650|pid:none) Homo sapiens carbonyl reductase 4,... 66 1e-09
CP000271_1061(CP000271|pid:none) Burkholderia xenovorans LB400 c... 66 1e-09
(Q8N4T8) RecName: Full=Carbonyl reductase 4; EC=1.1.1.-... 66 2e-09
CP000239_2652(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 66 2e-09
CP000419_326(CP000419|pid:none) Streptococcus thermophilus LMD-9... 66 2e-09
AJ311166_1(AJ311166|pid:none) Azotobacter sp. FA8 phaB gene for ... 66 2e-09
CP000469_1517(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 66 2e-09
CP001052_1355(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 66 2e-09
CP000444_1526(CP000444|pid:none) Shewanella sp. MR-7, complete g... 66 2e-09
CP001019_458(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com... 66 2e-09
AP008957_3074(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 66 2e-09
AJ719938_1(AJ719938|pid:none) Gallus gallus mRNA for hypothetica... 65 2e-09
CU638744_703(CU638744|pid:none) Podospora anserina genomic DNA c... 65 2e-09
CP000023_375(CP000023|pid:none) Streptococcus thermophilus LMG 1... 65 2e-09
CP000764_1434(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 65 2e-09
(Q2FE21) RecName: Full=Uncharacterized oxidoreductase SAUSA300_2... 65 2e-09
AM746676_4683(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 65 2e-09
CP000866_44(CP000866|pid:none) Nitrosopumilus maritimus SCM1, co... 65 2e-09
CP001037_2019(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 65 2e-09
AP009385_2147(AP009385|pid:none) Burkholderia multivorans ATCC 1... 65 2e-09
CP001001_3504(CP001001|pid:none) Methylobacterium radiotolerans ... 65 3e-09
CP001022_206(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 65 3e-09
AL935262_97(AL935262|pid:none) Lactobacillus plantarum strain WC... 65 3e-09
AE017263_173(AE017263|pid:none) Mesoplasma florum L1 complete ge... 65 4e-09
CP001229_52(CP001229|pid:none) Sulfurihydrogenibium azorense Az-... 65 4e-09
CP001654_3461(CP001654|pid:none) Dickeya dadantii Ech703, comple... 65 4e-09
CP000454_838(CP000454|pid:none) Arthrobacter sp. FB24, complete ... 65 4e-09
BA000028_3314(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 64 5e-09
CP000563_2645(CP000563|pid:none) Shewanella baltica OS155, compl... 64 5e-09
AL646053_1060(AL646053|pid:none) Ralstonia solanacearum GMI1000 ... 64 5e-09
AE014184_313(AE014184|pid:none) Tropheryma whipplei str. Twist, ... 64 5e-09
CP000509_2765(CP000509|pid:none) Nocardioides sp. JS614, complet... 64 5e-09
CP000685_4998(CP000685|pid:none) Flavobacterium johnsoniae UW101... 64 5e-09
AE017226_595(AE017226|pid:none) Treponema denticola ATCC 35405, ... 64 5e-09
(Q6G6J1) RecName: Full=Uncharacterized oxidoreductase SAS2370; ... 64 5e-09
CP000480_6604(CP000480|pid:none) Mycobacterium smegmatis str. MC... 64 5e-09
CP000360_796(CP000360|pid:none) Acidobacteria bacterium Ellin345... 64 5e-09
CR543861_1414(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 64 7e-09
CP000908_260(CP000908|pid:none) Methylobacterium extorquens PA1,... 64 7e-09
CP000817_3998(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 64 7e-09
BA000028_671(BA000028|pid:none) Oceanobacillus iheyensis HTE831 ... 64 7e-09
CP000271_2697(CP000271|pid:none) Burkholderia xenovorans LB400 c... 64 7e-09
BA000039_1309(BA000039|pid:none) Thermosynechococcus elongatus B... 64 7e-09
BC009118_1(BC009118|pid:none) Mus musculus carbonyl reductase 4,... 64 7e-09
AE017354_2270(AE017354|pid:none) Legionella pneumophila subsp. p... 64 7e-09
CR382125_431(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 64 7e-09
CP000614_2268(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 64 7e-09
CP000386_2224(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 64 9e-09
CP000677_266(CP000677|pid:none) Novosphingobium aromaticivorans ... 64 9e-09
CP000545_13(CP000545|pid:none) Burkholderia mallei NCTC 10229 ch... 64 9e-09
CP001010_201(CP001010|pid:none) Polynucleobacter necessarius sub... 64 9e-09
CP000769_32(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, com... 64 9e-09
(Q10245) RecName: Full=3-ketoacyl-CoA reductase; Short=... 64 9e-09
CP001655_3549(CP001655|pid:none) Dickeya zeae Ech1591, complete ... 64 9e-09
CP001251_384(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 64 9e-09
BX571966_359(BX571966|pid:none) Burkholderia pseudomallei strain... 63 1e-08
AM849034_1937(AM849034|pid:none) Clavibacter michiganensis subsp... 63 1e-08
CP001298_1447(CP001298|pid:none) Methylobacterium chloromethanic... 63 1e-08
AY663853_1(AY663853|pid:none) Oreochromis niloticus 17-beta hydr... 63 1e-08
CP001069_491(CP001069|pid:none) Ralstonia pickettii 12J chromoso... 63 1e-08
CP000011_831(CP000011|pid:none) Burkholderia mallei ATCC 23344 c... 63 1e-08
CP000697_489(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 63 1e-08
CP000425_740(CP000425|pid:none) Lactococcus lactis subsp. cremor... 63 1e-08
AP006627_3105(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 63 1e-08
CP000851_1645(CP000851|pid:none) Shewanella pealeana ATCC 700345... 63 1e-08
(Q91VT4) RecName: Full=Carbonyl reductase 4; EC=1.1.1.-... 63 1e-08
CP000573_500(CP000573|pid:none) Burkholderia pseudomallei 1106a ... 63 1e-08
CP000728_3399(CP000728|pid:none) Clostridium botulinum F str. La... 63 1e-08
CP000094_3274(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 63 1e-08
CP000573_21(CP000573|pid:none) Burkholderia pseudomallei 1106a c... 63 1e-08
CP000446_1464(CP000446|pid:none) Shewanella sp. MR-4, complete g... 63 1e-08
AM406671_1747(AM406671|pid:none) Lactococcus lactis subsp. cremo... 63 1e-08
CU633749_1941(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 63 1e-08
AP007255_2587(AP007255|pid:none) Magnetospirillum magneticum AMB... 63 1e-08
CP000352_3043(CP000352|pid:none) Ralstonia metallidurans CH34, c... 63 1e-08
CP000133_2967(CP000133|pid:none) Rhizobium etli CFN 42, complete... 63 1e-08
CP000085_19(CP000085|pid:none) Burkholderia thailandensis E264 c... 63 1e-08
BT045417_1(BT045417|pid:none) Salmo salar clone ssal-rgf-520-346... 63 1e-08
CP000081_34(CP000081|pid:none) Leishmania major chromosome 35, c... 63 1e-08
CP001053_1937(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 63 1e-08
CP000058_900(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 63 1e-08
AE017333_3315(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 63 1e-08
CP000085_2029(CP000085|pid:none) Burkholderia thailandensis E264... 63 1e-08
CP000473_733(CP000473|pid:none) Solibacter usitatus Ellin6076, c... 63 1e-08
CP001635_1498(CP001635|pid:none) Variovorax paradoxus S110 chrom... 63 1e-08
AE016823_2604(AE016823|pid:none) Leptospira interrogans serovar ... 63 1e-08
CP000850_1039(CP000850|pid:none) Salinispora arenicola CNS-205, ... 63 1e-08
CP000921_432(CP000921|pid:none) Streptococcus pneumoniae Taiwan1... 63 1e-08
CP000614_1407(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 62 2e-08
CP000384_4563(CP000384|pid:none) Mycobacterium sp. MCS, complete... 62 2e-08
AY892319_1(AY892319|pid:none) Synthetic construct Homo sapiens c... 62 2e-08
CP000227_2895(CP000227|pid:none) Bacillus cereus Q1, complete ge... 62 2e-08
CP001052_2354(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 62 2e-08
AE005672_400(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 62 2e-08
CP001291_3274(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 62 2e-08
(Q06136) RecName: Full=3-ketodihydrosphingosine reductase; ... 62 2e-08
AP009384_1277(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 62 2e-08
CP000360_265(CP000360|pid:none) Acidobacteria bacterium Ellin345... 62 2e-08
CP000251_3151(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 62 2e-08
CP001130_504(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 62 2e-08
AJ749949_1201(AJ749949|pid:none) Francisella tularensis subsp. t... 62 3e-08
CP001053_3079(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 62 3e-08
AM233362_742(AM233362|pid:none) Francisella tularensis subsp. ho... 62 3e-08
AE005176_1538(AE005176|pid:none) Lactococcus lactis subsp. lacti... 62 3e-08
CP001025_1372(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 62 3e-08
CP000931_2594(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 62 3e-08
AC116984_39(AC116984|pid:none) Dictyostelium discoideum chromoso... 62 3e-08
BA000040_3991(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 62 3e-08
AE017340_109(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 62 3e-08
BA000004_932(BA000004|pid:none) Bacillus halodurans C-125 DNA, c... 62 3e-08
CP000440_1342(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 62 3e-08
BA000028_675(BA000028|pid:none) Oceanobacillus iheyensis HTE831 ... 62 3e-08
CP000854_4864(CP000854|pid:none) Mycobacterium marinum M, comple... 62 3e-08
AE014075_1683(AE014075|pid:none) Escherichia coli CFT073, comple... 62 3e-08
CP000725_1648(CP000725|pid:none) Streptococcus gordonii str. Cha... 62 3e-08
AM295007_1063(AM295007|pid:none) Streptococcus pyogenes Manfredo... 62 3e-08
CP000439_1153(CP000439|pid:none) Francisella tularensis subsp. n... 62 3e-08
CR378666_253(CR378666|pid:none) Photobacterium profundum SS9; se... 62 3e-08
CP001110_1489(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 62 3e-08
DQ489736_305(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 62 3e-08
BC125689_1(BC125689|pid:none) Xenopus tropicalis hypothetical pr... 62 3e-08
CP000480_2480(CP000480|pid:none) Mycobacterium smegmatis str. MC... 62 3e-08
CP000713_452(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 62 3e-08
BC044552_1(BC044552|pid:none) Danio rerio 3-ketodihydrosphingosi... 62 3e-08
AE005176_774(AE005176|pid:none) Lactococcus lactis subsp. lactis... 62 3e-08
CP000686_376(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 62 3e-08
AE016958_2650(AE016958|pid:none) Mycobacterium avium subsp. para... 61 4e-08
AJ278289_3(AJ278289|pid:none) Thauera aromatica ORF1, ORF2, ORF3... 61 4e-08
CP001638_1582(CP001638|pid:none) Geobacillus sp. WCH70, complete... 61 4e-08
AE004092_695(AE004092|pid:none) Streptococcus pyogenes M1 GAS, c... 61 4e-08
CP000655_213(CP000655|pid:none) Polynucleobacter necessarius sub... 61 4e-08
AM167904_263(AM167904|pid:none) Bordetella avium 197N complete g... 61 4e-08
CP000922_1402(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 61 4e-08
(Q6GDV6) RecName: Full=Uncharacterized oxidoreductase SAR2567; ... 61 4e-08
CP000629_866(CP000629|pid:none) Agrobacterium radiobacter K84 ch... 61 4e-08
BT076812_1(BT076812|pid:none) Caligus rogercresseyi clone crog-e... 61 4e-08
CP001157_3143(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 61 4e-08
CP001344_244(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 61 4e-08
AX154967_1(AX154967|pid:none) Sequence 13 from Patent WO0138484. 61 4e-08
CP000563_3411(CP000563|pid:none) Shewanella baltica OS155, compl... 61 4e-08
CP000384_2010(CP000384|pid:none) Mycobacterium sp. MCS, complete... 61 4e-08
CP000462_2193(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 61 4e-08
CP001341_406(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 61 4e-08
(A4QTE3) RecName: Full=3-ketoacyl-CoA reductase; Short=... 61 4e-08
CP000352_2194(CP000352|pid:none) Ralstonia metallidurans CH34, c... 61 4e-08
CU928160_1254(CU928160|pid:none) Escherichia coli IAI1 chromosom... 61 4e-08
CU207366_2973(CU207366|pid:none) Gramella forsetii KT0803 comple... 61 4e-08
CP000151_1420(CP000151|pid:none) Burkholderia sp. 383 chromosome... 61 4e-08
CP000962_3418(CP000962|pid:none) Clostridium botulinum A3 str. L... 61 6e-08
CP001083_3554(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 61 6e-08
CP000685_1834(CP000685|pid:none) Flavobacterium johnsoniae UW101... 61 6e-08
CP000896_625(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 61 6e-08
CP001192_328(CP001192|pid:none) Rhizobium leguminosarum bv. trif... 61 6e-08
CP000393_3015(CP000393|pid:none) Trichodesmium erythraeum IMS101... 61 6e-08
CP001472_3149(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 61 6e-08
CP001618_2458(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 61 6e-08
(Q7RYE5) RecName: Full=3-ketoacyl-CoA reductase; Short=... 61 6e-08
CU207366_1507(CU207366|pid:none) Gramella forsetii KT0803 comple... 61 6e-08
CP001357_2592(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 61 6e-08
CU928168_544(CU928168|pid:none) Kluyveromyces thermotolerans str... 61 6e-08
AE016795_2771(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 61 6e-08
CP000479_1215(CP000479|pid:none) Mycobacterium avium 104, comple... 61 6e-08
(Q9KQH7) RecName: Full=3-oxoacyl-[acyl-carrier-protein] reductas... 60 7e-08
CR936257_2175(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 60 7e-08
AY596297_1736(AY596297|pid:none) Haloarcula marismortui ATCC 430... 60 7e-08
CP000915_633(CP000915|pid:none) Francisella tularensis subsp. me... 60 7e-08
CP000056_1383(CP000056|pid:none) Streptococcus pyogenes MGAS6180... 60 7e-08
CP000780_1738(CP000780|pid:none) Candidatus Methanoregula boonei... 60 7e-08
CR936257_1767(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 60 7e-08
CP000133_781(CP000133|pid:none) Rhizobium etli CFN 42, complete ... 60 7e-08
CP000753_846(CP000753|pid:none) Shewanella baltica OS185, comple... 60 7e-08
A82604(A82604) oxidoreductase XF2082 [imported] - Xylella fastid... 60 7e-08
CP000390_3648(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 60 7e-08
CP000822_1303(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 60 7e-08
CP000884_1540(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 60 7e-08
CP000431_5338(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 60 7e-08
CP000740_163(CP000740|pid:none) Sinorhizobium medicae WSM419 pla... 60 7e-08
AM747721_1945(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 60 7e-08
CP000151_3076(CP000151|pid:none) Burkholderia sp. 383 chromosome... 60 7e-08
CP001341_1844(CP001341|pid:none) Arthrobacter chlorophenolicus A... 60 1e-07
CP000542_150(CP000542|pid:none) Verminephrobacter eiseniae EF01-... 60 1e-07
CP000407_1795(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 60 1e-07
GN099405_1(GN099405|pid:none) Sequence 4186 from Patent WO200903... 60 1e-07
AP009387_68(AP009387|pid:none) Burkholderia multivorans ATCC 176... 60 1e-07
CP000479_1184(CP000479|pid:none) Mycobacterium avium 104, comple... 60 1e-07
CU468135_1552(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 60 1e-07
CP000941_866(CP000941|pid:none) Xylella fastidiosa M12, complete... 60 1e-07
CP000512_3084(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 60 1e-07
CP000878_741(CP000878|pid:none) Prochlorococcus marinus str. MIT... 60 1e-07
FJ196388_4(FJ196388|pid:none) Escherichia coli strain P528.10.99... 60 1e-07
CP000454_3928(CP000454|pid:none) Arthrobacter sp. FB24, complete... 60 1e-07
AM747721_1585(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 60 1e-07
CP000248_1715(CP000248|pid:none) Novosphingobium aromaticivorans... 60 1e-07
CP001052_2085(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 60 1e-07
U77680_1(U77680|pid:none) Acinetobacter baylyi fatty acyl-CoA re... 60 1e-07
EF495212_55(EF495212|pid:none) Arthrobacter sp. Chr15 plasmid pC... 60 1e-07
CR555306_3313(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 60 1e-07
CP001359_3357(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 60 1e-07
(P0A0H9) RecName: Full=3-oxoacyl-[acyl-carrier-protein] reductas... 60 1e-07
AM884176_485(AM884176|pid:none) Chlamydia trachomatis strain L2/... 60 1e-07
AM181176_2979(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 60 1e-07
CP000431_3805(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 60 1e-07
AP006725_2070(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 60 1e-07
AM420293_3703(AM420293|pid:none) Saccharopolyspora erythraea NRR... 60 1e-07
BC068662_1(BC068662|pid:none) Xenopus laevis hypothetical protei... 60 1e-07
CU928163_1549(CU928163|pid:none) Escherichia coli UMN026 chromos... 60 1e-07
CP000491_570(CP000491|pid:none) Paracoccus denitrificans PD1222 ... 60 1e-07
CP000647_1239(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 60 1e-07
AP006725_1367(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 60 1e-07
AP009351_1147(AP009351|pid:none) Staphylococcus aureus subsp. au... 60 1e-07
CU458896_2699(CU458896|pid:none) Mycobacterium abscessus chromos... 60 1e-07
AE010300_971(AE010300|pid:none) Leptospira interrogans serovar l... 60 1e-07
(P31808) RecName: Full=Uncharacterized oxidoreductase yciK; ... 60 1e-07
AB195289_1(AB195289|pid:none) Staphylococcus aureus fabG gene fo... 60 1e-07
CP000384_1493(CP000384|pid:none) Mycobacterium sp. MCS, complete... 60 1e-07
CP000382_49(CP000382|pid:none) Clostridium novyi NT, complete ge... 60 1e-07
CP000509_402(CP000509|pid:none) Nocardioides sp. JS614, complete... 60 1e-07
AB192961_1(AB192961|pid:none) Gluconobacter frateurii genes for ... 59 2e-07
CU633898_19(CU633898|pid:none) Podospora anserina genomic DNA ch... 59 2e-07
AM920427_225(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 59 2e-07
CP001026_1471(CP001026|pid:none) Burkholderia ambifaria MC40-6 c... 59 2e-07
CP001615_2864(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 59 2e-07
AM502253_42(AM502253|pid:none) Leishmania infantum chromosome 35. 59 2e-07
CP000806_3910(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 59 2e-07
AE005176_898(AE005176|pid:none) Lactococcus lactis subsp. lactis... 59 2e-07
CP000492_2403(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 59 2e-07
CP001037_1576(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 59 2e-07
CP000038_1747(CP000038|pid:none) Shigella sonnei Ss046, complete... 59 2e-07
CP001074_865(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 59 2e-07
CP000813_2076(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 59 2e-07
CR555306_375(CR555306|pid:none) Azoarcus sp. EbN1 complete genome. 59 2e-07
CP001074_3122(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 59 2e-07
AM946015_840(AM946015|pid:none) Streptococcus uberis 0140J compl... 59 2e-07
CP000148_2203(CP000148|pid:none) Geobacter metallireducens GS-15... 59 2e-07
CP000086_2567(CP000086|pid:none) Burkholderia thailandensis E264... 59 2e-07
CP000804_1747(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 59 2e-07
AE016825_3576(AE016825|pid:none) Chromobacterium violaceum ATCC ... 59 2e-07
AP008955_1172(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 59 2e-07
CP000817_847(CP000817|pid:none) Lysinibacillus sphaericus C3-41,... 59 2e-07
CP000970_1797(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 59 2e-07
AP008971_818(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 59 2e-07
CU928164_1601(CU928164|pid:none) Escherichia coli IAI39 chromoso... 59 2e-07
CT573213_4593(CT573213|pid:none) Frankia alni str. ACN14A chromo... 59 2e-07
AE016853_1704(AE016853|pid:none) Pseudomonas syringae pv. tomato... 59 2e-07
AP009240_1319(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 59 2e-07
CP000937_93(CP000937|pid:none) Francisella philomiragia subsp. p... 59 2e-07
(Q68ER2) RecName: Full=Carbonyl reductase 4; EC=1.1.1.-... 59 3e-07
CP001504_21(CP001504|pid:none) Burkholderia glumae BGR1 chromoso... 59 3e-07
CP001191_430(CP001191|pid:none) Rhizobium leguminosarum bv. trif... 59 3e-07
CP000908_1324(CP000908|pid:none) Methylobacterium extorquens PA1... 59 3e-07
CP001503_2055(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 59 3e-07
BC148618_1(BC148618|pid:none) Synthetic construct Mus musculus c... 59 3e-07
CP001175_2177(CP001175|pid:none) Listeria monocytogenes HCC23, c... 59 3e-07
AE017355_3691(AE017355|pid:none) Bacillus thuringiensis serovar ... 59 3e-07
CP000580_754(CP000580|pid:none) Mycobacterium sp. JLS, complete ... 59 3e-07
AP009386_1376(AP009386|pid:none) Burkholderia multivorans ATCC 1... 59 3e-07
AP011115_3711(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 59 3e-07
AM889285_3269(AM889285|pid:none) Gluconacetobacter diazotrophicu... 59 3e-07
CP000320_93(CP000320|pid:none) Nitrobacter hamburgensis X14 plas... 59 3e-07
CP000909_2039(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 59 3e-07
CP001655_3066(CP001655|pid:none) Dickeya zeae Ech1591, complete ... 59 3e-07
CR555306_3466(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 59 3e-07
CP001052_2705(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 59 3e-07
CP000473_2681(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 59 3e-07
CP001146_304(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 58 4e-07
AB009078_1(AB009078|pid:none) Brevibacterium saccharolyticum gen... 58 4e-07
CP000826_4105(CP000826|pid:none) Serratia proteamaculans 568, co... 58 4e-07
CP000411_1449(CP000411|pid:none) Oenococcus oeni PSU-1, complete... 58 4e-07
CP000776_1303(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 58 4e-07
AL591985_441(AL591985|pid:none) Sinorhizobium meliloti 1021 plas... 58 4e-07
AE004092_1263(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ... 58 4e-07
CP000783_2192(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 58 4e-07
FM204883_456(FM204883|pid:none) Streptococcus equi subsp. equi 4... 58 4e-07
CP000325_397(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 58 4e-07
CP001280_1204(CP001280|pid:none) Methylocella silvestris BL2, co... 58 4e-07
CP000679_1532(CP000679|pid:none) Caldicellulosiruptor saccharoly... 58 4e-07
(Q6NV34) RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; ... 58 4e-07
AP010935_1222(AP010935|pid:none) Streptococcus dysgalactiae subs... 58 4e-07
AB158429_3(AB158429|pid:none) Streptococcus bovis genes for hypo... 58 4e-07
CP000508_139(CP000508|pid:none) Nocardioides sp. JS614, complete... 58 4e-07
CP000261_1518(CP000261|pid:none) Streptococcus pyogenes MGAS2096... 58 5e-07
CP000448_1848(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 58 5e-07
CP000686_4440(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 58 5e-07
CP000480_261(CP000480|pid:none) Mycobacterium smegmatis str. MC2... 58 5e-07
CP000964_3905(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 58 5e-07
AM181176_1943(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 58 5e-07
EU016666_16(EU016666|pid:none) Uncultured marine microorganism H... 58 5e-07
CP000759_1257(CP000759|pid:none) Ochrobactrum anthropi ATCC 4918... 58 5e-07
BT045689_1(BT045689|pid:none) Salmo salar clone ssal-rgf-528-346... 58 5e-07
BA000043_1655(BA000043|pid:none) Geobacillus kaustophilus HTA426... 58 5e-07
CU633749_2579(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 58 5e-07
CP001622_4486(CP001622|pid:none) Rhizobium leguminosarum bv. tri... 58 5e-07
CP000271_804(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 58 5e-07
CP000230_3007(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 58 5e-07
AB439580_1(AB439580|pid:none) Cyprinus carpio rdh8l2 mRNA for re... 58 5e-07
CP000102_46(CP000102|pid:none) Methanosphaera stadtmanae DSM 309... 58 5e-07
CP000386_524(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 58 5e-07
AE014074_1523(AE014074|pid:none) Streptococcus pyogenes MGAS315,... 58 5e-07
B83838(B83838) oxidoreductase BH1506 [imported] - Bacillus halod... 58 5e-07
CP000783_824(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-... 58 5e-07
CP001139_1790(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 58 5e-07
CP000471_1148(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 58 5e-07
CP000031_2758(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 58 5e-07
(A1DH66) RecName: Full=3-ketoacyl-CoA reductase; Short=... 58 5e-07
CP001618_2307(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 58 5e-07
CP000438_3261(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 58 5e-07
CP001026_1379(CP001026|pid:none) Burkholderia ambifaria MC40-6 c... 58 5e-07
CP000557_1487(CP000557|pid:none) Geobacillus thermodenitrificans... 58 5e-07
CU928158_1763(CU928158|pid:none) Escherichia fergusonii ATCC 354... 58 5e-07
CP000580_1490(CP000580|pid:none) Mycobacterium sp. JLS, complete... 57 6e-07
CP001127_1740(CP001127|pid:none) Salmonella enterica subsp. ente... 57 6e-07
CP000425_882(CP000425|pid:none) Lactococcus lactis subsp. cremor... 57 6e-07
CP000152_925(CP000152|pid:none) Burkholderia sp. 383 chromosome ... 57 6e-07
CP000738_194(CP000738|pid:none) Sinorhizobium medicae WSM419, co... 57 6e-07
A95284(A95284) probable [imported] - Sinorhizobium meliloti (str... 57 6e-07
CP000740_167(CP000740|pid:none) Sinorhizobium medicae WSM419 pla... 57 6e-07
CP000575_554(CP000575|pid:none) Staphylothermus marinus F1, comp... 57 6e-07
AC0654(AC0654) hypothetical oxidoreductase STY1333 [imported] - ... 57 6e-07
CP000480_1581(CP000480|pid:none) Mycobacterium smegmatis str. MC... 57 6e-07
CP000699_1365(CP000699|pid:none) Sphingomonas wittichii RW1, com... 57 6e-07
CP000436_684(CP000436|pid:none) Haemophilus somnus 129PT, comple... 57 6e-07
AM900040_21(AM900040|pid:none) Streptomyces olivaceus elloramyci... 57 6e-07
CP000260_1558(CP000260|pid:none) Streptococcus pyogenes MGAS1027... 57 6e-07
CP001026_1568(CP001026|pid:none) Burkholderia ambifaria MC40-6 c... 57 6e-07
CP001037_655(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 57 8e-07
CP000504_1077(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 57 8e-07
AM746676_1335(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 57 8e-07
CP000916_231(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 57 8e-07
CP000927_158(CP000927|pid:none) Caulobacter sp. K31, complete ge... 57 8e-07
AE000512_432(AE000512|pid:none) Thermotoga maritima MSB8, comple... 57 8e-07
BT035594_1(BT035594|pid:none) Zea mays full-length cDNA clone ZM... 57 8e-07
AE017262_442(AE017262|pid:none) Listeria monocytogenes str. 4b F... 57 8e-07
FM173265_32(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 57 8e-07
CP001251_387(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 57 8e-07
AM942759_850(AM942759|pid:none) Proteus mirabilis strain HI4320,... 57 8e-07
AE017220_1714(AE017220|pid:none) Salmonella enterica subsp. ente... 57 8e-07
CP000386_1659(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 57 8e-07
CP001389_203(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 57 8e-07
AM778913_26(AM778913|pid:none) Microcystis aeruginosa PCC 7806 g... 57 8e-07
AE016958_599(AE016958|pid:none) Mycobacterium avium subsp. parat... 57 8e-07
FP236842_2148(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 57 1e-06
CP000826_1899(CP000826|pid:none) Serratia proteamaculans 568, co... 57 1e-06
CP000283_1538(CP000283|pid:none) Rhodopseudomonas palustris BisB... 57 1e-06
AP009044_2628(AP009044|pid:none) Corynebacterium glutamicum R DN... 57 1e-06
BA000028_2211(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 57 1e-06
(A1C6J8) RecName: Full=3-ketoacyl-CoA reductase; Short=... 57 1e-06
AM039952_3897(AM039952|pid:none) Xanthomonas campestris pv. vesi... 57 1e-06
CP000155_6331(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 57 1e-06
CP001322_4981(CP001322|pid:none) Desulfatibacillum alkenivorans ... 57 1e-06
CP000386_2730(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 57 1e-06
CU207211_2270(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 57 1e-06
CP000702_474(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 57 1e-06
AJ012346_1(AJ012346|pid:none) Listeria monocytogenes internalin ... 57 1e-06
AL939129_118(AL939129|pid:none) Streptomyces coelicolor A3(2) co... 57 1e-06
CP000304_2791(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 57 1e-06
(P25145) RecName: Full=Uncharacterized oxidoreductase Lmo0432; ... 57 1e-06
CP000463_608(CP000463|pid:none) Rhodopseudomonas palustris BisA5... 57 1e-06
AX763268_1(AX763268|pid:none) Sequence 85 from Patent WO03040291... 57 1e-06
CP000316_3525(CP000316|pid:none) Polaromonas sp. JS666, complete... 57 1e-06
AM181176_3645(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 57 1e-06
CP001635_2725(CP001635|pid:none) Variovorax paradoxus S110 chrom... 57 1e-06
AX065111_1(AX065111|pid:none) Sequence 237 from Patent WO0100844... 57 1e-06
CP000738_3098(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 57 1e-06
CP000857_1953(CP000857|pid:none) Salmonella enterica subsp. ente... 57 1e-06
CP001291_2779(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 57 1e-06
CP000494_1096(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 57 1e-06
CP000521_1910(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 57 1e-06
(Q7TS56) RecName: Full=Carbonyl reductase 4; EC=1.1.1.-... 57 1e-06
>CP000386_2942(CP000386|pid:none) Rubrobacter xylanophilus DSM 9941,
complete genome.
Length = 236
Score = 166 bits (419), Expect = 1e-39
Identities = 92/224 (41%), Positives = 135/224 (60%), Gaps = 3/224 (1%)
Frame = +2
Query: 134 VAEKFAKEGFSVALVSRNKEKLEPFVQTIQKKFGDTGSFAVEMDATNAESVEKGFKEIRS 313
VA +FA+ G++VAL++R ++ LEP I G + AV DA++ SV F +R
Sbjct: 18 VARRFARGGYAVALMARRRQSLEPVRGEIAGAGG--AALAVPADASDPGSVAAAFGRVRE 75
Query: 314 KINGRPIDVLIYNASASFKAVSVEKTDVNDFQNAWKASCLGAFLTSQQVLSEMYGQQNGT 493
++ G P +VL+YNA A F+ + + F W+ +C GAF +++VL M + GT
Sbjct: 76 EL-GDP-EVLVYNAGA-FQPGGILEIPPERFDECWRINCAGAFYAAREVLPAMAEKGRGT 132
Query: 494 IIFTGATASLRGGASFGLFASSKFALRGFAQSLARESYPKGVHVSHVIIDGYVD---INR 664
++ TGATA+ RG A+F A KF LR AQS+ARE P+GVHV+HV+IDG +D +
Sbjct: 133 VLLTGATAAWRGSANFAALAVGKFGLRALAQSMAREFGPRGVHVAHVVIDGQIDTPRVRE 192
Query: 665 DYSSRPKENWIDPDAIASTYFSLYSQDKSAWTHEIDIRPHTEKW 796
Y R + P+AIA TY+ L+SQ AWT E+D+RP E++
Sbjct: 193 RYPGREGHTMLSPEAIAETYWQLHSQPPDAWTLELDLRPSVERF 236
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,120,214,212
Number of extensions: 20073196
Number of successful extensions: 54282
Number of sequences better than 10.0: 3165
Number of HSP's gapped: 53808
Number of HSP's successfully gapped: 3167
Length of query: 289
Length of database: 1,061,185,681
Length adjustment: 127
Effective length of query: 162
Effective length of database: 646,092,785
Effective search space: 104667031170
Effective search space used: 104667031170
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|