NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U04457-1
Contig ID Contig-U04457-1
Contig update 2001. 8.29
Contig sequence 
>Contig-U04457-1 (Contig-U04457-1Q) /CSM_Contig/Contig-U04457-1Q.Seq.d
TTTTTTTTGGGGTGGAGTGTAAAAAAAAAAAAAAATTTTAATTATTTAGT
TAAGTTTTTTTTTTTTTTGTCCTTTGCTTCTGTTGTTTTTTTTTTTTCAC
CCTTTTTTCTTTTTTTTTTTTTTTTCCCAACTTTTGATTTTAAATATCGG
AACCAAATGTATTTTCACCGCTATAGCAAATATATAAAAAGCCATCTTCA
TCTTTATGAGCGTCATATATTGAGGA
Gap no gap
Contig length 226
Chromosome number (1..6, M) 5
Chromosome length 5062330
Start point 4102227
End point 4102454
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 1
Link to clone list U04457
List of clone(s) 

est1=SSA726F,1,227
Translated Amino Acid sequence 
FFLGWSVKKKKNFNYLVKFFFFLSFASVVFFFSPFFLFFFFFPTFDFKYRNQMYFHRYSK
YIKSHLHLYERHILR
Translated Amino Acid sequence (All Frames) 
Frame A:
FFLGWSVKKKKNFNYLVKFFFFLSFASVVFFFSPFFLFFFFFPTFDFKYRNQMYFHRYSK
YIKSHLHLYERHILR


Frame B:
ffwggv*kkkkilii*lsffffcpllllffffhpfffffffsqllilnigtkciftaian
i*kaififmsviy*g


Frame C:
ffgveckkkkkf*lfs*vffffvlcfccfffftlfsfffffpnf*f*isepnvfspl*qi
ykkpsssl*asyie
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U04457-1 (Contig-U04457-1Q)
/CSM_Contig/Contig-U04457-1Q.Seq.d
         (226 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U04457-1 (Contig-U04457-1Q) /CSM_Contig/Conti...   200  4e-52
Contig-U14442-1 (Contig-U14442-1Q) /CSM_Contig/Conti...    40  0.001
Contig-U06663-1 (Contig-U06663-1Q) /CSM_Contig/Conti...    40  0.001
Contig-U12586-1 (Contig-U12586-1Q) /CSM_Contig/Conti...    32  0.24
Contig-U11931-1 (Contig-U11931-1Q) /CSM_Contig/Conti...    32  0.24
Contig-U11064-1 (Contig-U11064-1Q) /CSM_Contig/Conti...    32  0.24
Contig-U09085-1 (Contig-U09085-1Q) /CSM_Contig/Conti...    32  0.24
Contig-U06667-1 (Contig-U06667-1Q) /CSM_Contig/Conti...    32  0.24
Contig-U04954-1 (Contig-U04954-1Q) /CSM_Contig/Conti...    32  0.24

>Contig-U04457-1 (Contig-U04457-1Q) /CSM_Contig/Contig-U04457-1Q.Seq.d
          Length = 226

 Score =  200 bits (101), Expect = 4e-52
 Identities = 101/101 (100%)
 Strand = Plus / Plus

                                                                       
Query: 126 cccaacttttgattttaaatatcggaaccaaatgtattttcaccgctatagcaaatatat 185
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 126 cccaacttttgattttaaatatcggaaccaaatgtattttcaccgctatagcaaatatat 185

                                                    
Query: 186 aaaaagccatcttcatctttatgagcgtcatatattgagga 226
           |||||||||||||||||||||||||||||||||||||||||
Sbjct: 186 aaaaagccatcttcatctttatgagcgtcatatattgagga 226


 Score = 40.1 bits (20), Expect = 0.001
 Identities = 20/20 (100%)
 Strand = Plus / Plus

                              
Query: 1  ttttttttggggtggagtgt 20
          ||||||||||||||||||||
Sbjct: 1  ttttttttggggtggagtgt 20


 Score = 38.2 bits (19), Expect = 0.004
 Identities = 19/19 (100%)
 Strand = Plus / Plus

                             
Query: 36 ttttaattatttagttaag 54
          |||||||||||||||||||
Sbjct: 36 ttttaattatttagttaag 54


>Contig-U14442-1 (Contig-U14442-1Q) /CSM_Contig/Contig-U14442-1Q.Seq.d
          Length = 791

 Score = 40.1 bits (20), Expect = 0.001
 Identities = 47/56 (83%)
 Strand = Plus / Minus

                                                                   
Query: 152 accaaatgtattttcaccgctatagcaaatatataaaaagccatcttcatctttat 207
           |||||| ||||||||||| || ||   ||| |||||||| ||||||||||| ||||
Sbjct: 483 accaaaagtattttcaccactgtaagtaatgtataaaaatccatcttcatccttat 428


>Contig-U06663-1 (Contig-U06663-1Q) /CSM_Contig/Contig-U06663-1Q.Seq.d
          Length = 509

 Score = 40.1 bits (20), Expect = 0.001
 Identities = 47/56 (83%)
 Strand = Plus / Minus

                                                                   
Query: 152 accaaatgtattttcaccgctatagcaaatatataaaaagccatcttcatctttat 207
           |||||| ||||||||||| || ||   ||| |||||||| ||||||||||| ||||
Sbjct: 320 accaaaagtattttcaccactgtaagtaatgtataaaaatccatcttcatccttat 265


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 2863
Number of Sequences: 6905
Number of extensions: 2863
Number of successful extensions: 1032
Number of sequences better than 10.0: 78
length of query: 226
length of database: 5,674,871
effective HSP length: 15
effective length of query: 211
effective length of database: 5,571,296
effective search space: 1175543456
effective search space used: 1175543456
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2009. 6.21
Homology vs DNA 
Query= Contig-U04457-1 (Contig-U04457-1Q) /CSM_Contig/Contig-U04457-1Q.Seq.d
         (226 letters)

Database: ddbj_A
           102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU072736) Dictyostelium discoideum slug cDNA, clone SSA726.      200   1e-53  3
(EC819766) SME00006936 esmbsro2 Sawyeria marylandensis cDNA,...    50   4e-05  2
(EX925756) lb33c11.g1 Cycas ovule - normalized (NYBG) Cycas ...    48   1e-04  2
(EX808787) hz55a10.b1 Cycas ovule (NYBG) Cycas rumphii cDNA ...    48   1e-04  2
(CB091944) he98d04.g1 Cycad Leaf Library (NYBG) Cycas rumphi...    48   1e-04  2
(CB090596) gy77e12.g1 Cycad Leaf Library (NYBG) Cycas rumphi...    48   1e-04  2
(EJ843958) 1093017845470 Global-Ocean-Sampling_GS-30-02-01-1...    42   0.002  2
(EJ851101) 1093017887611 Global-Ocean-Sampling_GS-30-02-01-1...    42   0.002  2
(ER375638) 1093041161324 Global-Ocean-Sampling_GS-34-01-01-1...    54   0.002  1
(GE649161) ginkgochina-3694 Ginkgo mature foliage Library Gi...    52   0.009  1
(AC110464) Rattus norvegicus clone CH230-287M15, *** SEQUENC...    50   0.035  1
(FF147429) Sm20G4 Cell cultures of Saussurea medusa Saussure...    50   0.035  1
(DR538437) WS0276.B21_P05 SS-IL-A-FL-14 Picea sitchensis cDN...    40   0.11   2
(ES258762) WS0378.C21_B03 SS-B-N-22 Picea sitchensis cDNA cl...    40   0.11   2
(EF084104) Picea sitchensis clone WS02713_M09 unknown mRNA.        40   0.11   2
(ES259033) WS0378.C21_N15 SS-B-N-22 Picea sitchensis cDNA cl...    40   0.11   2
(DR537155) WS02751.C21_D14 SS-IL-A-FL-14 Picea sitchensis cD...    40   0.11   2
(GH282236) WS0444.C21_J04 SS-BD-29 Picea sitchensis cDNA clo...    40   0.11   2
(ES256428) WS03729.C21_C06 SS-B-N-22 Picea sitchensis cDNA c...    40   0.11   2
(ES859693) WS02779.CR_B21 SS-IL-A-FL-14 Picea sitchensis cDN...    40   0.11   2
(ES873868) WS02924.CR_G05 SS-IB-A-FL-15 Picea sitchensis cDN...    40   0.11   2
(DR520409) WS0276.BR_P05 SS-IL-A-FL-14 Picea sitchensis cDNA...    40   0.11   2
(GH280363) WS0441.C21_F01 SS-BD-29 Picea sitchensis cDNA clo...    40   0.11   2
(ES860374) WS02781.CR.1_C19 SS-IL-A-FL-14 Picea sitchensis c...    40   0.11   2
(GH280660) WS0441.CR_F01 SS-BD-29 Picea sitchensis cDNA clon...    40   0.11   2
(DR481599) WS0286.BR_K20 SS-IB-A-FL-13 Picea sitchensis cDNA...    40   0.11   2
(DR523159) WS02713.C21_M09 SS-IL-A-FL-14 Picea sitchensis cD...    40   0.11   2
(ES855973) WS02766.CR_J04 SS-IL-A-FL-14 Picea sitchensis cDN...    40   0.11   2
(DR505241) WS02713.CR_M09 SS-IL-A-FL-14 Picea sitchensis cDN...    40   0.11   2
(DR530499) WS02732.C21_L21 SS-IL-A-FL-14 Picea sitchensis cD...    40   0.11   2
(DR512302) WS02732.CR_L21 SS-IL-A-FL-14 Picea sitchensis cDN...    40   0.11   2
(DR487334) WS0286.B21_K20 SS-IB-A-FL-13 Picea sitchensis cDN...    40   0.11   2
(DR536661) WS02749.C21_M22 SS-IL-A-FL-14 Picea sitchensis cD...    40   0.11   2
(EX343504) GQ03101.SP6_D09 GQ031 - Xylem Scrapings (Normaliz...    40   0.11   2
(DR518647) WS02749.CR_M22 SS-IL-A-FL-14 Picea sitchensis cDN...    40   0.11   2
(EC819881) SME00008350 esmbsro2 Sawyeria marylandensis cDNA,...    48   0.14   1
(EJ630717) 1092963383250 Global-Ocean-Sampling_GS-29-01-01-1...    36   0.25   3
(EZ031113) TSA: Acropora millepora SeqIndex5689, mRNA sequence.    46   0.54   1
(DU028472) 9390 Tomato HindIII BAC Library Solanum lycopersi...    46   0.54   1
(DR062916) iq23d09.g1 Cycas ovule (NYBG) Cycas rumphii cDNA ...    46   0.54   1
(DR062354) iq15h03.g1 Cycas ovule (NYBG) Cycas rumphii cDNA ...    46   0.54   1
(DB720342) Solanum lycopersicum cDNA, clone: LEFL2034J11, 5'...    46   0.54   1
(BI209252) EST527292 cTOS Solanum lycopersicum cDNA clone cT...    46   0.54   1
(EY027534) JGI_CAOH2531.fwd CAOH Acropora palmata 15 day old...    46   0.54   1
(EY027533) JGI_CAOH2531.rev CAOH Acropora palmata 15 day old...    46   0.54   1
(AW224716) EST303159 tomato root, plants pre-anthesis, Corne...    46   0.54   1
(AW224715) EST303158 tomato root, plants pre-anthesis, Corne...    46   0.54   1
(AW224714) EST303157 tomato root, plants pre-anthesis, Corne...    46   0.54   1
(DY895673) CeleSEQ15557 Cunninghamella elegans pBluescript (...    36   1.5    2
(DB837276) Nilaparvata lugens mRNA, EST clone:NLTH1031, 5' e...    40   1.5    2
(ER293073) 1092343622680 Global-Ocean-Sampling_GS-34-01-01-1...    32   1.5    2
(EK262710) 1095462186466 Global-Ocean-Sampling_GS-31-01-01-1...    44   2.1    1
(DW097414) CLPY8438.b1_L22.ab1 CLP(XYZ) lettuce perennis Lac...    44   2.1    1
(DW093811) CLPY502.b1_L05.ab1 CLP(XYZ) lettuce perennis Lact...    44   2.1    1
(DW091005) CLPY2272.b1_P16.ab1 CLP(XYZ) lettuce perennis Lac...    44   2.1    1
(FC843175) CBHN2410.fwd CBHN Metridium senile tentacle Metri...    44   2.1    1
(CU104700) Zebrafish DNA sequence from clone CH211-93I7 in l...    32   4.1    2
(DW560047) EST_ssal_rgb2_24466 rgb2 Salmo salar cDNA clone s...    34   4.7    2
(CB085924) hg18e08.g1 Hedyotis centranthoides flower - Stage...    40   5.2    2
(AM866838) Crassostrea gigas EST, 5' end sequence, clone cdn...    32   5.5    2
(AM860312) Crassostrea gigas EST, 5' end sequence, clone cdn...    32   5.5    2
(CK435298) GQ0064.TB_C24 GQ006: Cambium and phloem from matu...    32   5.5    2
(AM862044) Crassostrea gigas EST, 5' end sequence, clone cdn...    32   5.5    2
(AM859984) Crassostrea gigas EST, 5' end sequence, clone cdn...    32   5.5    2
(AM865864) Crassostrea gigas EST, 5' end sequence, clone cdn...    32   5.6    2
(AM853720) Crassostrea gigas EST, 5' end sequence, clone cDN...    32   5.6    2
(DT335797) JBW035D04.b_026.abi Pineapple week 1-4 nematode-i...    32   5.7    2
(BX815108) Arabidopsis thaliana Full-length cDNA Complete se...    42   8.4    1
(EJ405456) 1093012090930 Global-Ocean-Sampling_GS-28-01-01-1...    42   8.4    1
(EE265303) GRAA-aaa37e11.g1 Globodera_rostochiensis_EST Glob...    42   8.4    1
(EE265302) GRAA-aaa37e11.b1 Globodera_rostochiensis_EST Glob...    42   8.4    1
(FK759483) av02078b12r1.1 Symbiotic sea anemone (Anemonia vi...    42   8.4    1
(FK758489) av01028a18r1.1 Symbiotic sea anemone (Anemonia vi...    42   8.4    1
(FK751904) av02108b22r1.1 Symbiotic sea anemone (Anemonia vi...    42   8.4    1
(FK750287) av02092i15r1.1 Symbiotic sea anemone (Anemonia vi...    42   8.4    1
(FK745283) av02120i24r1.1 Symbiotic sea anemone (Anemonia vi...    42   8.4    1
(FK742118) av01024i20r1.1 Symbiotic sea anemone (Anemonia vi...    42   8.4    1
(FK726002) av01029f15r1.1 Symbiotic sea anemone (Anemonia vi...    42   8.4    1
(CP000814) Campylobacter jejuni subsp. jejuni 81116, complet...    42   8.4    1

>(AU072736) Dictyostelium discoideum slug cDNA, clone SSA726.
          Length = 227

 Score =  200 bits (101), Expect(3) = 1e-53
 Identities = 101/101 (100%)
 Strand = Plus / Plus


Query: 126 cccaacttttgattttaaatatcggaaccaaatgtattttcaccgctatagcaaatatat 185
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 126 cccaacttttgattttaaatatcggaaccaaatgtattttcaccgctatagcaaatatat 185


Query: 186 aaaaagccatcttcatctttatgagcgtcatatattgagga 226
           |||||||||||||||||||||||||||||||||||||||||
Sbjct: 186 aaaaagccatcttcatctttatgagcgtcatatattgagga 226

 Score = 38.2 bits (19), Expect(3) = 1e-53
 Identities = 19/19 (100%)
 Strand = Plus / Plus


Query: 36 ttttaattatttagttaag 54
          |||||||||||||||||||
Sbjct: 36 ttttaattatttagttaag 54

 Score = 24.3 bits (12), Expect(3) = 1e-53
 Identities = 12/12 (100%)
 Strand = Plus / Plus


Query: 9  ggggtggagtgt 20
          ||||||||||||
Sbjct: 9  ggggtggagtgt 20

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 179,289,644
Number of extensions: 12551828
Number of successful extensions: 3341433
Number of sequences better than 10.0: 80
Length of query: 226
Length of database: 101,790,757,118
Length adjustment: 23
Effective length of query: 203
Effective length of database: 99,442,330,388
Effective search space: 20186793068764
Effective search space used: 20186793068764
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 7.30
Homology vs Protein 
Query= Contig-U04457-1 (Contig-U04457-1Q) /CSM_Contig/Contig-U04457-1Q.Seq.d
         (226 letters)

Database: nrp_A
           3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q86CR8) RecName: Full=Autophagy-related protein 8; AltName: Ful...    52   7e-06
(Q2GVL1) RecName: Full=Autophagy-related protein 8; AltName: Ful...    52   9e-06
(Q8J282) RecName: Full=Autophagy-related protein 8; AltName: Ful...    51   1e-05
(A6RPU4) RecName: Full=Autophagy-related protein 8; AltName: Ful...    51   1e-05
(Q5B2U9) RecName: Full=Autophagy-related protein 8; AltName: Ful...    51   1e-05
(A7KAL9) RecName: Full=Autophagy-related protein 8; AltName: Ful...    51   1e-05
(A1CQS1) RecName: Full=Autophagy-related protein 8; AltName: Ful...    51   1e-05
(Q51MW4) RecName: Full=Autophagy-related protein 8; AltName: Ful...    51   1e-05
(Q8WZY7) RecName: Full=Autophagy-related protein 8; AltName: Ful...    51   1e-05
EU430269_1(EU430269|pid:none) Gibberella zeae strain ZF2021 micr...    51   1e-05
FM992688_532(FM992688|pid:none) Candida dubliniensis CD36 chromo...    51   1e-05
DQ122902_1(DQ122902|pid:none) Chlamydomonas incerta microtubule-...    51   1e-05
(Q1E4K5) RecName: Full=Autophagy-related protein 8; AltName: Ful...    50   2e-05
AY085349_1(AY085349|pid:none) Arabidopsis thaliana clone 14759 m...    50   2e-05
(Q8LEM4) RecName: Full=Autophagy-related protein 8a; AltName: Fu...    50   2e-05
(P0C075) RecName: Full=Autophagy-related protein 8; AltName: Ful...    50   2e-05
CP001334_206(CP001334|pid:none) Micromonas sp. RCC299 chromosome...    50   2e-05
CR954201_557(CR954201|pid:none) Ostreococcus tauri strain OTTH05...    50   2e-05
(A3GFU8) RecName: Full=Autophagy-related protein 8; AltName: Ful...    50   3e-05
(Q4P2U6) RecName: Full=Autophagy-related protein 8; AltName: Ful...    50   3e-05
(Q5KN30) RecName: Full=Autophagy-related protein 8; AltName: Ful...    49   6e-05
(Q9XEB5) RecName: Full=Autophagy-related protein 8b; AltName: Fu...    49   6e-05
(Q8NJJ4) RecName: Full=Autophagy-related protein 8; AltName: Ful...    49   6e-05
(Q9SL04) RecName: Full=Autophagy-related protein 8d; AltName: Fu...    49   6e-05
EF148151_1(EF148151|pid:none) Populus trichocarpa clone WS0128_B...    49   6e-05
(Q6CMF8) RecName: Full=Autophagy-related protein 8; AltName: Ful...    49   7e-05
EU477413_1(EU477413|pid:none) Moniliophthora perniciosa autophag...    48   9e-05
(P87068) RecName: Full=Autophagy-related protein 8; AltName: Ful...    48   9e-05
(O94272) RecName: Full=Autophagy-related protein 8; AltName: Ful...    48   9e-05
U93506_1(U93506|pid:none) Laccaria bicolor symbiosis-related pro...    48   9e-05
AY191782_1(AY191782|pid:none) Branchiostoma belcheri hypothetica...    48   9e-05
AJ489614_1(AJ489614|pid:none) Cicer arietinum mRNA for microtubu...    48   1e-04
AC138087_29(AC138087|pid:none) Medicago truncatula clone mth2-22...    48   1e-04
EF575989_1(EF575989|pid:none) Oryza sativa (indica cultivar-grou...    48   1e-04
AJ417518_1(AJ417518|pid:none) Oryza sativa partial mRNA for puta...    48   1e-04
(Q8S927) RecName: Full=Autophagy-related protein 8c; AltName: Fu...    48   1e-04
AC004392_23(AC004392|pid:none) Arabidopsis thaliana chromosome 1...    48   1e-04
AY311346_1(AY311346|pid:none) Gossypium hirsutum microtubule-ass...    48   1e-04
(Q8S926) RecName: Full=Autophagy-related protein 8e; AltName: Fu...    47   2e-04
BT060763_1(BT060763|pid:none) Zea mays full-length cDNA clone ZM...    47   2e-04
(Q6FXR8) RecName: Full=Autophagy-related protein 8; AltName: Ful...    47   3e-04
AB453310_1(AB453310|pid:none) Glycine max GmATG8d mRNA, complete...    46   4e-04
EU958533_1(EU958533|pid:none) Zea mays clone 1700855 unknown mRNA.     46   4e-04
(A2YS06) RecName: Full=Autophagy-related protein 8C; AltName: Fu...    46   4e-04
(A2XXR7) RecName: Full=Autophagy-related protein 8B; AltName: Fu...    46   4e-04
BT065336_1(BT065336|pid:none) Zea mays full-length cDNA clone ZM...    46   4e-04
EU971810_1(EU971810|pid:none) Zea mays clone 370920 autophagy-re...    46   4e-04
EF145014_1(EF145014|pid:none) Populus trichocarpa clone WS0111_I...    46   4e-04
EU935007_1(EU935007|pid:none) Acanthamoeba castellanii autophagy...    45   6e-04
DQ768299_1(DQ768299|pid:none) Trypanosoma cruzi Atg8-like protei...    45   0.001
AF077046_1(AF077046|pid:none) Homo sapiens ganglioside expressio...    44   0.001
BT075345_1(BT075345|pid:none) Osmerus mordax clone omor-eva-007-...    44   0.001
(Q8H715) RecName: Full=Autophagy-related protein 8; AltName: Ful...    44   0.001
EF148462_1(EF148462|pid:none) Populus trichocarpa x Populus delt...    44   0.001
DQ215678_1(DQ215678|pid:none) Taeniopygia guttata clone 0061P000...    44   0.001
(P60519) RecName: Full=Gamma-aminobutyric acid receptor-associat...    44   0.001
DQ215684_1(DQ215684|pid:none) Taeniopygia guttata clone 0058P001...    44   0.001
BC106474_1(BC106474|pid:none) Xenopus laevis hypothetical protei...    44   0.001
AK002596_1(AK002596|pid:none) Mus musculus adult male kidney cDN...    44   0.001
BT043942_1(BT043942|pid:none) Salmo salar clone HM4_2381 GABARAP...    44   0.001
(Q9LRP7) RecName: Full=Autophagy-related protein 8i; AltName: Fu...    44   0.002
AY398351_1(AY398351|pid:none) Danio rerio clone RZ145A3D05 GABA(...    43   0.004
BT048217_1(BT048217|pid:none) Salmo salar clone ssal-rgb2-637-38...    42   0.005
(Q6H6P0) RecName: Full=Putative autophagy-related protein 8E; Al...    42   0.009
AP008217_1(AP008217|pid:none) Oryza sativa (japonica cultivar-gr...    42   0.009
(Q2RBS4) RecName: Full=Autophagy-related protein 8D; AltName: Fu...    42   0.009
(Q8S925) RecName: Full=Autophagy-related protein 8h; AltName: Fu...    41   0.012
DQ445535_1(DQ445535|pid:none) Graphocephala atropunctata isolate...    40   0.020
BT073932_1(BT073932|pid:none) Oncorhynchus mykiss clone omyk-evo...    40   0.034
DQ217070_1(DQ217070|pid:none) Taeniopygia guttata clone 0058P003...    39   0.044
FN357697_17(FN357697|pid:none) Schistosoma mansoni genome sequen...    39   0.058
AJ719776_1(AJ719776|pid:none) Gallus gallus mRNA for hypothetica...    39   0.058
BC045759_1(BC045759|pid:none) Homo sapiens microtubule-associate...    39   0.058
(Q9GZQ8) RecName: Full=Microtubule-associated proteins 1A/1B lig...    39   0.058
AC136840_8(AC136840|pid:none) Medicago truncatula clone mth2-33n...    39   0.075
AC091553_5(AC091553|pid:none) Trypanosoma brucei chromosome 7 cl...    39   0.075
BC064267_1(BC064267|pid:none) Xenopus tropicalis microtubule-ass...    38   0.098
AY206669_1(AY206669|pid:none) Rattus norvegicus map1a/1b light c...    38   0.098
DQ864960_1(DQ864960|pid:none) Pfiesteria piscicida clone Ppi-118...    37   0.17
AB264293_1(AB264293|pid:none) Danio rerio MAP1-LC3A mRNA for mic...    37   0.17
AL118520_1(AL118520|pid:none) Human DNA sequence from clone RP11...    37   0.17
(O41515) RecName: Full=Microtubule-associated proteins 1A/1B lig...    37   0.17
AB264294_1(AB264294|pid:none) Danio rerio MAP1-LC3B mRNA for mic...    37   0.22
BC080488_1(BC080488|pid:none) Xenopus tropicalis map1lc3a protei...    37   0.22
BC043946_1(BC043946|pid:none) Xenopus laevis microtubule-associa...    37   0.22
AK340444_1(AK340444|pid:none) Acyrthosiphon pisum ACYPI004701 mR...    37   0.29
AB461861_1(AB461861|pid:none) Thunnus orientalis MAP1-LC3B mRNA ...    36   0.49
AB461862_1(AB461862|pid:none) Seriola quinqueradiata MAP1-LC3B m...    36   0.49
AB264295_1(AB264295|pid:none) Danio rerio MAP1-LC3C mRNA for mic...    36   0.49
BC123362_1(BC123362|pid:none) Xenopus laevis hypothetical protei...    36   0.49
EZ048863_1(EZ048863|pid:none) TSA: Stomoxys calcitrans SC-4-40-1...    36   0.49
AY232215_1(AY232215|pid:none) Drosophila yakuba clone yak-ad_CG1...    35   0.64
BC056047_1(BC056047|pid:none) Xenopus laevis hypothetical protei...    35   0.64
AM494959_119(AM494959|pid:none) Leishmania braziliensis chromoso...    35   0.64
(A6NCE7) RecName: Full=Microtubule-associated proteins 1A/1B lig...    35   0.64
BC155037_1(BC155037|pid:none) Xenopus tropicalis microtubule-ass...    35   0.64
AE014298_1550(AE014298|pid:none) Drosophila melanogaster chromos...    35   0.64
CT005261_128(CT005261|pid:none) Leishmania major strain Friedlin...    35   0.64
AC159429_47(AC159429|pid:none) Trypanosoma brucei chromosome 7 c...    35   0.83
(Q9BXW4) RecName: Full=Microtubule-associated proteins 1A/1B lig...    35   0.83
DQ115351_1(DQ115351|pid:none) Caenorhabditis remanei GABA(A) rec...    35   1.1
BT082173_1(BT082173|pid:none) Anoplopoma fimbria clone afim-evh-...    34   1.4
BT077149_1(BT077149|pid:none) Caligus rogercresseyi clone crog-e...    34   1.4
AM910988_40(AM910988|pid:none) Plasmodium knowlesi strain H chro...    34   1.4
BT077123_1(BT077123|pid:none) Caligus rogercresseyi clone crog-e...    34   1.4
BT073187_1(BT073187|pid:none) Oncorhynchus mykiss clone omyk-evn...    34   1.9
EU441470_1(EU441470|pid:none) Xenopus borealis clone Map1lc3a.b ...    34   1.9
CR940348_624(CR940348|pid:none) Theileria annulata strain Ankara...    34   1.9
BT056624_1(BT056624|pid:none) Salmo salar clone ssal-eve-526-218...    34   1.9
BT073231_1(BT073231|pid:none) Oncorhynchus mykiss clone omyk-evn...    34   1.9
BT080304_1(BT080304|pid:none) Caligus clemensi clone ccle-evs-50...    34   1.9
BT046413_1(BT046413|pid:none) Salmo salar clone ssal-evd-004-015...    34   1.9
BT073163_1(BT073163|pid:none) Oncorhynchus mykiss clone omyk-evn...    34   1.9
BT077486_1(BT077486|pid:none) Lepeophtheirus salmonis Pacific fo...    34   1.9
AY190697_1(AY190697|pid:none) Pagrus major gaba receptor protein...    33   2.4
AY894115_1(AY894115|pid:none) Synthetic construct Homo sapiens c...    33   2.4
AY117146_1(AY117146|pid:none) Bos taurus cell-line MDBK gamma-am...    33   4.1
FN357544_31(FN357544|pid:none) Schistosoma mansoni genome sequen...    33   4.1
BT046939_1(BT046939|pid:none) Salmo salar clone ssal-evd-528-161...    32   5.4
BT047825_1(BT047825|pid:none) Salmo salar clone ssal-eve-533-328...    32   5.4
FJ222244_1(FJ222244|pid:none) Gillichthys mirabilis GABA(A) rece...    32   5.4
BT043696_1(BT043696|pid:none) Salmo salar clone HM5_2203 GABA(A)...    32   5.4
BT057079_1(BT057079|pid:none) Salmo salar clone ssal-eve-558-345...    32   7.0
AK312205_1(AK312205|pid:none) Homo sapiens cDNA, FLJ92494, highl...    32   7.0
AE014297_2486(AE014297|pid:none) Drosophila melanogaster chromos...    32   7.0
AK002879_1(AK002879|pid:none) Mus musculus adult male kidney cDN...    32   7.0
BT079438_1(BT079438|pid:none) Esox lucius clone eluc-evq-540-058...    32   7.0
AL050182_1(AL050182|pid:none) Homo sapiens mRNA; cDNA DKFZp586A1...    32   7.0
BC068621_1(BC068621|pid:none) Xenopus laevis hypothetical protei...    32   7.0
AJ297742_1(AJ297742|pid:none) Bos taurus partial mRNA for GABA-A...    32   7.0
BT073647_1(BT073647|pid:none) Oncorhynchus mykiss clone omyk-evn...    32   7.0
BT075103_1(BT075103|pid:none) Osmerus mordax clone omor-eva-508-...    32   7.0
BT046480_1(BT046480|pid:none) Salmo salar clone ssal-eve-577-076...    32   7.0
BC056701_1(BC056701|pid:none) Danio rerio GABA(A) receptor-assoc...    32   7.0
AY461412_1(AY461412|pid:none) Hevea brasiliensis microtubule-ass...    32   9.2
DQ768300_1(DQ768300|pid:none) Trypanosoma cruzi Atg8-like protei...    32   9.2
AE014185_191(AE014185|pid:none) Plasmodium falciparum 3D7 chromo...    32   9.2

>(Q86CR8) RecName: Full=Autophagy-related protein 8; AltName:
           Full=Autophagy-related ubiquitin-like modifier atg8;
           Flags: Precursor;  &AY191015_1(AY191015|pid:none)
          Length = 122

 Score = 52.0 bits (123), Expect = 7e-06
 Identities = 22/28 (78%), Positives = 25/28 (89%)
 Frame = -1

Query: 226 SSIYDAHKDEDGFLYICYSGENTFGSDI 143
           S IY+ +KDEDGFLYI YSGENTFGSD+
Sbjct: 95  SQIYERYKDEDGFLYITYSGENTFGSDL 122

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 181,283,414
Number of extensions: 2024154
Number of successful extensions: 3222
Number of sequences better than 10.0: 137
Number of HSP's gapped: 3222
Number of HSP's successfully gapped: 137
Length of query: 75
Length of database: 1,061,185,681
Length adjustment: 46
Effective length of query: 29
Effective length of database: 910,837,073
Effective search space: 26414275117
Effective search space used: 26414275117
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 27 (15.0 bits)
PSORT 

 psg: 0.69  gvh: 0.57  alm: 0.25  top: 0.43  tms: 0.07  mit: 0.32  mip: 0.00
 nuc: 0.04  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 1.00  tyr: 0.31  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 1.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 0.00 

	 24.0 %: endoplasmic reticulum
	 20.0 %: cytoplasmic
	 16.0 %: Golgi
	 16.0 %: mitochondrial
	 12.0 %: nuclear
	  4.0 %: vacuolar
	  4.0 %: plasma membrane
	  4.0 %: vesicles of secretory system

>> prediction for Contig-U04457-1 is end
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 1
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0