Contig-U04150-1
Contig ID Contig-U04150-1
Contig update 2001. 8.29
Contig sequence
>Contig-U04150-1 (Contig-U04150-1Q) /CSM_Contig/Contig-U04150-1Q.Seq.d
TTCGACCTCGGTACCCTGAACCATTTTCTCGTAAAAATATAATATGTAAT
CCAACTAATCCTACGATTATAAATGGACATAAATAATGTAATGAGAAAAA
TCTATTTAATGTAGGATTATCTACATTAAATCCTCCCCATAACCATATTA
CGATATCTTCTCCAATTACTGGTAATACTGTTACTAGATTTGTAATTACT
GTTGCTGCCCAATAACTCATTTGACCCCAAGGTAATACATAACCTAAAAA
TCCAGTAATAATTAATAATAAAAAAATTACTACTCCACTTACCCATAACA
TTGCATTTGGTTTTTGGTATGATCCAAAATATAAACCTCTTAACATATGG
ATATAAACTACTATAAAGAAGAAAGAAGCTCCATTGGCATGAATATATCT
TAATAACCAGCCATAATCTACTTCTCTTACTAATCTCTCGATACTATTAA
AAGCTAAATCGACATGTGCCGAATAATGCATTGCTAATAATATTCCACTT
ACTAATTGTATAATTAAACAAATTAACGAAAAAAATCCAAAATTCCATAA
ATAACTAATATTTGCGGGTTCTGGATATCTTACGCCTGCTTCATAAATTC
CATTTATTACTACATTTTTTTTAACTAATCTCATACTT

Gap no gap
Contig length 638
Chromosome number (1..6, M) M
Chromosome length 55569
Start point 23486
End point 22869
Strand (PLUS/MINUS) MINUS
Number of clones 2
Number of EST 2
Link to clone list U04150
List of clone(s)

est1=SLG872F,1,639
est2=SLG745Z,323,448
Translated Amino Acid sequence
rprypepfsrkniicnptnptiinghk*CNEKNLFNVGLSTLNPPHNHITISSPITGNTV
TRFVITVAAQ*li*pqgnt*pknpviinnkkittplthniafgfwydpkykplniwi*tt
ikkkeapla*iylnnqp*stsltnlsillkakstcae*ciannipltnciikqineknpk
fhk*lifagsgyltpas*ipfittffltnlil


Translated Amino Acid sequence (All Frames)
Frame A:
fdlgtlnhflvki*yviqlilrl*mdinnvmrkiylm*dylh*ilpitilryllqllvil
lldl*llllpnnsfdpkvihnlkiq**liikklllhlpitlhlvfgmiqninlltygykl
l*rrkklhwheyilitshnlllllisryy*klnrhvpnnalliifhlliv*lnkltkkiq
nsinn*ylrvldilrllhkfhlllhff*lisy


Frame B:
stsvp*tifs*kynm*sn*sydykwt*im**eksi*criiyikssp*pyydifsnyw*yc
y*icnycccpithltpr*yit*kssnn***knyystyp*hciwflv*ski*ts*hmdiny
ykeerssigmnis**paiiyfsy*sldtiks*idmcrimhc**ysty*lyn*tn*rkksk
ip*itnicgfwisyacfinsiyyyiffn*sht


Frame C:
rprypepfsrkniicnptnptiinghk*CNEKNLFNVGLSTLNPPHNHITISSPITGNTV
TRFVITVAAQ*li*pqgnt*pknpviinnkkittplthniafgfwydpkykplniwi*tt
ikkkeapla*iylnnqp*stsltnlsillkakstcae*ciannipltnciikqineknpk
fhk*lifagsgyltpas*ipfittffltnlil


own update 2004. 6. 9
Homology vs CSM-cDNA
Query= Contig-U04150-1 (Contig-U04150-1Q)
/CSM_Contig/Contig-U04150-1Q.Seq.d
(638 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U04150-1 (Contig-U04150-1Q) /CSM_Contig/Conti... 1134 0.0
Contig-U14047-1 (Contig-U14047-1Q) /CSM_Contig/Conti... 36 0.045
Contig-U13609-1 (Contig-U13609-1Q) /CSM_Contig/Conti... 36 0.045
Contig-U12227-1 (Contig-U12227-1Q) /CSM_Contig/Conti... 34 0.18
Contig-U11650-1 (Contig-U11650-1Q) /CSM_Contig/Conti... 34 0.18
Contig-U14400-1 (Contig-U14400-1Q) /CSM_Contig/Conti... 32 0.70
Contig-U14116-1 (Contig-U14116-1Q) /CSM_Contig/Conti... 32 0.70
Contig-U14094-1 (Contig-U14094-1Q) /CSM_Contig/Conti... 32 0.70
Contig-U13906-1 (Contig-U13906-1Q) /CSM_Contig/Conti... 32 0.70
Contig-U13747-1 (Contig-U13747-1Q) /CSM_Contig/Conti... 32 0.70

>Contig-U04150-1 (Contig-U04150-1Q) /CSM_Contig/Contig-U04150-1Q.Seq.d
Length = 638

Score = 1134 bits (572), Expect = 0.0
Identities = 616/638 (96%)
Strand = Plus / Plus


Query: 1 ttcgacctcggtaccctgaaccattttctcgtaaaaatataatatgtaatccaactaatc 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ttcgacctcggtaccctgaaccattttctcgtaaaaatataatatgtaatccaactaatc 60


Query: 61 ctacgattataaatggacataaataatgtaatgagaaaaatctatttaatgtaggattat 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ctacgattataaatggacataaataatgtaatgagaaaaatctatttaatgtaggattat 120


Query: 121 ctacattaaatcctccccataaccatattacgatatcttctccaattactggtaatactg 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ctacattaaatcctccccataaccatattacgatatcttctccaattactggtaatactg 180


Query: 181 ttactagatttgtaattactgttgctgcccaataactcatttgaccccaaggtaatacat 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ttactagatttgtaattactgttgctgcccaataactcatttgaccccaaggtaatacat 240


Query: 241 aacctaaaaatccagtaataattaataatnnnnnnnttactactccacttacccataaca 300
||||||||||||||||||||||||||||| ||||||||||||||||||||||||
Sbjct: 241 aacctaaaaatccagtaataattaataataaaaaaattactactccacttacccataaca 300


Query: 301 ttgcatttggtttttggtatgatccaaaatataaacctcttaacatatggatataaacta 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ttgcatttggtttttggtatgatccaaaatataaacctcttaacatatggatataaacta 360


Query: 361 ctataaagaagaaagaagctccattggcatgaatatatcttaataaccagccataatcta 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 ctataaagaagaaagaagctccattggcatgaatatatcttaataaccagccataatcta 420


Query: 421 cttctcttactaatctctcgatactattaaaagctaaatcgacatgtgccgaataatgca 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 cttctcttactaatctctcgatactattaaaagctaaatcgacatgtgccgaataatgca 480


Query: 481 ttgctaataatattccacttactaattgtataattaaacaaattaacgnnnnnnntccaa 540
|||||||||||||||||||||||||||||||||||||||||||||||| |||||
Sbjct: 481 ttgctaataatattccacttactaattgtataattaaacaaattaacgaaaaaaatccaa 540


Query: 541 aattccataaataactaatatttgcgggttctggatatcttacgcctgcttcataaattc 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 aattccataaataactaatatttgcgggttctggatatcttacgcctgcttcataaattc 600


Query: 601 catttattactacannnnnnnnaactaatctcatactt 638
|||||||||||||| ||||||||||||||||
Sbjct: 601 catttattactacattttttttaactaatctcatactt 638


>Contig-U14047-1 (Contig-U14047-1Q) /CSM_Contig/Contig-U14047-1Q.Seq.d
Length = 223

Score = 36.2 bits (18), Expect = 0.045
Identities = 18/18 (100%)
Strand = Plus / Minus


Query: 33 aaaaatataatatgtaat 50
||||||||||||||||||
Sbjct: 133 aaaaatataatatgtaat 116


>Contig-U13609-1 (Contig-U13609-1Q) /CSM_Contig/Contig-U13609-1Q.Seq.d
Length = 1215

Score = 36.2 bits (18), Expect = 0.045
Identities = 18/18 (100%)
Strand = Plus / Minus


Query: 480 attgctaataatattcca 497
||||||||||||||||||
Sbjct: 57 attgctaataatattcca 40


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 5558
Number of Sequences: 6905
Number of extensions: 5558
Number of successful extensions: 612
Number of sequences better than 10.0: 46
length of query: 638
length of database: 5,674,871
effective HSP length: 16
effective length of query: 622
effective length of database: 5,564,391
effective search space: 3461051202
effective search space used: 3461051202
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 6.14
Homology vs DNA
Query= Contig-U04150-1 (Contig-U04150-1Q) /CSM_Contig/Contig-U04150-1Q.Seq.d
(638 letters)

Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU061984) Dictyostelium discoideum slug cDNA, clone SLG872. 533 0.0 4
(D16466) Dictyostelium discoideum mitochondrial genes for la... 502 0.0 4
(AB000109) Dictyostelium discoideum mitochondrial DNA, compl... 502 0.0 4
(DQ336395) Dictyostelium citrinum mitochondrion, complete ge... 351 0.0 3
(EU275726) Polysphondylium pallidum strain PN500 mitochondri... 137 5e-83 4
(AY700145) Polysphondylium pallidum mitochondrion DNA, compl... 135 2e-76 6
(EU275727) Dictyostelium fasciculatum strain SH3 mitochondri... 113 1e-72 6
(EC761322) PSE00004559 rw_mgpallid Polysphondylium pallidum ... 115 3e-72 5
(AU061949) Dictyostelium discoideum slug cDNA, clone SLG745. 170 4e-38 1
(DL163166) Methods. 68 8e-31 3
(DL163165) Methods. 68 8e-31 3
(DL163164) Methods. 68 8e-31 3
(AX577562) Sequence 532 from Patent WO02081742. 68 8e-31 3
(AX577561) Sequence 531 from Patent WO02081742. 68 8e-31 3
(AX577560) Sequence 530 from Patent WO02081742. 68 8e-31 3
(AF288092) Naegleria gruberi mitochondrial DNA, complete gen... 94 1e-27 5
(U17009) Phytophthora infestans mitochondrion, complete genome. 62 8e-26 5
(AY898628) Phytophthora infestans haplotype IIb mitochondrio... 62 9e-26 5
(AY898627) Phytophthora infestans haplotype IIa mitochondrio... 62 1e-25 5
(EJ315946) 1095403287496 Global-Ocean-Sampling_GS-27-01-01-1... 82 7e-23 3
(EK167584) 1095458059905 Global-Ocean-Sampling_GS-31-01-01-1... 66 4e-22 4
(EK528335) 1095515650813 Global-Ocean-Sampling_GS-32-01-01-1... 74 1e-20 3
(EK210049) 1095460096181 Global-Ocean-Sampling_GS-31-01-01-1... 76 1e-20 4
(ER559328) 1093015735150 Global-Ocean-Sampling_GS-36-01-01-2... 62 1e-20 5
(EJ525936) 1092955185303 Global-Ocean-Sampling_GS-29-01-01-1... 68 2e-20 4
(EK425962) 1095516019486 Global-Ocean-Sampling_GS-31-01-01-1... 66 2e-20 3
(EK187961) 1095460008180 Global-Ocean-Sampling_GS-31-01-01-1... 66 2e-20 2
(AY894835) Phytophthora infestans haplotype Ia mitochondrion... 62 2e-20 4
(EJ560092) 1092959544045 Global-Ocean-Sampling_GS-29-01-01-1... 68 2e-20 4
(DQ832718) Phytophthora ramorum mitochondrion, complete genome. 60 4e-20 5
(EU427470) Phytophthora ramorum strain CBS 101553 mitochondr... 60 4e-20 5
(ER483114) 1093015279557 Global-Ocean-Sampling_GS-35-01-01-1... 74 6e-20 3
(ER424308) 1092963737872 Global-Ocean-Sampling_GS-35-01-01-1... 74 7e-20 3
(EK438195) 1095521143224 Global-Ocean-Sampling_GS-31-01-01-1... 74 7e-19 3
(ER434702) 1092963792701 Global-Ocean-Sampling_GS-35-01-01-1... 58 1e-18 5
(EK246593) 1095460260130 Global-Ocean-Sampling_GS-31-01-01-1... 82 5e-18 3
(EJ094119) 1095460246153 Global-Ocean-Sampling_GS-26-01-01-1... 76 6e-18 4
(AY534144) Saprolegnia ferax strain ATCC 36051 mitochondion,... 60 8e-18 4
(AF069626) Hepatocystis sp. from Ethiopia cytochrome b (cytb... 103 8e-18 1
(EJ111885) 1092343157962 Global-Ocean-Sampling_GS-27-01-01-1... 66 1e-17 3
(AY772389) Agrocybe chaxingu strain SM 960903 apocytochrome ... 52 1e-17 4
(EK256569) 1095462013115 Global-Ocean-Sampling_GS-31-01-01-1... 64 3e-17 3
(EK259577) 1095462099074 Global-Ocean-Sampling_GS-31-01-01-1... 60 1e-16 3
(ER320791) 1092344177809 Global-Ocean-Sampling_GS-34-01-01-1... 70 2e-16 2
(AY376125) Hyaloperonospora parasitica clone 72T-2F2 sequenc... 52 3e-16 3
(EJ968228) 1093022060551 Global-Ocean-Sampling_GS-30-02-01-1... 58 5e-16 3
(AM494475) Orientia tsutsugamushi Boryong complete genome. 80 8e-16 2
(AP008981) Orientia tsutsugamushi str. Ikeda DNA, complete g... 80 8e-16 2
(Y18476) Trichophyton rubrum mitochondrial cytb gene and NAD... 62 9e-16 4
(EK256542) 1095462013085 Global-Ocean-Sampling_GS-31-01-01-1... 68 3e-15 2
(EJ396888) 1093012005213 Global-Ocean-Sampling_GS-28-01-01-1... 58 4e-15 4
(EJ976968) 1093022126008 Global-Ocean-Sampling_GS-30-02-01-1... 82 4e-15 2
(EK573943) 1095521101030 Global-Ocean-Sampling_GS-32-01-01-1... 48 7e-15 4
(ER393604) 1095339006316 Global-Ocean-Sampling_GS-34-01-01-1... 58 7e-15 3
(FJ168565) Hepatocystis sp. ex Pteropus hypomelanus mitochon... 94 8e-15 1
(DQ396531) Hepatocystis sp. PP1 cytochrome b-like gene, comp... 94 8e-15 1
(EJ942851) 1093018896883 Global-Ocean-Sampling_GS-30-02-01-1... 82 1e-14 2
(CV590591) L_AI-aaa12d12.g1 Hc7B_Y Ajellomyces capsulatus cD... 44 2e-14 4
(DQ832717) Phytophthora sojae mitochondrion, complete genome. 54 2e-14 5
(EJ751914) 1092963041576 Global-Ocean-Sampling_GS-30-02-01-1... 66 2e-14 3
(EK387051) 1095469487416 Global-Ocean-Sampling_GS-31-01-01-1... 62 3e-14 3
(EJ512158) 1095407104063 Global-Ocean-Sampling_GS-28-01-01-1... 74 4e-14 2
(EK254073) 1095462001723 Global-Ocean-Sampling_GS-31-01-01-1... 82 5e-14 2
(DQ887772) Peronospora sparsa cytochrome b gene, partial cds... 50 6e-14 3
(EJ307644) 1095390109328 Global-Ocean-Sampling_GS-27-01-01-1... 58 6e-14 3
(EJ290276) 1095375000733 Global-Ocean-Sampling_GS-27-01-01-1... 58 1e-13 3
(EU810668) Plasmodium sp. WA30 cytochrome b (cytb) gene, par... 90 1e-13 1
(EJ124383) 1092343387715 Global-Ocean-Sampling_GS-27-01-01-1... 90 1e-13 1
(EJ494212) 1095403562448 Global-Ocean-Sampling_GS-28-01-01-1... 58 2e-13 3
(EJ083995) 1095460076234 Global-Ocean-Sampling_GS-26-01-01-1... 74 2e-13 2
(ER594469) 1093016215851 Global-Ocean-Sampling_GS-36-01-01-2... 68 2e-13 2
(EK145975) 1095456022039 Global-Ocean-Sampling_GS-31-01-01-1... 56 2e-13 2
(FE988876) 141467_1780_3243 Pythium ultimum ESTs Pythium ult... 58 2e-13 2
(ER294615) 1092343638182 Global-Ocean-Sampling_GS-34-01-01-1... 50 3e-13 4
(EJ990076) 1093023042126 Global-Ocean-Sampling_GS-30-02-01-1... 66 4e-13 3
(EJ968492) 1093022061903 Global-Ocean-Sampling_GS-30-02-01-1... 66 5e-13 3
(EK586836) 1095522098234 Global-Ocean-Sampling_GS-32-01-01-1... 60 5e-13 3
(EJ660142) 1092955020612 Global-Ocean-Sampling_GS-30-02-01-1... 52 5e-13 3
(EU400409) Hepatocystis sp. MFRC11 clone B cytochrome b (cyt... 88 5e-13 1
(EU400408) Hepatocystis sp. MFRC11 clone A cytochrome b (cyt... 88 5e-13 1
(EJ652202) 1092954004985 Global-Ocean-Sampling_GS-30-02-01-1... 52 5e-13 3
(AF116776) Tetraselmis aff. maculata apocytochrome b (cob) g... 52 5e-13 3
(ER343520) 1092344363775 Global-Ocean-Sampling_GS-34-01-01-1... 82 6e-13 2
(EJ630783) 1092963392058 Global-Ocean-Sampling_GS-29-01-01-1... 66 7e-13 2
(EL774328) PUNAJ01TV Pythium ultimum ESTs Pythium ultimum DA... 58 1e-12 3
(EJ258511) 1095349024475 Global-Ocean-Sampling_GS-27-01-01-1... 58 1e-12 3
(EJ375463) 1092963739611 Global-Ocean-Sampling_GS-28-01-01-1... 56 1e-12 3
(EJ509631) 1095407058367 Global-Ocean-Sampling_GS-28-01-01-1... 58 1e-12 3
(EJ370578) 1092963723099 Global-Ocean-Sampling_GS-28-01-01-1... 58 1e-12 3
(EJ334468) 1092963465660 Global-Ocean-Sampling_GS-28-01-01-1... 66 1e-12 3
(ER438224) 1092963804289 Global-Ocean-Sampling_GS-35-01-01-1... 58 2e-12 3
(AJ277126) Pilayella littoralis complete mitochondrial genome. 64 2e-12 3
(DQ287690) Blastocladiella emersonii mitochondrion, complete... 48 2e-12 4
(EJ391485) 1092963939232 Global-Ocean-Sampling_GS-28-01-01-1... 48 2e-12 4
(EC762322) PSE00007790 rw_mgpallid Polysphondylium pallidum ... 86 2e-12 1
(EK173443) 1095458086554 Global-Ocean-Sampling_GS-31-01-01-1... 54 2e-12 3
(EK374334) 1095469432073 Global-Ocean-Sampling_GS-31-01-01-1... 60 2e-12 2
(AF181617) Trigona hypogea cytochrome b (cytb) gene, partial... 54 3e-12 3
(FF012689) 265998_0820_0252 Pythium ultimum ESTs Pythium ult... 58 3e-12 3
(EJ341238) 1092963517499 Global-Ocean-Sampling_GS-28-01-01-1... 72 3e-12 2
(EJ266016) 1095351012578 Global-Ocean-Sampling_GS-27-01-01-1... 60 4e-12 4
(EK377149) 1095469445502 Global-Ocean-Sampling_GS-31-01-01-1... 50 5e-12 4
(EJ267257) 1095351023550 Global-Ocean-Sampling_GS-27-01-01-1... 54 7e-12 4
(FJ355916) Plasmodium sp. COLL6 cytochrome b (cytb) gene, pa... 84 7e-12 1
(DQ368375) Plasmodium sp. COLL6 cytochrome b (cytb) gene, pa... 84 7e-12 1
(AY714198) Plasmodium sp. AP65 cytochrome b (cytb) gene, par... 84 7e-12 1
(AY714197) Plasmodium sp. AP64 cytochrome b (cytb) gene, par... 84 7e-12 1
(EJ611130) 1092962045442 Global-Ocean-Sampling_GS-29-01-01-1... 66 8e-12 2
(EL776855) PUNBB56TV Pythium ultimum ESTs Pythium ultimum DA... 58 8e-12 2
(Z47547) Chondrus crispus complete mitochondrial genome. 48 9e-12 4
(EJ085434) 1095460097375 Global-Ocean-Sampling_GS-26-01-01-1... 66 1e-11 2
(EK192926) 1095460025956 Global-Ocean-Sampling_GS-31-01-01-1... 66 1e-11 2
(AY905369) Nisitrus vittatus cytochrome b (cytb) gene, parti... 50 2e-11 3
(ER287423) 1092343579701 Global-Ocean-Sampling_GS-34-01-01-1... 62 2e-11 3
(EU254518) Leucocytozoon sp. 2109 cytochrome b (cytb) gene, ... 82 3e-11 1
(AY714202) Plasmodium sp. AP69 cytochrome b (cytb) gene, par... 82 3e-11 1
(EJ271590) 1095353018997 Global-Ocean-Sampling_GS-27-01-01-1... 54 4e-11 2
(EJ915044) 1093018555722 Global-Ocean-Sampling_GS-30-02-01-1... 56 7e-11 3
(EJ873907) 1093018359210 Global-Ocean-Sampling_GS-30-02-01-1... 56 7e-11 3
(AY898665) Megastigmus sp. 1 MAAR-2005 isolate Mnsp1.MAR cyt... 50 7e-11 3
(AF222718) Chrysodidymus synuroideus mitochondrion, complete... 50 7e-11 5
(EK048297) 1092959660768 Global-Ocean-Sampling_GS-31-01-01-1... 56 1e-10 3
(EJ261236) 1095349040490 Global-Ocean-Sampling_GS-27-01-01-1... 74 1e-10 2
(EU810667) Plasmodium sp. WA13 cytochrome b (cytb) gene, par... 80 1e-10 1
(EF179356) Unidentified Haemosporida isolate C272 cytochrome... 80 1e-10 1
(EK144382) 1095456012237 Global-Ocean-Sampling_GS-31-01-01-1... 62 1e-10 2
(AB441298) Siderastrea stellata mitochondrial Cytb gene for ... 54 1e-10 2
(AB441297) Siderastrea radians mitochondrial Cytb gene for c... 54 1e-10 2
(AB441296) Siderastrea siderea mitochondrial Cytb gene for c... 54 1e-10 2
(EJ843611) 1093017844613 Global-Ocean-Sampling_GS-30-02-01-1... 58 1e-10 2
(EK382266) 1095469466412 Global-Ocean-Sampling_GS-31-01-01-1... 70 2e-10 2
(U69723) Nucella canaliculata cytochrome b (cytb) gene, mito... 56 2e-10 3
(U69722) Nucella canaliculata cytochrome b (cytb) gene, mito... 56 2e-10 3
(U02970) Prototheca wickerhamii 263-11 complete mitochondria... 66 3e-10 4
(ER578616) 1093015824402 Global-Ocean-Sampling_GS-36-01-01-2... 50 3e-10 4
(ER434901) 1092963793426 Global-Ocean-Sampling_GS-35-01-01-1... 60 3e-10 3
(EJ233706) 1092404073896 Global-Ocean-Sampling_GS-27-01-01-1... 58 3e-10 4
(ER355759) 1092351101105 Global-Ocean-Sampling_GS-34-01-01-1... 46 3e-10 4
(ER618275) 1093017362810 Global-Ocean-Sampling_GS-36-01-01-2... 60 3e-10 3
(EK113063) 1092963141627 Global-Ocean-Sampling_GS-31-01-01-1... 58 3e-10 3
(AB441325) Turbinaria peltata mitochondrial Cytb gene for cy... 56 5e-10 2
(EJ597003) 1092961095932 Global-Ocean-Sampling_GS-29-01-01-1... 60 6e-10 2
(EJ594535) 1092961069820 Global-Ocean-Sampling_GS-29-01-01-1... 60 6e-10 2
(L16863) Phytophthora megasperma ATP synthase subunit 9 (atp... 50 6e-10 4
(FF051614) 443875_0983_3959 Pythium ultimum ESTs Pythium ult... 54 6e-10 2
(FE971424) 019542_1608_3095 Pythium ultimum ESTs Pythium ult... 54 6e-10 2
(EJ115715) 1092343318746 Global-Ocean-Sampling_GS-27-01-01-1... 58 7e-10 4
(CD868032) AZO2.107N17F001110 AZO2 Triticum aestivum cDNA cl... 60 8e-10 3
(DQ396529) Hepatocystis sp. LB3 cytochrome b-like gene, comp... 74 9e-10 2
(DQ396528) Hepatocystis sp. IZ09 cytochrome b-like gene, com... 74 9e-10 2
(EK412883) 1095505210736 Global-Ocean-Sampling_GS-31-01-01-1... 56 9e-10 3
(EJ896795) 1093018469880 Global-Ocean-Sampling_GS-30-02-01-1... 58 1e-09 3
(EJ580583) 1092960158807 Global-Ocean-Sampling_GS-29-01-01-1... 60 1e-09 2
(EK073721) 1092961014204 Global-Ocean-Sampling_GS-31-01-01-1... 50 1e-09 3
(EJ643821) 1093012177334 Global-Ocean-Sampling_GS-29-01-01-1... 52 1e-09 3
(EK535555) 1095516027892 Global-Ocean-Sampling_GS-32-01-01-1... 48 1e-09 3
(EJ735810) 1092961146163 Global-Ocean-Sampling_GS-30-02-01-1... 44 1e-09 3
(EJ734636) 1092961082515 Global-Ocean-Sampling_GS-30-02-01-1... 44 1e-09 3
(CV590889) L_AI-aaa32b10.g1 Hc7B_Y Ajellomyces capsulatus cD... 44 1e-09 3
(FJ462683) Plasmodium sp. LVCP01Ven cytochrome b (cytb) gene... 76 2e-09 1
(EF032871) Haemoproteus sp. H-SYBOR20 cytochrome b (cytb) ge... 76 2e-09 1
(DQ659591) Plasmodium sp. P56 cytochrome b (cytb) gene, part... 76 2e-09 1
(DQ241535) Plasmodium sp. G28 cytochrome b (cytb) gene, part... 76 2e-09 1
(DQ241530) Plasmodium sp. B23 cytochrome b (cytb) gene, part... 76 2e-09 1
(AF254962) Plasmodium nucleophilum cytochrome b gene, partia... 76 2e-09 1
(AF069613) Haemoproteus columbae from Venezuela cytochrome b... 76 2e-09 1
(EK343067) 1095467075872 Global-Ocean-Sampling_GS-31-01-01-1... 76 2e-09 1
(EJ806414) 1093017461181 Global-Ocean-Sampling_GS-30-02-01-1... 54 2e-09 2
(CV588570) L_AI-aaa20c12.g1 Hc7B_Y Ajellomyces capsulatus cD... 44 2e-09 3
(CV621629) mdv95d05.b2 Hc7B_Y Ajellomyces capsulatus cDNA 3'... 44 2e-09 3
(EU205059) Armigeres subalbatus ASAP ID ACN-0184492 cytochro... 38 2e-09 4
(U12386) Acanthamoeba castellanii mitochondrion, complete ge... 64 2e-09 3
(EJ437401) 1093015287942 Global-Ocean-Sampling_GS-28-01-01-1... 58 2e-09 2
(AY439851) Armigeres subalbatus ASAP ID: 43877 cytochrome b ... 38 2e-09 4
(AI211476) p0e03a1.r1 Aspergillus nidulans 24hr asexual deve... 44 3e-09 4
(CV585713) L_AI-aaa02c06.b1 Hc7B_Y Ajellomyces capsulatus cD... 44 3e-09 3
(CV602858) mdw03b05.b2 Hc7B_Y Ajellomyces capsulatus cDNA 3'... 44 3e-09 3
(DQ643838) Siderastrea radians mitochondrion, complete genome. 54 3e-09 2
(FF049025) 431433_0077_1718 Pythium ultimum ESTs Pythium ult... 50 3e-09 2
(ER481234) 1093015264841 Global-Ocean-Sampling_GS-35-01-01-1... 54 3e-09 3
(EJ091512) 1095460187922 Global-Ocean-Sampling_GS-26-01-01-1... 54 3e-09 3
(EJ916741) 1093018565436 Global-Ocean-Sampling_GS-30-02-01-1... 50 4e-09 4
(CV593236) L_AI-aaa30b05.g1 Hc7B_Y Ajellomyces capsulatus cD... 44 4e-09 3
(DQ368379) Plasmodium sp. GRW14 cytochrome b (cytb) gene, pa... 72 4e-09 2
(EU219392) Plasmodium sp. DURB6 cytochrome b gene, partial c... 72 4e-09 2
(EJ914544) 1093018554204 Global-Ocean-Sampling_GS-30-02-01-1... 50 5e-09 4
(EU810655) Plasmodium sp. WA26 cytochrome b (cytb) gene, par... 72 5e-09 2
(EJ387661) 1092963834407 Global-Ocean-Sampling_GS-28-01-01-1... 50 5e-09 4
(EU254552) Haemoproteus picae haplotype 1534 cytochrome b (c... 62 5e-09 2
(AF287134) Ochromonas danica mitochondrial DNA, complete gen... 50 7e-09 5
(AB441307) Pachyseris speciosa mitochondrial Cytb gene for c... 56 7e-09 2
(EU810669) Plasmodium sp. WA14 cytochrome b (cytb) gene, par... 74 7e-09 1
(EU254528) Hepatocystis sp. MB3 cytochrome b (cytb) gene, pa... 74 7e-09 1
(EU254527) Hepatocystis sp. MB6 cytochrome b (cytb) gene, pa... 74 7e-09 1
(AJ251941) Plasmodium reichenowi complete mitochondrial genome. 74 7e-09 1
(AF069610) Plasmodium reichenowi cytochrome b (cytb) gene, m... 74 7e-09 1
(EK522947) 1095515632096 Global-Ocean-Sampling_GS-32-01-01-1... 74 7e-09 1
(EK022299) 1092955340685 Global-Ocean-Sampling_GS-31-01-01-1... 74 7e-09 1
(EJ156158) 1092344030615 Global-Ocean-Sampling_GS-27-01-01-1... 74 7e-09 1
(EJ491216) 1095403540940 Global-Ocean-Sampling_GS-28-01-01-1... 68 7e-09 2
(EK131391) 1093009678502 Global-Ocean-Sampling_GS-31-01-01-1... 58 8e-09 2
(EJ465470) 1095390204586 Global-Ocean-Sampling_GS-28-01-01-1... 52 8e-09 2
(EJ169647) 1092344078863 Global-Ocean-Sampling_GS-27-01-01-1... 60 9e-09 2
(EK142199) 1095454143207 Global-Ocean-Sampling_GS-31-01-01-1... 68 9e-09 2
(AF465590) Haemoproteus sp. haplotype 42 cytochrome b gene, ... 62 9e-09 2
(CP000409) Rickettsia canadensis str. McKiel, complete genome. 56 9e-09 2
(AF069623) Plasmodium sp. from Gabon cytochrome b (cytb) gen... 62 9e-09 2
(EJ432875) 1093015265833 Global-Ocean-Sampling_GS-28-01-01-1... 42 1e-08 4
(U69720) Nucella lamellosa cytochrome b (cytb) gene, mitocho... 50 1e-08 3
(U69719) Nucella lamellosa cytochrome b (cytb) gene, mitocho... 50 1e-08 3
(EJ091085) 1095460184054 Global-Ocean-Sampling_GS-26-01-01-1... 50 1e-08 3
(AY182007) Monoblepharella sp. JEL15 mitochondrion, complete... 52 2e-08 3
(EU651892) Hemiselmis andersenii strain CCMP 644 mitochondri... 60 2e-08 3
(X87998) Mycena viridimarginata mRNA for cytochrome b (cytbg... 46 2e-08 4
(CD577264) 27_D05_27_043 ESTs from wild-caught Anopheles fun... 48 2e-08 3
(CD577266) 29_E03_29_020 ESTs from wild-caught Anopheles fun... 48 2e-08 3
(EK108251) 1092963073654 Global-Ocean-Sampling_GS-31-01-01-1... 58 2e-08 2
(FM882292) Balanus amphitrite EST, clone 01_D1. 46 2e-08 3
(EU254523) Plasmodium chabaudi strain R16 cytochrome b (cytb... 68 2e-08 2
(EF011167) Plasmodium chabaudi haplotype R16 cytochrome b ge... 68 2e-08 2
(FM882635) Balanus amphitrite EST, clone 05_A7. 46 2e-08 3
(FM882943) Balanus amphitrite EST, clone 08_E1. 46 2e-08 3
(CD577256) 25_F05_25_044 ESTs from wild-caught Anopheles fun... 48 3e-08 3
(ER470450) 1092963951055 Global-Ocean-Sampling_GS-35-01-01-1... 66 3e-08 2
(CD577248) Igor3_H09_Q2_078 ESTs from wild-caught Anopheles ... 48 3e-08 3
(FJ404701) Plasmodium sp. PV12L cytochrome b (cytb) gene, pa... 72 3e-08 1
(EU810748) Haemoproteus sp. WAH19 cytochrome b (cytb) gene, ... 72 3e-08 1
(EU810697) Plasmodium sp. WA10 cytochrome b (cytb) gene, par... 72 3e-08 1
(EU810696) Plasmodium sp. WA9 isolate 27 cytochrome b (cytb)... 72 3e-08 1
(EU810695) Plasmodium sp. WA9 isolate 26 cytochrome b (cytb)... 72 3e-08 1
(EU810694) Plasmodium sp. WA9 isolate 25 cytochrome b (cytb)... 72 3e-08 1
(EU810692) Plasmodium sp. WA9 isolate 23 cytochrome b (cytb)... 72 3e-08 1
(EU810689) Plasmodium sp. WA9 isolate 20 cytochrome b (cytb)... 72 3e-08 1
(EU810687) Plasmodium sp. WA9 isolate 18 cytochrome b (cytb)... 72 3e-08 1
(EU810686) Plasmodium sp. WA9 isolate 17 cytochrome b (cytb)... 72 3e-08 1
(EU810684) Plasmodium sp. WA9 isolate 15 cytochrome b (cytb)... 72 3e-08 1
(EU810678) Plasmodium sp. WA9 isolate 9 cytochrome b (cytb) ... 72 3e-08 1
(EU810675) Plasmodium sp. WA9 isolate 6 cytochrome b (cytb) ... 72 3e-08 1
(EU810673) Plasmodium sp. WA9 isolate 4 cytochrome b (cytb) ... 72 3e-08 1
(EU810672) Plasmodium sp. WA9 isolate 3 cytochrome b (cytb) ... 72 3e-08 1
(EU810671) Plasmodium sp. WA9 isolate 2 cytochrome b (cytb) ... 72 3e-08 1
(EU810670) Plasmodium sp. WA9 isolate 1 cytochrome b (cytb) ... 72 3e-08 1
(EU254529) Plasmodium mexicanum haplotype E1 cytochrome b (c... 72 3e-08 1
(EF079653) Plasmodium mexicanum mitochondrion, complete genome. 72 3e-08 1
(DQ991072) Plasmodium sp. pBLUTI2 cytochrome b gene, partial... 72 3e-08 1
(DQ847264) Plasmodium sp. RFF1 cytochrome b (cytb) gene, par... 72 3e-08 1
(DQ847208) Leucocytozoon sp. BUL3 cytochrome b (cytb) gene, ... 72 3e-08 1
(DQ846860) Plasmodium sp. NV9 cytochrome b gene, partial cds... 72 3e-08 1
(DQ846858) Plasmodium sp. NV7 cytochrome b gene, partial cds... 72 3e-08 1
(DQ846857) Plasmodium sp. NV6 cytochrome b gene, partial cds... 72 3e-08 1
(DQ846856) Plasmodium sp. NV5 cytochrome b gene, partial cds... 72 3e-08 1
(DQ846853) Plasmodium sp. NV2 cytochrome b gene, partial cds... 72 3e-08 1
(DQ846852) Plasmodium sp. NV1 cytochrome b gene, partial cds... 72 3e-08 1
(DQ846851) Plasmodium sp. V1 cytochrome b gene, partial cds;... 72 3e-08 1
(DQ839091) Plasmodium sp. P46 isolate P46.26 cytochrome b (c... 72 3e-08 1
(DQ839090) Plasmodium sp. P46 isolate P46.25 cytochrome b (c... 72 3e-08 1
(DQ839089) Plasmodium sp. P46 isolate P46.24 cytochrome b (c... 72 3e-08 1
(DQ839087) Plasmodium sp. P46 isolate P46.22 cytochrome b (c... 72 3e-08 1
(DQ839086) Plasmodium sp. P46 isolate P46.21 cytochrome b (c... 72 3e-08 1
(DQ839085) Plasmodium sp. P46 isolate P46.20 cytochrome b (c... 72 3e-08 1
(DQ839082) Plasmodium sp. P46 isolate P46.17 cytochrome b (c... 72 3e-08 1
(DQ839079) Plasmodium sp. P46 isolate P46.14 cytochrome b (c... 72 3e-08 1
(DQ839078) Plasmodium sp. P46 isolate P46.13 cytochrome b (c... 72 3e-08 1
(DQ839077) Plasmodium sp. P46 isolate P46.12 cytochrome b (c... 72 3e-08 1
(DQ839075) Plasmodium sp. P46 isolate P46.10 cytochrome b (c... 72 3e-08 1
(DQ839072) Plasmodium sp. P46 isolate P46.7 cytochrome b (cy... 72 3e-08 1
(DQ839071) Plasmodium sp. P46 isolate P46.6 cytochrome b (cy... 72 3e-08 1
(DQ839068) Plasmodium sp. P46 isolate P46.3 cytochrome b (cy... 72 3e-08 1
(DQ839064) Plasmodium sp. P42 isolate P42.1 cytochrome b (cy... 72 3e-08 1
(DQ659584) Plasmodium sp. P46 cytochrome b (cytb) gene, part... 72 3e-08 1
(DQ659582) Plasmodium sp. P42 cytochrome b (cytb) gene, part... 72 3e-08 1
(DQ368392) Plasmodium sp. SYBOR2 cytochrome b (cytb) gene, p... 72 3e-08 1
(DQ177273) Leucocytozoon toddi isolate 180789992 cytochrome ... 72 3e-08 1
(DQ060773) Plasmodium sp. pGRW9 cytochrome b (cytb) gene, pa... 72 3e-08 1
(AY099061) Plasmodium chiricahuae from Sceloporus jarrovi cy... 72 3e-08 1
(AY099060) Plasmodium mexicanum from Sceloporus mexicanum cy... 72 3e-08 1
(AF495574) Haemoproteus sp. isolate SW5 cytochrome b gene, p... 72 3e-08 1
(AB375765) Plasmodium mexicanum mitochondrial cox3, cox1, cy... 72 3e-08 1
(FM882522) Balanus amphitrite EST, clone 03_H10. 46 3e-08 3
(EJ248721) 1095344005068 Global-Ocean-Sampling_GS-27-01-01-1... 66 3e-08 2
(EJ935575) 1093018835915 Global-Ocean-Sampling_GS-30-02-01-1... 58 3e-08 2
(CD577253) 30_C10_30_071 ESTs from wild-caught Anopheles fun... 48 3e-08 3
(D89861) Cyanidioschyzon merolae mitochondrial DNA, complete... 54 3e-08 2
(DQ414649) Plasmodium chabaudi chabaudi strain AS cytochrome... 68 4e-08 2
(DQ414648) Plasmodium chabaudi adami strain 556KA cytochrome... 68 4e-08 2
(DQ414647) Plasmodium chabaudi adami strain 408XZ cytochrome... 68 4e-08 2
(AY099050) Plasmodium chabaudi clone CB cytochrome b gene, p... 68 4e-08 2
(AY898668) Megastigmus wachtli isolate Mwa.GRE cytochrome b ... 60 4e-08 2
(DQ287361) Anopheles funestus cytochrome b (cytb) mRNA, part... 48 4e-08 3
(EF081250) Oscarella carmela mitochondrion, complete genome. 54 4e-08 2
(AB354570) Plasmodium malariae mitochondrial cox3, cox1, cyt... 62 4e-08 3
(EJ988136) 1093023026147 Global-Ocean-Sampling_GS-30-02-01-1... 44 5e-08 4
(AY800112) Plasmodium sp. DAJ-2004 cytochrome c oxidase subu... 62 5e-08 2
(AY182006) Harpochytrium sp. JEL105 mitochondrion, complete ... 58 5e-08 2
(EJ966293) 1093022044196 Global-Ocean-Sampling_GS-30-02-01-1... 44 5e-08 4
(EJ358696) 1092963676765 Global-Ocean-Sampling_GS-28-01-01-1... 52 6e-08 3
(EF153647) Haemoproteus sp. ChH2 cytochrome b (cytb) gene, p... 66 6e-08 2
(AF538053) Monosiga brevicollis mitochondrion, complete genome. 52 7e-08 6
(U55947) Euproctus platycephalus cytochrome b (CYT-b) gene, ... 64 9e-08 2
(CD577254) 47(2)W-14_14_D11_091 ESTs from wild-caught Anophe... 48 9e-08 3
(AB441287) Galaxea fascicularis mitochondrial Cytb gene for ... 52 1e-07 2
(AB441286) Galaxea fascicularis mitochondrial Cytb gene for ... 52 1e-07 2
(AB441327) Porites astreoides mitochondrial Cytb gene for cy... 50 1e-07 2
(AB441290) Euphyllia ancora mitochondrial Cytb gene for cyto... 50 1e-07 2
(AB441288) Euphyllia divisa mitochondrial Cytb gene for cyto... 50 1e-07 2
(EK128038) 1092994801150 Global-Ocean-Sampling_GS-31-01-01-1... 58 1e-07 2
(DQ821201) Euproctus platycephalus isolate E3 cytochrome b (... 64 1e-07 2
(DQ821200) Euproctus platycephalus isolate E1 cytochrome b (... 64 1e-07 2
(AB040640) Rhodotorula philyla mitochondrial cytb gene for c... 70 1e-07 1
(EK237881) 1095460209768 Global-Ocean-Sampling_GS-31-01-01-1... 70 1e-07 1
(EJ501848) 1095403640058 Global-Ocean-Sampling_GS-28-01-01-1... 70 1e-07 1
(EJ272320) 1095353022568 Global-Ocean-Sampling_GS-27-01-01-1... 70 1e-07 1
(FF028759) 340390_0602_3684 Pythium ultimum ESTs Pythium ult... 50 1e-07 2
(EK350873) 1095467937208 Global-Ocean-Sampling_GS-31-01-01-1... 48 1e-07 2
(FF023478) 316414_1301_1763 Pythium ultimum ESTs Pythium ult... 50 1e-07 2
(AY898669) Megastigmus atlanticus isolate Matl.MAR cytochrom... 52 1e-07 2
(EL779437) PUNCU02TVC Pythium ultimum ESTs Pythium ultimum D... 46 1e-07 2
(AY099062) Haemoproteus kopki from Teratoscincus scincus cyt... 62 1e-07 2
(AF014116) Plasmodium chabaudi cytochrome c oxidase subunit ... 68 2e-07 2
(AB379671) Plasmodium chabaudi adami mitochondrial coxIII, c... 68 2e-07 2
(AB379670) Plasmodium chabaudi adami mitochondrial coxIII, c... 68 2e-07 2
(AB379669) Plasmodium chabaudi chabaudi mitochondrial coxIII... 68 2e-07 2
(AB379668) Plasmodium chabaudi chabaudi mitochondrial coxIII... 68 2e-07 2
(AB379667) Plasmodium chabaudi chabaudi mitochondrial coxIII... 68 2e-07 2
(AB379666) Plasmodium chabaudi chabaudi mitochondrial coxIII... 68 2e-07 2
(AB379665) Plasmodium chabaudi chabaudi mitochondrial coxIII... 68 2e-07 2
(AB379664) Plasmodium chabaudi chabaudi mitochondrial coxIII... 68 2e-07 2
(AB379663) Plasmodium chabaudi chabaudi mitochondrial coxIII... 68 2e-07 2
(AF121770) Aspergillus japonicus apocytochrome b (cob) gene,... 46 3e-07 4
(AF063191) Sarcophyton glaucum NADH dehydrogenase subunit 1 ... 44 3e-07 4
(DQ451406) Plasmodium sp. P121 cytochrome b gene, partial cd... 66 3e-07 2
(EF011194) Plasmodium Haemamoeba sp. P121 cytochrome b gene,... 66 3e-07 2
(EK291450) 1095462332073 Global-Ocean-Sampling_GS-31-01-01-1... 50 3e-07 2
(EK380777) 1095469460819 Global-Ocean-Sampling_GS-31-01-01-1... 58 3e-07 2
(AP007176) Aspergillus oryzae RIB40 mitochondrial DNA, compl... 40 4e-07 4
(EK161547) 1095458033628 Global-Ocean-Sampling_GS-31-01-01-1... 52 4e-07 2
(DQ368387) Plasmodium sp. PABY05 cytochrome b (cytb) gene, p... 68 4e-07 1
(DQ241542) Haemoproteus sp. G35 cytochrome b (cytb) gene, pa... 68 4e-07 1
(AF465579) Haemoproteus sp. haplotype 31 cytochrome b gene, ... 68 4e-07 1
(FF017016) 286471_0564_0527 Pythium ultimum ESTs Pythium ult... 58 5e-07 2
(EU237481) Ephydatia muelleri mitochondrion, complete genome. 52 5e-07 2
(EJ790159) 1093017372807 Global-Ocean-Sampling_GS-30-02-01-1... 66 5e-07 2
(EJ586384) 1092961018824 Global-Ocean-Sampling_GS-29-01-01-1... 42 5e-07 3
(AF315721) Aspergillus japonicus apocytochrome b (cob) gene,... 46 5e-07 4
(AB119750) Nesiohelix kanoi mitochondrial ND1, ND4L, cytb ge... 58 5e-07 2
(AF069622) Plasmodium gonderi cytochrome b (cytb) gene, mito... 62 5e-07 2
(U69726) Nucella emarginata cytochrome b (cytb) gene, mitoch... 42 6e-07 3
(U69725) Nucella emarginata cytochrome b (cytb) gene, mitoch... 42 6e-07 3
(CD577263) 26_C04_26_023 ESTs from wild-caught Anopheles fun... 48 6e-07 3
(CD275029) T143B00712F (FHIG:B) Axenic plate culture Paxillu... 54 7e-07 2
(EJ168976) 1092344076394 Global-Ocean-Sampling_GS-27-01-01-1... 44 7e-07 4
(AY733087) Haemoproteus sp. jb2.SEW5141 mitochondrion, compl... 62 7e-07 2
(AY733086) Haemoproteus sp. jb1.JA27 mitochondrion, complete... 62 7e-07 2
(AY570202) Potamopyrgus antipodarum haplotype 23 cytochrome ... 56 8e-07 2
(AY570201) Potamopyrgus antipodarum haplotype 22 cytochrome ... 56 8e-07 2
(CP000107) Ehrlichia canis str. Jake, complete genome. 62 8e-07 11
(EU523756) Uroctonus mordax mitochondrion, complete genome. 58 9e-07 3
(CD577245) 47(2)w-3_03_H03_029 ESTs from wild-caught Anophel... 48 9e-07 3
(BN001180) TPA: Hydra magnipapillata mitochondrial genome, c... 44 1e-06 3
(AF353999) Mesostigma viride mitochondrion, complete genome. 54 1e-06 4
(DV771457) McClintock17_E08.ab1 Homarus EST library project ... 48 1e-06 2
(Z47795) P.subcordiformis mitochondrial atpA, nad3, cob, rps... 48 1e-06 2
(DV774187) McClintock24_G04.ab1 Homarus EST library project ... 48 1e-06 2
(CD577259) 27_F06_27_048 ESTs from wild-caught Anopheles fun... 48 1e-06 3
(ER409370) 1095368008586 Global-Ocean-Sampling_GS-34-01-01-1... 50 1e-06 2
(AF123598) Aspergillus japonicus apocytochrome b (cob) gene,... 46 1e-06 4
(AY916122) Euglossa gorgonensis cytochrome b (cytb) gene, pa... 50 1e-06 2
(AY916121) Euglossa dodsoni cytochrome b (cytb) gene, partia... 50 1e-06 2
(AF110138) Nephroselmis olivacea mitochondrion, complete gen... 54 1e-06 2
(DV773739) McClintock52_C12.ab1 Homarus EST library project ... 48 1e-06 2
(DV772183) McClintock_2_G01.ab1 Homarus EST library project ... 48 1e-06 2
(DV774569) McClintock47_A04.ab1 Homarus EST library project ... 48 1e-06 2
(AY916130) Epidermophyton floccosum mitochondrion, complete ... 48 1e-06 4
(EJ391754) 1092963946334 Global-Ocean-Sampling_GS-28-01-01-1... 56 2e-06 2
(DV772447) McClintock19_B11.ab1 Homarus EST library project ... 48 2e-06 2
(M99416) Plasmodium falciparum mitochondrial cytochrome b an... 66 2e-06 1
(M76611) Plasmodium falciparum mitochondrion, complete genome. 66 2e-06 1
(FJ404706) Plasmodium sp. PV16L cytochrome b (cytb) gene, pa... 66 2e-06 1
(FJ404705) Plasmodium sp. PV16bL cytochrome b (cytb) gene, p... 66 2e-06 1
(FJ404704) Plasmodium sp. PV16aL cytochrome b (cytb) gene, p... 66 2e-06 1
(EU810720) Haemoproteus sp. WAH5 isolate 3 cytochrome b (cyt... 66 2e-06 1
(EU810718) Haemoproteus sp. WAH5 isolate 1 cytochrome b (cyt... 66 2e-06 1
(EU810717) Haemoproteus sp. WAH4 cytochrome b (cytb) gene, p... 66 2e-06 1
(EU810716) Haemoproteus sp. WAH3 cytochrome b (cytb) gene, p... 66 2e-06 1
(EU810715) Haemoproteus sp. WAH2 isolate 3 cytochrome b (cyt... 66 2e-06 1
(EU810714) Haemoproteus sp. WAH2 isolate 2 cytochrome b (cyt... 66 2e-06 1
(EU810713) Haemoproteus sp. WAH2 isolate 1 cytochrome b (cyt... 66 2e-06 1
(EU810712) Haemoproteus sp. WAH1 cytochrome b (cytb) gene, p... 66 2e-06 1
(EU810711) Plasmodium sp. WA15 isolate 12 cytochrome b (cytb... 66 2e-06 1
(EU810710) Plasmodium sp. WA15 isolate 11 cytochrome b (cytb... 66 2e-06 1
(EU810708) Plasmodium sp. WA15 isolate 9 cytochrome b (cytb)... 66 2e-06 1
(EU810706) Plasmodium sp. WA15 isolate 7 cytochrome b (cytb)... 66 2e-06 1
(EU810705) Plasmodium sp. WA15 isolate 6 cytochrome b (cytb)... 66 2e-06 1
(EU810704) Plasmodium sp. WA15 isolate 5 cytochrome b (cytb)... 66 2e-06 1
(EU810700) Plasmodium sp. WA15 isolate 1 cytochrome b (cytb)... 66 2e-06 1
(EU810699) Plasmodium sp. WA34 cytochrome b (cytb) gene, par... 66 2e-06 1
(EU676191) Plasmodium sp. P_FIPAR01 cytochrome b gene, parti... 66 2e-06 1
(EU254526) Hepatocystis sp. LDFB cytochrome b (cytb) gene, p... 66 2e-06 1
(EF607292) Leucocytozoon sp L-BUBT3 cytochrome b gene, parti... 66 2e-06 1
(EF380160) Plasmodium sp. LIN32 cytochrome b (cytb) gene, pa... 66 2e-06 1
(EF179355) Unidentified Haemosporida isolate C289 cytochrome... 66 2e-06 1
(EF079654) Plasmodium floridense mitochondrion, complete gen... 66 2e-06 1
(EF032866) Leucocytozoon sp. lGRUS1 cytochrome b (cytb) gene... 66 2e-06 1
(DQ986496) Plasmodium sp. NV13 cytochrome b gene, partial cd... 66 2e-06 1
(DQ847257) Leucocytozoon sp. GRUS1 cytochrome b (cytb) gene,... 66 2e-06 1
(DQ847256) Leucocytozoon sp. HGR1 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847255) Leucocytozoon sp. BGR2 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847254) Leucocytozoon sp. BGR3 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847253) Leucocytozoon sp. BRG1 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847252) Leucocytozoon sp. CAP2 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847251) Leucocytozoon sp. CAP4 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847250) Leucocytozoon sp. CAP3 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847249) Leucocytozoon sp. CAP1 cytochrome b (cytb) gene, ... 66 2e-06 1
(DQ847196) Haemoproteus sp. REB3 cytochrome b (cytb) gene, p... 66 2e-06 1
(DQ839001) Plasmodium sp. P12 isolate P12.1 cytochrome b (cy... 66 2e-06 1
(DQ676825) Leucocytozoon macleani isolate 25-136 cytochrome ... 66 2e-06 1
(DQ659592) Haemoproteus enucleator haplotype lineage H59 cyt... 66 2e-06 1
(DQ659587) Plasmodium sp. P49 cytochrome b (cytb) gene, part... 66 2e-06 1
(DQ659574) Plasmodium sp. P33 cytochrome b (cytb) gene, part... 66 2e-06 1
(DQ659550) Plasmodium sp. P12 cytochrome b (cytb) gene, part... 66 2e-06 1
(DQ659547) Plasmodium sp. P8 cytochrome b (cytb) gene, parti... 66 2e-06 1
(DQ659546) Plasmodium sp. P7 cytochrome b (cytb) gene, parti... 66 2e-06 1
(DQ642845) Plasmodium falciparum HB3 mitochondrion, complete... 66 2e-06 1
(DQ396530) Hepatocystis sp. MFF3 cytochrome b-like gene, com... 66 2e-06 1
(DQ368388) Plasmodium sp. SFC5 cytochrome b (cytb) gene, par... 66 2e-06 1
(DQ241512) Plasmodium sp. G5 cytochrome b (cytb) gene, parti... 66 2e-06 1
(DQ212192) Haemoproteus sp. C033 cytochrome b (cytb) gene, p... 66 2e-06 1
(DQ212191) Haemoproteus sp. 4018 cytochrome b (cytb) gene, p... 66 2e-06 1
(DQ212190) Haemoproteus sp. LD-2005 cytochrome b (cytb) gene... 66 2e-06 1
(AY910014) Plasmodium falciparum isolate I5 cytochrome b (Cy... 66 2e-06 1
(AY910013) Plasmodium falciparum isolate I4 cytochrome b (Cy... 66 2e-06 1
(AY910012) Plasmodium falciparum isolate I3 cytochrome b (Cy... 66 2e-06 1
(AY762061) Plasmodium sp. DW5422 cytochrome b (cytb) gene, p... 66 2e-06 1
(AY762060) Plasmodium sp. DW5390 cytochrome b (cytb) gene, p... 66 2e-06 1
(AY714201) Plasmodium sp. AP68 cytochrome b (cytb) gene, par... 66 2e-06 1
(AY714199) Plasmodium sp. AP66 cytochrome b (cytb) gene, par... 66 2e-06 1
(AY714189) Haemoproteus sp. AP56 cytochrome b (cytb) gene, p... 66 2e-06 1
(AY714188) Haemoproteus sp. AP55 cytochrome b (cytb) gene, p... 66 2e-06 1
(AY588280) Plasmodium falciparum isolate I2 cytochrome b (cy... 66 2e-06 1
(AY588279) Plasmodium falciparum isolate I1 cytochrome b (cy... 66 2e-06 1
(AY283019) Plasmodium falciparum isolate WR80 mitochondrion,... 66 2e-06 1
(AY283018) Plasmodium falciparum isolate V1S mitochondrion, ... 66 2e-06 1
(AY283017) Plasmodium falciparum isolate TM284 mitochondrion... 66 2e-06 1
(AY283016) Plasmodium falciparum isolate TM191c mitochondrio... 66 2e-06 1
(AY283015) Plasmodium falciparum isolate Tha2-2 mitochondrio... 66 2e-06 1
(AY283014) Plasmodium falciparum isolate Tha2-1 mitochondrio... 66 2e-06 1
(AY283013) Plasmodium falciparum isolate Tha19 mitochondrion... 66 2e-06 1
(AY283012) Plasmodium falciparum isolate Tha18-2 mitochondri... 66 2e-06 1
(AY283011) Plasmodium falciparum isolate Tha18-1 mitochondri... 66 2e-06 1
(AY283010) Plasmodium falciparum isolate Tha17-1 mitochondri... 66 2e-06 1
(AY283009) Plasmodium falciparum isolate Tha16 mitochondrion... 66 2e-06 1
(AY283008) Plasmodium falciparum isolate T2c6 mitochondrion,... 66 2e-06 1
(AY283007) Plasmodium falciparum isolate SLD6 mitochondrion,... 66 2e-06 1
(AY283006) Plasmodium falciparum isolate S35 mitochondrion, ... 66 2e-06 1
(AY283005) Plasmodium falciparum isolate REN mitochondrion, ... 66 2e-06 1
(AY283004) Plasmodium falciparum isolate PNG9-3 mitochondrio... 66 2e-06 1
(AY283003) Plasmodium falciparum isolate PNG9-1 mitochondrio... 66 2e-06 1
(AY283002) Plasmodium falciparum isolate PNG5-1 mitochondrio... 66 2e-06 1
(AY283001) Plasmodium falciparum isolate PNG4 mitochondrion,... 66 2e-06 1
(AY283000) Plasmodium falciparum isolate PNG3 mitochondrion,... 66 2e-06 1
(AY282999) Plasmodium falciparum isolate PNG2 mitochondrion,... 66 2e-06 1
(AY282998) Plasmodium falciparum isolate PNG13 mitochondrion... 66 2e-06 1
(AY282997) Plasmodium falciparum isolate PNG10-1 mitochondri... 66 2e-06 1
(AY282996) Plasmodium falciparum isolate PC49 mitochondrion,... 66 2e-06 1
(AY282995) Plasmodium falciparum isolate PC26 mitochondrion,... 66 2e-06 1
(AY282994) Plasmodium falciparum isolate PC17 mitochondrion,... 66 2e-06 1
(AY282993) Plasmodium falciparum isolate PC15 mitochondrion,... 66 2e-06 1
(AY282992) Plasmodium falciparum isolate PC09 mitochondrion,... 66 2e-06 1
(AY282991) Plasmodium falciparum isolate PAD mitochondrion, ... 66 2e-06 1
(AY282990) Plasmodium falciparum isolate P99-3 mitochondrion... 66 2e-06 1
(AY282989) Plasmodium falciparum isolate P99-1 mitochondrion... 66 2e-06 1
(AY282988) Plasmodium falciparum isolate P98-5 mitochondrion... 66 2e-06 1
(AY282987) Plasmodium falciparum isolate P98-4 mitochondrion... 66 2e-06 1
(AY282986) Plasmodium falciparum isolate P98-18 mitochondrio... 66 2e-06 1
(AY282985) Plasmodium falciparum isolate P98-13 mitochondrio... 66 2e-06 1
(AY282984) Plasmodium falciparum isolate P98-11 mitochondrio... 66 2e-06 1
(AY282983) Plasmodium falciparum isolate P31 mitochondrion, ... 66 2e-06 1
(AY282982) Plasmodium falciparum isolate P13 mitochondrion, ... 66 2e-06 1
(AY282981) Plasmodium falciparum isolate MTs-1 mitochondrion... 66 2e-06 1
(AY282980) Plasmodium falciparum isolate M97 mitochondrion, ... 66 2e-06 1
(AY282979) Plasmodium falciparum isolate M5 mitochondrion, c... 66 2e-06 1
(AY282978) Plasmodium falciparum isolate M24 mitochondrion, ... 66 2e-06 1
(AY282977) Plasmodium falciparum isolate M2 mitochondrion, c... 66 2e-06 1
(AY282976) Plasmodium falciparum isolate M190 mitochondrion,... 66 2e-06 1
(AY282975) Plasmodium falciparum isolate LF4-1 mitochondrion... 66 2e-06 1
(AY282974) Plasmodium falciparum isolate KMVII mitochondrion... 66 2e-06 1
(AY282973) Plasmodium falciparum isolate K39 mitochondrion, ... 66 2e-06 1
(AY282972) Plasmodium falciparum isolate JCK mitochondrion, ... 66 2e-06 1
(AY282971) Plasmodium falciparum isolate JAV mitochondrion, ... 66 2e-06 1
(AY282970) Plasmodium falciparum isolate Indo mitochondrion,... 66 2e-06 1
(AY282969) Plasmodium falciparum isolate ICS mitochondrion, ... 66 2e-06 1
(AY282968) Plasmodium falciparum isolate HZ945 mitochondrion... 66 2e-06 1
(AY282967) Plasmodium falciparum isolate HZ597 mitochondrion... 66 2e-06 1
(AY282966) Plasmodium falciparum isolate HZ529 mitochondrion... 66 2e-06 1
(AY282965) Plasmodium falciparum isolate HZ475 mitochondrion... 66 2e-06 1
(AY282964) Plasmodium falciparum isolate HZ395 mitochondrion... 66 2e-06 1
(AY282963) Plasmodium falciparum isolate HZ357 mitochondrion... 66 2e-06 1
(AY282962) Plasmodium falciparum isolate Hb3 mitochondrion, ... 66 2e-06 1
(AY282961) Plasmodium falciparum isolate Haiti mitochondrion... 66 2e-06 1
(AY282960) Plasmodium falciparum isolate FCB mitochondrion, ... 66 2e-06 1

>(AU061984) Dictyostelium discoideum slug cDNA, clone SLG872.
Length = 639

Score = 533 bits (269), Expect(4) = 0.0
Identities = 269/269 (100%)
Strand = Plus / Plus


Query: 1 ttcgacctcggtaccctgaaccattttctcgtaaaaatataatatgtaatccaactaatc 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ttcgacctcggtaccctgaaccattttctcgtaaaaatataatatgtaatccaactaatc 60


Query: 61 ctacgattataaatggacataaataatgtaatgagaaaaatctatttaatgtaggattat 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ctacgattataaatggacataaataatgtaatgagaaaaatctatttaatgtaggattat 120


Query: 121 ctacattaaatcctccccataaccatattacgatatcttctccaattactggtaatactg 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 ctacattaaatcctccccataaccatattacgatatcttctccaattactggtaatactg 180


Query: 181 ttactagatttgtaattactgttgctgcccaataactcatttgaccccaaggtaatacat 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ttactagatttgtaattactgttgctgcccaataactcatttgaccccaaggtaatacat 240


Query: 241 aacctaaaaatccagtaataattaataat 269
|||||||||||||||||||||||||||||
Sbjct: 241 aacctaaaaatccagtaataattaataat 269

Score = 500 bits (252), Expect(4) = 0.0
Identities = 252/252 (100%)
Strand = Plus / Plus


Query: 277 ttactactccacttacccataacattgcatttggtttttggtatgatccaaaatataaac 336
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 277 ttactactccacttacccataacattgcatttggtttttggtatgatccaaaatataaac 336


Query: 337 ctcttaacatatggatataaactactataaagaagaaagaagctccattggcatgaatat 396
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 337 ctcttaacatatggatataaactactataaagaagaaagaagctccattggcatgaatat 396


Query: 397 atcttaataaccagccataatctacttctcttactaatctctcgatactattaaaagcta 456
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 397 atcttaataaccagccataatctacttctcttactaatctctcgatactattaaaagcta 456


Query: 457 aatcgacatgtgccgaataatgcattgctaataatattccacttactaattgtataatta 516
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 457 aatcgacatgtgccgaataatgcattgctaataatattccacttactaattgtataatta 516


Query: 517 aacaaattaacg 528
||||||||||||
Sbjct: 517 aacaaattaacg 528

Score = 157 bits (79), Expect(4) = 0.0
Identities = 79/79 (100%)
Strand = Plus / Plus


Query: 536 tccaaaattccataaataactaatatttgcgggttctggatatcttacgcctgcttcata 595
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 536 tccaaaattccataaataactaatatttgcgggttctggatatcttacgcctgcttcata 595


Query: 596 aattccatttattactaca 614
|||||||||||||||||||
Sbjct: 596 aattccatttattactaca 614

Score = 32.2 bits (16), Expect(4) = 0.0
Identities = 16/16 (100%)
Strand = Plus / Plus


Query: 623 aactaatctcatactt 638
||||||||||||||||
Sbjct: 623 aactaatctcatactt 638

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 716,728,321
Number of extensions: 41333290
Number of successful extensions: 3433198
Number of sequences better than 10.0: 8251
Length of query: 638
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 614
Effective length of database: 99,340,224,878
Effective search space: 60994898075092
Effective search space used: 60994898075092
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.29
Homology vs Protein
Query= Contig-U04150-1 (Contig-U04150-1Q) /CSM_Contig/Contig-U04150-1Q.Seq.d
(638 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

EU275726_19(EU275726|pid:none) Polysphondylium pallidum strain P... 349 4e-95
EU275727_18(EU275727|pid:none) Dictyostelium fasciculatum strain... 344 1e-93
(P48875) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 261 1e-68
AF114794_4(AF114794|pid:none) Porphyra purpurea mitochondrion, c... 256 3e-67
(P48876) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 255 9e-67
CP000107_496(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 254 2e-66
AF288091_28(AF288091|pid:none) Thraustochytrium aureum mitochond... 253 3e-66
AY534144_42(AY534144|pid:none) Saprolegnia ferax strain ATCC 360... 253 3e-66
D58930(D58930) ubiquinol-cytochrome-c reductase (EC 1.10.2.2) cy... 252 6e-66
AF288090_42(AF288090|pid:none) Rhodomonas salina mitochondrial D... 252 7e-66
AE017321_771(AE017321|pid:none) Wolbachia endosymbiont strain TR... 251 1e-65
CP000030_529(CP000030|pid:none) Anaplasma marginale str. St. Mar... 251 2e-65
CP000236_501(CP000236|pid:none) Ehrlichia chaffeensis str. Arkan... 251 2e-65
(Q4UJM4) RecName: Full=Cytochrome b; &CP000053_1009(CP000053|pi... 250 2e-65
DQ859144_1(DQ859144|pid:none) Najas sp. C113 apocytochrome b (co... 250 2e-65
DQ859143_1(DQ859143|pid:none) Najas guadalupensis voucher C1485 ... 250 2e-65
CP001227_285(CP001227|pid:none) Rickettsia peacockii str. Rustic... 250 3e-65
CP000409_304(CP000409|pid:none) Rickettsia canadensis str. McKie... 250 3e-65
AY342361_3(AY342361|pid:none) Emiliania huxleyi mitochondrion, c... 250 3e-65
AF116776_1(AF116776|pid:none) Tetraselmis aff. maculata apocytoc... 250 3e-65
T11931(T11931) ubiquinol-cytochrome-c reductase (EC 1.10.2.2) cy... 250 3e-65
EU651892_3(EU651892|pid:none) Hemiselmis andersenii strain CCMP ... 249 4e-65
CP001612_291(CP001612|pid:none) Rickettsia africae ESF-5, comple... 249 5e-65
CP000766_391(CP000766|pid:none) Rickettsia rickettsii str. Iowa,... 249 5e-65
EF135219_1(EF135219|pid:none) Euphorbia abyssinica voucher Chase... 249 6e-65
CR925677_517(CR925677|pid:none) Ehrlichia ruminantium str. Garde... 248 8e-65
CR767821_524(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 248 8e-65
DQ186202_35(DQ186202|pid:none) Thalassiosira pseudonana mitochon... 248 8e-65
(Q1RIA4) RecName: Full=Cytochrome b; &CP000087_829(CP000087|pid... 248 1e-64
AY894835_9(AY894835|pid:none) Phytophthora infestans haplotype I... 248 1e-64
AF538053_26(AF538053|pid:none) Monosiga brevicollis mitochondrio... 248 1e-64
AP006444_75(AP006444|pid:none) Brassica napus mitochondrial DNA,... 248 1e-64
CP000849_971(CP000849|pid:none) Rickettsia bellii OSU 85-389, co... 248 1e-64
DQ832718_8(DQ832718|pid:none) Phytophthora ramorum mitochondrion... 248 1e-64
(Q37378) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 248 1e-64
(P29757) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 247 2e-64
EF135246_1(EF135246|pid:none) Mesua sp. Coode 7884 apocytochrome... 247 2e-64
CR954200_26(CR954200|pid:none) Ostreococcus tauri mitochondrion,... 247 2e-64
EF135272_1(EF135272|pid:none) Salix reticulata voucher Chase 840... 247 2e-64
DQ916619_1(DQ916619|pid:none) Idiospermum australiense apocytoch... 247 2e-64
EF135181_1(EF135181|pid:none) Abatia parviflora voucher Penningt... 247 2e-64
EF135265_1(EF135265|pid:none) Prockia crucis voucher Alford & Ma... 247 2e-64
EF135263_1(EF135263|pid:none) Poliothyrsis sinensis voucher Borg... 247 2e-64
EF135212_1(EF135212|pid:none) Dovyalis rhamnoides voucher Chase ... 247 2e-64
EF135189_1(EF135189|pid:none) Banara guianensis voucher Penningt... 247 2e-64
EF135274_1(EF135274|pid:none) Scyphostegia borneensis voucher Be... 246 3e-64
DQ859158_1(DQ859158|pid:none) Vallisneria sp. C1139 apocytochrom... 246 3e-64
CP000847_364(CP000847|pid:none) Rickettsia akari str. Hartford, ... 246 3e-64
DQ859132_1(DQ859132|pid:none) Echinodorus cordifolius voucher C1... 246 3e-64
EF135232_1(EF135232|pid:none) Hypericum empetrifolium voucher Ch... 246 4e-64
EF135196_1(EF135196|pid:none) Calophyllum soulattri voucher Chas... 246 5e-64
DQ859136_1(DQ859136|pid:none) Halophila sp. C864 apocytochrome b... 245 7e-64
EF135221_1(EF135221|pid:none) Flacourtia jangomas voucher Chase ... 245 7e-64
EF135284_1(EF135284|pid:none) Vismia sp. Miller et al. 9313 apoc... 245 7e-64
EF135192_1(EF135192|pid:none) Bonnetia stricta voucher Amorim 39... 245 9e-64
DQ859128_1(DQ859128|pid:none) Blyxa aubertii voucher C107 apocyt... 245 9e-64
AF538047_1(AF538047|pid:none) Amoebidium parasiticum mitochondri... 244 1e-63
DQ916710_1(DQ916710|pid:none) Luzula acuminata apocytochrome b (... 244 2e-63
U92011_1(U92011|pid:none) Nicotiana tabacum apocytochrome b (cob... 244 2e-63
DQ859138_1(DQ859138|pid:none) Hydrocharis morsus-ranae voucher C... 243 3e-63
EF463011_22(EF463011|pid:none) Chlorokybus atmophyticus strain S... 243 3e-63
EF135203_1(EF135203|pid:none) Clusia rosea voucher Matthaei Bot.... 243 3e-63
AY863211_20(AY863211|pid:none) Mortierella verticillata mitochon... 243 3e-63
(P26852) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 243 3e-63
M68929_48(M68929|pid:none) Marchantia polymorpha mitochondrion, ... 243 3e-63
AP008981_722(AP008981|pid:none) Orientia tsutsugamushi str. Iked... 243 4e-63
DQ859129_1(DQ859129|pid:none) Caldesia oligococca voucher C246 a... 243 4e-63
AM494475_1397(AM494475|pid:none) Orientia tsutsugamushi Boryong ... 243 4e-63
EF135223_1(EF135223|pid:none) Garcinia hessii voucher Axelrod 45... 242 6e-63
(P09843) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 242 6e-63
DQ365900_7(DQ365900|pid:none) Oltmannsiellopsis viridis mitochon... 242 8e-63
X67736_3(X67736|pid:none) A.thaliana mitochondrial rp15, and cob... 242 8e-63
(Q37395) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 241 1e-62
DQ859125_1(DQ859125|pid:none) Alisma plantago-aquatica voucher C... 241 1e-62
DQ916705_1(DQ916705|pid:none) Carex interior apocytochrome b (co... 241 1e-62
AF353999_20(AF353999|pid:none) Mesostigma viride mitochondrion, ... 241 1e-62
AY818946_1(AY818946|pid:none) Plantago rugelii apocytochrome B (... 241 1e-62
EF135202_1(EF135202|pid:none) Chrysobalanus icaco voucher Wurdac... 241 2e-62
EF135186_1(EF135186|pid:none) Atuna racemosa voucher Chase 2118 ... 241 2e-62
DQ859155_1(DQ859155|pid:none) Thalassia testudinum voucher C856 ... 240 2e-62
AP009384_3500(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 240 2e-62
EF135200_1(EF135200|pid:none) Casearia sylvestris voucher Alford... 239 4e-62
EF135276_1(EF135276|pid:none) Stackhousia minima voucher Molly s... 239 4e-62
EF135239_1(EF135239|pid:none) Lunania parviflora voucher Alford ... 239 4e-62
AY182006_13(AY182006|pid:none) Harpochytrium sp. JEL105 mitochon... 239 5e-62
EF135193_1(EF135193|pid:none) Brexia madagascariensis voucher Wu... 239 5e-62
EF135245_1(EF135245|pid:none) Maytenus senegalensis voucher Coll... 239 5e-62
EF135244_1(EF135244|pid:none) Maytenus arbutifolia voucher Colle... 239 5e-62
CP000319_3073(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 239 6e-62
CP000471_354(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 239 6e-62
EU237490_10(EU237490|pid:none) Xestospongia muta mitochondrion, ... 238 8e-62
(P23134) RecName: Full=Cytochrome b; &CBQFR(S12257;A38814) &CP0... 238 8e-62
EF135218_1(EF135218|pid:none) Euonymus alatus voucher Chase 137 ... 238 8e-62
EF135217_1(EF135217|pid:none) Erythroxylum coca voucher Wurdack ... 238 1e-61
AY500367_28(AY500367|pid:none) Desmarestia viridis mitochondrion... 238 1e-61
FJ376600_1(FJ376600|pid:none) Equisetum arvense apocytochrome b ... 238 1e-61
DQ209279_1(DQ209279|pid:none) Puccinia striiformis f. sp. tritic... 238 1e-61
DQ209278_1(DQ209278|pid:none) Puccinia sorghi cytochrome b (cytb... 238 1e-61
CP000774_2234(CP000774|pid:none) Parvibaculum lavamentivorans DS... 237 2e-61
DQ209277_1(DQ209277|pid:none) Puccinia recondita f. sp. secalis ... 237 2e-61
AJ344328_28(AJ344328|pid:none) Laminaria digitata complete mitoc... 237 2e-61
DQ209273_1(DQ209273|pid:none) Puccinia graminis f. sp. tritici c... 237 2e-61
EF547208_1(EF547208|pid:none) Nepenthes sp. 'Kosobe' apocytochro... 237 2e-61
CP000250_1199(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 236 3e-61
EF135268_1(EF135268|pid:none) Reinwardtia indica voucher Chase 2... 236 3e-61
AF095274_2(AF095274|pid:none) Solanum tuberosum ribosomal protei... 236 3e-61
X58437_1(X58437|pid:none) S.tuberosum mitochondrial cob gene for... 236 3e-61
EF135280_1(EF135280|pid:none) Trigonia nivea voucher Anderson 13... 236 3e-61
DQ304771_13(DQ304771|pid:none) Chrysopathes formosa mitochondrio... 236 4e-61
EF135220_1(EF135220|pid:none) Euphronia guianensis voucher Mori ... 236 4e-61
CP000613_3351(CP000613|pid:none) Rhodospirillum centenum SW, com... 236 4e-61
EU523757_12(EU523757|pid:none) Phalangium opilio mitochondrion, ... 236 4e-61
DQ209272_1(DQ209272|pid:none) Puccinia coronata f. sp. avenae cy... 236 4e-61
AY781064_1(AY781064|pid:none) Agrocybe aegerita strain SM 47 apo... 236 4e-61
DQ009932_1(DQ009932|pid:none) Puccinia striiformis f. sp. tritic... 236 5e-61
AY320032_5(AY320032|pid:none) Geodia neptuni mitochondrion, comp... 236 5e-61
DQ859087_1(DQ859087|pid:none) Echeandia sp. C893 apocytochrome b... 235 7e-61
EF135199_1(EF135199|pid:none) Caryocar glabrum voucher Mori 2299... 235 7e-61
AY772389_1(AY772389|pid:none) Agrocybe chaxingu strain SM 960903... 235 7e-61
DQ993184_9(DQ993184|pid:none) Tilletia indica strain F11 mitocho... 235 9e-61
EF135224_1(EF135224|pid:none) Goupia glabra voucher Prevost 3031... 235 9e-61
EF536375_9(EF536375|pid:none) Tilletia walkeri strain TJ23 mitoc... 235 9e-61
CP001016_154(CP001016|pid:none) Beijerinckia indica subsp. indic... 235 9e-61
CP000301_916(CP000301|pid:none) Rhodopseudomonas palustris BisB1... 234 1e-60
CU459003_2603(CU459003|pid:none) Magnetospirillum gryphiswaldens... 234 2e-60
X07126_1(X07126|pid:none) Oenothera mitochondrial COB gene for a... 234 2e-60
DQ859142_1(DQ859142|pid:none) Limnocharis flava voucher C1435 ap... 234 2e-60
EU237486_4(EU237486|pid:none) Iotrochota birotulata mitochondrio... 234 2e-60
EF135277_1(EF135277|pid:none) Tapura guianensis voucher Ducke Re... 234 2e-60
EF135260_1(EF135260|pid:none) Phyllanthus epiphyllanthus voucher... 234 2e-60
DQ916731_1(DQ916731|pid:none) Ixiolirion tataricum apocytochrome... 234 2e-60
EF135238_1(EF135238|pid:none) Linum arboreum voucher Chase 478 (... 233 3e-60
(Q3T4C8) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 233 3e-60
EF135275_1(EF135275|pid:none) Stachystemon axillaris voucher Cha... 233 3e-60
EF135237_1(EF135237|pid:none) Leonia glycycarpa voucher Penningt... 233 3e-60
DQ859154_1(DQ859154|pid:none) Syringodium filiforme voucher C855... 233 3e-60
DQ859131_1(DQ859131|pid:none) Cymodocea serrulata voucher C853 a... 233 3e-60
EF135214_1(EF135214|pid:none) Endospermum moluccanum voucher Cha... 233 4e-60
AY506529_109(AY506529|pid:none) Zea mays strain NB mitochondrion... 233 4e-60
DQ859077_1(DQ859077|pid:none) Anemarrhena asphodeloides voucher ... 233 4e-60
EF135258_1(EF135258|pid:none) Petalostigma pubescens voucher Cli... 233 4e-60
EF135191_1(EF135191|pid:none) Bischofia javanica voucher Levin 2... 233 4e-60
EF135188_1(EF135188|pid:none) Balanops vieillardii voucher Chase... 233 4e-60
EF135283_1(EF135283|pid:none) Viola kitaibeliana voucher Chase 6... 233 4e-60
AY494079_27(AY494079|pid:none) Fucus vesiculosus mitochondrion, ... 233 5e-60
EF135215_1(EF135215|pid:none) Erythrococca sp. Cheek s.n. apocyt... 233 5e-60
AF287134_4(AF287134|pid:none) Ochromonas danica mitochondrial DN... 233 5e-60
DQ916634_1(DQ916634|pid:none) Piper nigrum apocytochrome b (cob)... 233 5e-60
DQ167399_39(DQ167399|pid:none) Oryza sativa (indica cultivar-gro... 233 5e-60
CP000927_697(CP000927|pid:none) Caulobacter sp. K31, complete ge... 233 5e-60
EF135206_1(EF135206|pid:none) Croton alabamensis var. alabamensi... 233 5e-60
DQ859082_1(DQ859082|pid:none) Hesperocallis undulata voucher C92... 232 6e-60
EF135271_1(EF135271|pid:none) Rinorea pubiflora voucher Alford 3... 232 6e-60
DQ859088_1(DQ859088|pid:none) Leucocrinum montanum voucher C894 ... 232 6e-60
EU237480_6(EU237480|pid:none) Ectyoplasia ferox mitochondrion, c... 232 6e-60
DQ916658_1(DQ916658|pid:none) Dianella caerulea apocytochrome b ... 232 6e-60
EF135231_1(EF135231|pid:none) Hymenanthera alpina voucher Chase ... 232 6e-60
EF135183_1(EF135183|pid:none) Acharia tragodes voucher Cloete s.... 232 6e-60
DQ859085_1(DQ859085|pid:none) Anthericum ramosum voucher C493 ap... 232 6e-60
EF135250_1(EF135250|pid:none) Monotaxis megacarpa voucher Chase ... 232 6e-60
DQ859081_1(DQ859081|pid:none) Chlorogalum pomeridianum voucher C... 232 6e-60
DQ859080_1(DQ859080|pid:none) Camassia leichtlinii voucher C1385... 232 6e-60
DQ859079_1(DQ859079|pid:none) Polianthes geminiflora voucher C13... 232 6e-60
DQ859083_1(DQ859083|pid:none) Hosta lancifolia voucher C518 apoc... 232 6e-60
EF135234_1(EF135234|pid:none) Kiggelaria africana voucher Alford... 232 6e-60
EF135228_1(EF135228|pid:none) Hugonia platysepala voucher Gereau... 232 6e-60
EF135197_1(EF135197|pid:none) Carallia brachiata voucher Chase 2... 232 8e-60
EF135201_1(EF135201|pid:none) Cespedesia bonplandii voucher Chas... 232 8e-60
EF135252_1(EF135252|pid:none) Ochna multiflora voucher Chase 229... 232 8e-60
AB266515_11(AB266515|pid:none) Vampyroteuthis infernalis mitocho... 232 8e-60
EF135236_1(EF135236|pid:none) Koilodepas bantamense voucher Chas... 232 8e-60
(Q36445) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 231 1e-59
AY639934_12(AY639934|pid:none) Triops longicaudatus mitochondrio... 231 1e-59
EF079088_1(EF079088|pid:none) Skeletonema costatum cytochrome b ... 231 1e-59
EF135210_1(EF135210|pid:none) Dicella nucifera voucher Anderson ... 231 1e-59
DQ916661_1(DQ916661|pid:none) Hypoxis occidentalis apocytochrome... 231 1e-59
EF135251_1(EF135251|pid:none) Neoscortechinia kingii voucher Cha... 231 1e-59
EF135270_1(EF135270|pid:none) Ricinus communis voucher Wurdack D... 231 1e-59
EF135247_1(EF135247|pid:none) Micrandra minor voucher Rimachi 87... 231 1e-59
DQ640649_3(DQ640649|pid:none) Briareum asbestinum mitochondrion,... 231 1e-59
EF135187_1(EF135187|pid:none) Austrobuxus megacarpus voucher For... 231 1e-59
FJ648425_8(FJ648425|pid:none) Glomus intraradices isolate FACE#4... 231 1e-59
(Q9ZZT8) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 231 1e-59
EF135256_1(EF135256|pid:none) Passiflora coccinea voucher Chase ... 231 1e-59
EF135240_1(EF135240|pid:none) Malesherbia linearifolia voucher C... 231 1e-59
(P05718) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 231 1e-59
EF135241_1(EF135241|pid:none) Malpighia stevensii voucher Davis ... 231 1e-59
DQ859159_1(DQ859159|pid:none) Zannichellia palustris voucher C84... 231 1e-59
EU520642_12(EU520642|pid:none) Eremobates cf. palpisetulosus SEM... 231 1e-59
EF135261_1(EF135261|pid:none) Podocalyx loranthoides voucher Ber... 231 1e-59
EF135184_1(EF135184|pid:none) Acridocarpus natalitius voucher Go... 231 1e-59
EF135281_1(EF135281|pid:none) Turnera ulmifolia voucher Chase 22... 231 1e-59
X98362_1(X98362|pid:none) H.annuus mitochondrial cob gene. 231 2e-59
CP001280_3697(CP001280|pid:none) Methylocella silvestris BL2, co... 231 2e-59
EF135194_1(EF135194|pid:none) Bruguiera gymnorhiza voucher Chase... 231 2e-59
EU883269_1(EU883269|pid:none) Silene acaulis isolate 11 apocytoc... 231 2e-59
Z35295_1(Z35295|pid:none) H.petiolaris mitochondrial cob gene fo... 231 2e-59
T14263(T14263)ubiquinol-cytochrome-c reductase (EC 1.10.2.2) cyt... 231 2e-59
EU883258_1(EU883258|pid:none) Silene acaulis isolate 9 apocytoch... 231 2e-59
EF135208_1(EF135208|pid:none) Dalechampia spathulata voucher Wur... 231 2e-59
EF135229_1(EF135229|pid:none) Humiria balsamifera voucher Anders... 230 2e-59
EF547212_1(EF547212|pid:none) Silene nutans apocytochrome b (cob... 230 2e-59
EF135282_1(EF135282|pid:none) Vantanea guianensis voucher Pennin... 230 2e-59
DQ916707_1(DQ916707|pid:none) Flagellaria indica apocytochrome b... 230 2e-59
AE005673_472(AE005673|pid:none) Caulobacter crescentus CB15, com... 230 2e-59
EF135233_1(EF135233|pid:none) Irvingia malayana clone 567 apocyt... 230 2e-59
AB240156_11(AB240156|pid:none) Octopus ocellatus mitochondrial D... 230 2e-59
EF135249_1(EF135249|pid:none) Microdesmis puberula voucher Cheek... 230 2e-59
EF547211_1(EF547211|pid:none) Silene noctiflora apocytochrome b ... 230 2e-59
EU883259_1(EU883259|pid:none) Silene acaulis isolate 10 apocytoc... 230 3e-59
(Q1AGX7) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 230 3e-59
DQ859126_1(DQ859126|pid:none) Aponogeton crispus voucher C114 ap... 230 3e-59
EU883262_1(EU883262|pid:none) Silene acaulis isolate 14 apocytoc... 230 3e-59
DQ859152_1(DQ859152|pid:none) Scheuchzeria palustris voucher C52... 230 3e-59
EU024482_11(EU024482|pid:none) Nothopuga sp. 1 LP-2008 mitochond... 230 3e-59
EU883257_1(EU883257|pid:none) Silene acaulis isolate 8 apocytoch... 230 3e-59
AY320033_6(AY320033|pid:none) Tethya actinia mitochondrion, comp... 230 3e-59
DQ859148_1(DQ859148|pid:none) Posidonia australis voucher C854 a... 230 3e-59
X53862_1(X53862|pid:none) C.glabrata mitochondrial cytB gene for... 230 3e-59
AB084514_12(AB084514|pid:none) Triops cancriformis mitochondrial... 230 3e-59
EU883260_1(EU883260|pid:none) Silene acaulis isolate 12 apocytoc... 230 3e-59
(P51131) RecName: Full=Cytochrome b/c1; Contains: RecName: Ful... 230 3e-59
DQ209280_1(DQ209280|pid:none) Uromyces appendiculatus cytochrome... 230 3e-59
EU883281_1(EU883281|pid:none) Silene nutans isolate 32 apocytoch... 230 3e-59
DQ859147_1(DQ859147|pid:none) Phyllospadix scouleri voucher C109... 230 3e-59
(Q85QA4) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 229 4e-59
FM995164_2(FM995164|pid:none) Nakaseomyces delphensis complete m... 229 4e-59
DQ916651_1(DQ916651|pid:none) Potamogeton natans apocytochrome b... 229 4e-59
DQ916633_1(DQ916633|pid:none) Peperomia polybotrya apocytochrome... 229 4e-59
DQ859150_1(DQ859150|pid:none) Potamogeton lucens voucher C531 ap... 229 4e-59
EF135285_1(EF135285|pid:none) Leea guineensis clone 1095 apocyto... 229 5e-59
EF547209_1(EF547209|pid:none) Silene dioica apocytochrome b (cob... 229 5e-59
CP000494_2172(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 229 5e-59
DQ916635_1(DQ916635|pid:none) Houttuynia cordata apocytochrome b... 229 5e-59
EU746611_11(EU746611|pid:none) Nasonia giraulti strain RV2 NADH ... 229 5e-59
DQ916610_1(DQ916610|pid:none) Nuphar variegata apocytochrome b (... 229 5e-59
AF288044_1(AF288044|pid:none) Cucumis sativus cultivar Calypso a... 229 5e-59
AY962590_3(AY962590|pid:none) Candida orthopsilosis strain MCO45... 229 5e-59
DQ916719_1(DQ916719|pid:none) Thamnochortus cinereus apocytochro... 229 5e-59
EU815687_1(EU815687|pid:none) Dendroica petechia cytochrome b (c... 229 7e-59
EU237488_6(EU237488|pid:none) Ptilocaulis walpersi mitochondrion... 229 7e-59
(Q8M4E2) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 229 7e-59
AF383007_1(AF383007|pid:none) Seiurus aurocapillus cytochrome b ... 229 7e-59
AY216860_1(AY216860|pid:none) Seiurus aurocapillus specimen-vouc... 229 7e-59
DQ916735_1(DQ916735|pid:none) Freycinetia excelsa apocytochrome ... 229 7e-59
(Q9MDF2) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 229 7e-59
AF256504_1(AF256504|pid:none) Dendroica adelaidae cytochrome b g... 229 7e-59
AF383001_1(AF383001|pid:none) Seiurus noveboracensis cytochrome ... 229 7e-59
DQ916706_1(DQ916706|pid:none) Eriocaulon humboldtii apocytochrom... 229 7e-59
AY216840_1(AY216840|pid:none) Dendroica pinus specimen-voucher A... 229 7e-59
AF256509_1(AF256509|pid:none) Parula pitiayumi cytochrome b gene... 229 7e-59
AY216843_1(AY216843|pid:none) Dendroica angelae specimen-voucher... 229 7e-59
AY216838_1(AY216838|pid:none) Dendroica dominica specimen-vouche... 229 7e-59
EU815684_1(EU815684|pid:none) Dendroica occidentalis cytochrome ... 229 7e-59
AY216816_1(AY216816|pid:none) Parula gutturalis specimen-voucher... 229 7e-59
EU815682_1(EU815682|pid:none) Dendroica magnolia cytochrome b (c... 229 7e-59
EU815677_1(EU815677|pid:none) Dendroica coronata cytochrome b (c... 229 7e-59
EF622534_3(EF622534|pid:none) Keratoisidinae sp. BAL208-1 mitoch... 229 7e-59
DQ916665_1(DQ916665|pid:none) Cypripedium calceolus apocytochrom... 229 7e-59
AF383006_1(AF383006|pid:none) Mniotilta varia cytochrome b gene,... 229 7e-59
AY216830_1(AY216830|pid:none) Dendroica discolor specimen-vouche... 229 7e-59
AF256505_1(AF256505|pid:none) Dendroica tigrina cytochrome b gen... 229 7e-59
(Q36551) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 229 7e-59
AY216833_1(AY216833|pid:none) Dendroica caerulescens specimen-vo... 229 7e-59
DQ916675_1(DQ916675|pid:none) Wurmbea sp. Conran et al. 899 apoc... 229 7e-59
AB158363_11(AB158363|pid:none) Octopus vulgaris mitochondrial DN... 229 7e-59
AF383013_1(AF383013|pid:none) Basileuterus tristriatus cytochrom... 229 7e-59
AY216817_1(AY216817|pid:none) Parula gutturalis specimen-voucher... 229 7e-59
EU427662_1(EU427662|pid:none) Chlorospingus ophthalmicus albifro... 229 7e-59
(Q8M4D6) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 228 9e-59
AF383012_1(AF383012|pid:none) Basileuterus rubifrons cytochrome ... 228 9e-59
AY216837_1(AY216837|pid:none) Dendroica magnolia specimen-vouche... 228 9e-59
EU619793_1(EU619793|pid:none) Catharus minimus voucher UAM7440 c... 228 9e-59
AF256506_1(AF256506|pid:none) Parula superciliosa cytochrome b g... 228 9e-59
DQ859140_1(DQ859140|pid:none) Lilaea scilloides voucher C25 apoc... 228 9e-59
DQ916655_1(DQ916655|pid:none) Blandfordia grandiflora apocytochr... 228 9e-59
EU815676_1(EU815676|pid:none) Dendroica cerulea cytochrome b (cy... 228 9e-59
EF135273_1(EF135273|pid:none) Sapria himalayana voucher Kocyan 1... 228 9e-59
AY216847_1(AY216847|pid:none) Basileuterus rufifrons specimen-vo... 228 9e-59
AE007869_2184(AE007869|pid:none) Agrobacterium tumefaciens str. ... 228 9e-59
EU883261_1(EU883261|pid:none) Silene acaulis isolate 13 apocytoc... 228 9e-59
EF529958_1(EF529958|pid:none) Cyanerpes cyaneus cytochrome b (cy... 228 9e-59
AY216809_1(AY216809|pid:none) Vermivora peregrina specimen-vouch... 228 9e-59
AF382994_1(AF382994|pid:none) Basileuterus flaveolus cytochrome ... 228 9e-59
AY968839_1(AY968839|pid:none) Myioborus castaneocapillus isolate... 228 9e-59
DQ916736_1(DQ916736|pid:none) Talbotia elegans apocytochrome b (... 228 9e-59
AY216856_1(AY216856|pid:none) Seiurus motacilla specimen-voucher... 228 9e-59
DQ916695_1(DQ916695|pid:none) Philydrum lanuginosum apocytochrom... 228 9e-59
EU237483_9(EU237483|pid:none) Halisarca dujardini mitochondrion,... 228 9e-59
AY216815_1(AY216815|pid:none) Vermivora crissalis specimen-vouch... 228 9e-59
(Q7GEV4) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 228 9e-59
EU237482_13(EU237482|pid:none) Topsentia ophiraphidites mitochon... 228 9e-59
AF193903_34(AF193903|pid:none) Cafeteria roenbergensis mitochond... 228 9e-59
EU427669_1(EU427669|pid:none) Chlorospingus ophthalmicus punctul... 228 9e-59
AY216832_1(AY216832|pid:none) Dendroica vitellina specimen-vouch... 228 1e-58
EU427666_1(EU427666|pid:none) Chlorospingus ophthalmicus postocu... 228 1e-58
EF529986_1(EF529986|pid:none) Poospiza baeri cytochrome b (cytb)... 228 1e-58
EF135267_1(EF135267|pid:none) Rafflesia pricei voucher Nickrent ... 228 1e-58
AY383116_1(AY383116|pid:none) Tangara cyanoptera specimen vouche... 228 1e-58
AY216828_1(AY216828|pid:none) Dendroica pensylvanica specimen-vo... 228 1e-58
EU427668_1(EU427668|pid:none) Chlorospingus ophthalmicus regiona... 228 1e-58
AY216829_1(AY216829|pid:none) Mniotilta varia specimen-voucher 8... 228 1e-58
EF635026_1(EF635026|pid:none) Lanius meridionalis koenigi vouche... 228 1e-58
AY968843_1(AY968843|pid:none) Myioborus miniatus isolate MIN_57_... 228 1e-58
AF089038_2(AF089038|pid:none) Leistes militaris NADH dehydrogena... 228 1e-58
AY968878_1(AY968878|pid:none) Myioborus miniatus isolate MIN_6_5... 228 1e-58
AY481592_1(AY481592|pid:none) Dendroica vitellina crawfordi vouc... 228 1e-58
AY216865_1(AY216865|pid:none) Wilsonia pusilla specimen-voucher ... 228 1e-58
EF529987_1(EF529987|pid:none) Poospiza erythrophrys cytochrome b... 228 1e-58
AY216819_1(AY216819|pid:none) Vermivora chrysoptera specimen-vou... 228 1e-58
AY968862_1(AY968862|pid:none) Myioborus albifrons isolate AL_102... 228 1e-58
AY216820_1(AY216820|pid:none) Vermivora pinus specimen-voucher A... 228 1e-58
AY216849_1(AY216849|pid:none) Geothlypis speciosa specimen-vouch... 228 1e-58
DQ916696_1(DQ916696|pid:none) Eichhornia azurea apocytochrome b ... 228 1e-58
EF529968_1(EF529968|pid:none) Thlypopsis ruficeps cytochrome b (... 228 1e-58
AY216803_1(AY216803|pid:none) Vermivora ruficapilla specimen-vou... 228 1e-58
AY968853_1(AY968853|pid:none) Myioborus miniatus isolate MIN_57_... 228 1e-58
AY340209_1(AY340209|pid:none) Basileuterus rivularis B-1146 cyto... 228 1e-58
AY968861_1(AY968861|pid:none) Myioborus albifrons isolate AL_102... 228 1e-58
AY340210_1(AY340210|pid:none) Basileuterus fluvicauda B-11873 cy... 228 1e-58
EF635029_1(EF635029|pid:none) Lanius meridionalis koenigi vouche... 228 1e-58
(Q02655) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 228 1e-58
AY340212_1(AY340212|pid:none) Basileuterus rivularis b05027 cyto... 228 1e-58
AY216842_1(AY216842|pid:none) Dendroica adelaidae specimen-vouch... 228 1e-58
DQ916716_1(DQ916716|pid:none) Rapatea xiphoides apocytochrome b ... 228 1e-58
EU746609_11(EU746609|pid:none) Nasonia vitripennis strain AsymC ... 228 1e-58
EU619800_1(EU619800|pid:none) Catharus minimus voucher UAM8965 c... 228 1e-58
AF383029_1(AF383029|pid:none) Oporornis tolmiei cytochrome b gen... 228 1e-58
AY383115_1(AY383115|pid:none) Tangara cyanicollis specimen vouch... 228 1e-58
AF383011_1(AF383011|pid:none) Myioborus pictus cytochrome b gene... 228 1e-58
EF621572_1(EF621572|pid:none) Lanius collurio isolate M1 cytochr... 228 1e-58
EU746612_11(EU746612|pid:none) Nasonia longicornis strain IV7 NA... 228 1e-58
AD3311(AD3311) ubiquinol-cytochrome-c reductase (EC 1.10.2.2) [i... 228 1e-58
DQ916727_1(DQ916727|pid:none) Maranta leuconeura apocytochrome b... 228 1e-58
AY383121_1(AY383121|pid:none) Tangara dowii specimen voucher LSU... 228 1e-58
AY968874_1(AY968874|pid:none) Myioborus flavivertex isolate FLA_... 228 1e-58
AF383031_1(AF383031|pid:none) Myioborus brunniceps cytochrome b ... 228 1e-58
AY383156_1(AY383156|pid:none) Tangara vassorii specimen voucher ... 228 1e-58
AY216846_1(AY216846|pid:none) Basileuterus tristriatus specimen-... 228 1e-58
AY968870_1(AY968870|pid:none) Myioborus castaneocapillus isolate... 228 1e-58
EU427335_12(EU427335|pid:none) Dysdercus cingulatus mitochondrio... 228 1e-58
AY968840_1(AY968840|pid:none) Myioborus melanocephalus isolate M... 228 1e-58
AE014291_1499(AE014291|pid:none) Brucella suis 1330 chromosome I... 228 1e-58
AY968879_1(AY968879|pid:none) Myioborus ornatus isolate ORN_102_... 228 1e-58
DQ916654_1(DQ916654|pid:none) Astelia sp. Grimes 3525 apocytochr... 228 1e-58
EU619796_1(EU619796|pid:none) Catharus minimus voucher UAM7596 c... 228 1e-58
AY968873_1(AY968873|pid:none) Myioborus flavivertex isolate FLA_... 228 1e-58
AY968887_1(AY968887|pid:none) Myioborus torquatus isolate TOR_57... 228 1e-58
DQ859156_1(DQ859156|pid:none) Triglochin maritima voucher C32 ap... 228 1e-58
AY383143_1(AY383143|pid:none) Tangara nigrocincta specimen vouch... 228 1e-58
AY383114_1(AY383114|pid:none) Tangara cyanicollis specimen vouch... 228 1e-58
AY216844_1(AY216844|pid:none) Dendroica pharetra specimen-vouche... 227 2e-58
AB159154_1(AB159154|pid:none) Lanius bucephalus mitochondrial ge... 227 2e-58
AY030117_1(AY030117|pid:none) Passer domesticus domesticus cytoc... 227 2e-58
AP008982_13(AP008982|pid:none) Triticum aestivum mitochondrial D... 227 2e-58
DQ340830_12(DQ340830|pid:none) Daphnia pulex strain A12 mitochon... 227 2e-58
EF621581_1(EF621581|pid:none) Lanius schach isolate M10 cytochro... 227 2e-58
AY340216_1(AY340216|pid:none) Basileuterus fluvicauda B-7061 cyt... 227 2e-58
AY383149_1(AY383149|pid:none) Tangara punctata specimen voucher ... 227 2e-58
DQ916711_1(DQ916711|pid:none) Anomochloa marantoidea apocytochro... 227 2e-58
AY340211_1(AY340211|pid:none) Basileuterus fluvicauda B-1527 cyt... 227 2e-58
AF117817_12(AF117817|pid:none) Daphnia pulex mitochondrial genom... 227 2e-58
AY968877_1(AY968877|pid:none) Myioborus castaneocapillus isolate... 227 2e-58
EF529951_1(EF529951|pid:none) Molothrus ater cytochrome b (cytb)... 227 2e-58
DQ340838_12(DQ340838|pid:none) Daphnia pulex strain S8 mitochond... 227 2e-58
DQ916714_1(DQ916714|pid:none) Streptochaeta angustifolia apocyto... 227 2e-58
EF635033_1(EF635033|pid:none) Lanius collurio collurio voucher I... 227 2e-58
DQ340833_12(DQ340833|pid:none) Daphnia pulex strain S13 mitochon... 227 2e-58
DQ340822_12(DQ340822|pid:none) Daphnia pulex strain A7 mitochond... 227 2e-58
DQ916631_1(DQ916631|pid:none) Saruma henryi apocytochrome b (cob... 227 2e-58
EF635034_1(EF635034|pid:none) Lanius senator senator voucher IPM... 227 2e-58
EF621576_1(EF621576|pid:none) Lanius schach isolate M5 cytochrom... 227 2e-58
EF635035_1(EF635035|pid:none) Lanius senator niloticus voucher I... 227 2e-58
EF529961_1(EF529961|pid:none) Eucometis penicillata cytochrome b... 227 2e-58
EF635036_1(EF635036|pid:none) Lanius senator senator voucher IPM... 227 2e-58
DQ916712_1(DQ916712|pid:none) Bambusa multiplex apocytochrome b ... 227 2e-58
(Q34902) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 227 2e-58
AY030105_1(AY030105|pid:none) Lanius ludovicianus cytochrome b (... 227 2e-58
EF530017_1(EF530017|pid:none) Saltator aurantiirostris cytochrom... 227 2e-58
AY383138_1(AY383138|pid:none) Tangara larvata specimen voucher L... 227 2e-58
EF530020_1(EF530020|pid:none) Saltatricula multicolor cytochrome... 227 2e-58
DQ916671_1(DQ916671|pid:none) Tacca parkeri apocytochrome b (cob... 227 3e-58
EF529972_1(EF529972|pid:none) Volatinia jacarina cytochrome b (c... 227 3e-58
FM179380_36(FM179380|pid:none) Vitis vinifera complete mitochond... 227 3e-58
AF301456_1(AF301456|pid:none) Passerina versicolor cytochrome b ... 227 3e-58
AB086202_16(AB086202|pid:none) Watasenia scintillans mitochondri... 227 3e-58
AF383019_1(AF383019|pid:none) Hemispingus atropileus cytochrome ... 227 3e-58
AY383117_1(AY383117|pid:none) Tangara cyanocephala specimen vouc... 227 3e-58
AB239493_1(AB239493|pid:none) Passer montanus saturatus mitochon... 227 3e-58
DQ916722_1(DQ916722|pid:none) Canna indica apocytochrome b (cob)... 227 3e-58
AF301448_1(AF301448|pid:none) Passerina caerulea specimen-vouche... 227 3e-58
AF301452_1(AF301452|pid:none) Passerina rositae specimen-voucher... 227 3e-58
AY383090_1(AY383090|pid:none) Anisognathus flavinuchus specimen ... 227 3e-58
EU427679_1(EU427679|pid:none) Chlorospingus tacarcunae voucher S... 227 3e-58
AF301449_1(AF301449|pid:none) Passerina caerulea specimen-vouche... 227 3e-58
EF530032_1(EF530032|pid:none) Coccothraustes vespertina cytochro... 227 3e-58
AY340214_1(AY340214|pid:none) Basileuterus fluvicauda b0531 cyto... 227 3e-58
AB159158_1(AB159158|pid:none) Passer montanus mitochondrial gene... 227 3e-58
DQ640646_3(DQ640646|pid:none) Pseudopterogorgia bipinnata mitoch... 227 3e-58
AJ277126_33(AJ277126|pid:none) Pilayella littoralis complete mit... 227 3e-58
AF301458_1(AF301458|pid:none) Passerina ciris specimen-voucher L... 227 3e-58
EF529997_1(EF529997|pid:none) Piranga olivacea cytochrome b (cyt... 227 3e-58
AF382999_1(AF382999|pid:none) Teretistris fernandinae cytochrome... 227 3e-58
AY383152_1(AY383152|pid:none) Tangara rufigula specimen voucher ... 227 3e-58
EF530007_1(EF530007|pid:none) Cardinalis cardinalis cytochrome b... 227 3e-58
DQ916713_1(DQ916713|pid:none) Pharus latifolius apocytochrome b ... 227 3e-58
EF530021_1(EF530021|pid:none) Saltator atricollis cytochrome b (... 227 3e-58
EU427671_1(EU427671|pid:none) Chlorospingus ophthalmicus phaeoce... 227 3e-58
AY705435_1(AY705435|pid:none) Dolospingus fringilloides voucher ... 227 3e-58
EF530018_1(EF530018|pid:none) Saltator grossus cytochrome b (cyt... 227 3e-58
AY216806_1(AY216806|pid:none) Vermivora ruficapilla specimen-vou... 226 3e-58
EF529990_1(EF529990|pid:none) Coryphospingus cucullatus cytochro... 226 3e-58
FJ154633_2(FJ154633|pid:none) Sturnella magna isolate STMAG37 NA... 226 3e-58
FJ346339_1(FJ346339|pid:none) Rhynchosporium secalis cytochrome ... 226 3e-58
DQ916704_1(DQ916704|pid:none) Tillandsia usneoides apocytochrome... 226 3e-58
AY383094_1(AY383094|pid:none) Chlorochrysa phoenicotis specimen ... 226 3e-58
AF383023_1(AF383023|pid:none) Zonotrichia capensis cytochrome b ... 226 3e-58
EF529964_1(EF529964|pid:none) Ramphocelus dimidiatus cytochrome ... 226 3e-58
DQ916717_1(DQ916717|pid:none) Stegolepis parvipetala apocytochro... 226 3e-58
AF301457_1(AF301457|pid:none) Passerina versicolor specimen-vouc... 226 3e-58
AY383089_1(AY383089|pid:none) Coereba flaveola specimen voucher ... 226 3e-58
DQ916688_1(DQ916688|pid:none) Calectasia cyanea apocytochrome b ... 226 3e-58
(Q950B9) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 226 3e-58
EF529979_1(EF529979|pid:none) Phrygilus plebejus cytochrome b (c... 226 3e-58
DQ340828_12(DQ340828|pid:none) Daphnia pulex strain A1 mitochond... 226 3e-58
DQ916720_1(DQ916720|pid:none) Sparganium eurycarpum apocytochrom... 226 3e-58
DQ916684_1(DQ916684|pid:none) Carludovica drudei apocytochrome b... 226 3e-58
DQ916687_1(DQ916687|pid:none) Baxteria australis apocytochrome b... 226 3e-58
EF529963_1(EF529963|pid:none) Oryzoborus funereus cytochrome b (... 226 3e-58
EU427678_1(EU427678|pid:none) Chlorospingus semifuscus voucher L... 226 3e-58
DQ916708_1(DQ916708|pid:none) Joinvillea ascendens apocytochrome... 226 3e-58
AY383162_1(AY383162|pid:none) Tangara xanthogastra specimen vouc... 226 3e-58
EF529992_1(EF529992|pid:none) Lophospingus pusillus cytochrome b... 226 3e-58
AF301462_1(AF301462|pid:none) Cyanocompsa cyanoides specimen-vou... 226 3e-58
AY383123_1(AY383123|pid:none) Tangara fastuosa specimen voucher ... 226 3e-58
DQ825686_1(DQ825686|pid:none) Savalia savaglia mitochondrion, co... 226 3e-58
AY030122_1(AY030122|pid:none) Parula pitiayumi cytochrome b (cyt... 226 3e-58
DQ683370_1(DQ683370|pid:none) Anthopleura midori cytochrome b ge... 226 3e-58
AY030119_1(AY030119|pid:none) Basileuterus culicivorus cytochrom... 226 3e-58
EF529982_1(EF529982|pid:none) Phrygilus atriceps cytochrome b (c... 226 4e-58
EF135619_1(EF135619|pid:none) Sapria himalayana voucher Kocyan 1... 226 4e-58
FJ154645_2(FJ154645|pid:none) Sturnella magna isolate STMAG52 NA... 226 4e-58
EF529947_1(EF529947|pid:none) Emberiza pallasi cytochrome b (cyt... 226 4e-58
AY803353_12(AY803353|pid:none) Centruroides limpidus mitochondri... 226 4e-58
AY383132_1(AY383132|pid:none) Tangara heinei specimen voucher LS... 226 4e-58
AF301460_1(AF301460|pid:none) Cyanocompsa parellina specimen-vou... 226 4e-58
EU746610_11(EU746610|pid:none) Nasonia vitripennis strain HiCD12... 226 4e-58
FJ154656_2(FJ154656|pid:none) Sturnella magna isolate STNEG7 NAD... 226 4e-58
AY649531_1(AY649531|pid:none) Piranga rubra voucher SDSU 2623 cy... 226 4e-58
DQ916691_1(DQ916691|pid:none) Phoenix dactylifera apocytochrome ... 226 4e-58
AY649495_1(AY649495|pid:none) Piranga rubra voucher SDSU 2729 cy... 226 4e-58
EF530019_1(EF530019|pid:none) Saltator atriceps cytochrome b (cy... 226 4e-58
DQ916690_1(DQ916690|pid:none) Euterpe oleracea apocytochrome b (... 226 4e-58
AM420314_4(AM420314|pid:none) Negombata magnifica complete mitoc... 226 4e-58
DQ916698_1(DQ916698|pid:none) Pontederia cordata apocytochrome b... 226 4e-58
AY383120_1(AY383120|pid:none) Tangara desmaresti specimen vouche... 226 4e-58
DQ916638_1(DQ916638|pid:none) Platanus occidentalis apocytochrom... 226 4e-58
(O63848) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 226 4e-58
FJ154617_2(FJ154617|pid:none) Sturnella magna isolate STMAG2 NAD... 226 4e-58
EF529952_1(EF529952|pid:none) Sturnella neglecta cytochrome b (c... 226 4e-58
EU427676_1(EU427676|pid:none) Chlorospingus inornatus voucher LS... 226 4e-58
AB240153_10(AB240153|pid:none) Todarodes pacificus mitochondrial... 226 4e-58
DQ192021_1(DQ192021|pid:none) Fringilla montifringilla clone fmo... 226 4e-58
AY206945_1(AY206945|pid:none) Sheppardia bocagei cytochrome b (c... 226 4e-58
AB470277_1(AB470277|pid:none) Rossia pacifica mitochondrial cytb... 226 4e-58
EU658923_16(EU658923|pid:none) Sthenoteuthis oualaniensis isolat... 226 4e-58
AY383102_1(AY383102|pid:none) Schistochlamys melanopsis specimen... 226 4e-58
DQ459520_1(DQ459520|pid:none) Ammodramus maritimus cytochrome b ... 226 4e-58
EU068697_16(EU068697|pid:none) Dosidicus gigas mitochondrion, co... 226 4e-58
FJ154619_2(FJ154619|pid:none) Sturnella magna isolate STMAG24 NA... 226 4e-58
AY649542_1(AY649542|pid:none) Piranga rubra voucher FMNH 394093 ... 226 4e-58
AY649539_1(AY649539|pid:none) Piranga rubra voucher FMNH 363314 ... 226 4e-58
AY649533_1(AY649533|pid:none) Piranga rubra voucher SDSU 2625 cy... 226 4e-58
AY649513_1(AY649513|pid:none) Piranga rubra voucher SDSU 2741 cy... 226 4e-58
FJ154610_2(FJ154610|pid:none) Sturnella magna isolate STMAG12 NA... 226 4e-58
FJ487854_2(FJ487854|pid:none) Rhipidura leucophrys bio-material ... 226 4e-58
EF635021_1(EF635021|pid:none) Lanius nubicus voucher IPMB 12704 ... 226 4e-58
AY649530_1(AY649530|pid:none) Piranga rubra voucher SDSU 2622 cy... 226 4e-58
AY383159_1(AY383159|pid:none) Tangara viridicollis specimen vouc... 226 4e-58
AB158364_16(AB158364|pid:none) Todarodes pacificus mitochondrial... 226 4e-58
EF530033_1(EF530033|pid:none) Mitrospingus oleagineus cytochrome... 226 4e-58
FJ154613_2(FJ154613|pid:none) Sturnella magna isolate STMAG15 NA... 226 4e-58
AY383150_1(AY383150|pid:none) Tangara ruficervix specimen vouche... 226 4e-58
AY206946_1(AY206946|pid:none) Sheppardia bocagei cytochrome b (c... 226 4e-58
AF383020_1(AF383020|pid:none) Hemispingus frontalis cytochrome b... 226 4e-58
AF284071_2(AF284071|pid:none) Cardinalis cardinalis NADH dehydro... 226 4e-58
AY649517_1(AY649517|pid:none) Piranga rubra voucher SDSU 2630 cy... 226 4e-58
AY383137_1(AY383137|pid:none) Tangara labradorides specimen vouc... 226 4e-58
AY216863_1(AY216863|pid:none) Xenoligea montana specimen-voucher... 226 6e-58
AY156426_1(AY156426|pid:none) Plectrophenax nivalis specimen-vou... 226 6e-58
DQ916668_1(DQ916668|pid:none) Dioscorea retusa apocytochrome b (... 226 6e-58
DQ119522_1(DQ119522|pid:none) Luscinia cyane isolate lcy-2 cytoc... 226 6e-58
EF529931_1(EF529931|pid:none) Zonotrichia albicollis cytochrome ... 226 6e-58
(Q8M4C6) RecName: Full=Cytochrome b; AltName: Full=Ubiquinol-cyt... 226 6e-58
DQ489373_1(DQ489373|pid:none) Calcarius mccownii voucher JK94_07... 226 6e-58
AY167221_1(AY167221|pid:none) Sheppardia lowei specimen-voucher ... 226 6e-58
AY156448_1(AY156448|pid:none) Plectrophenax nivalis specimen-vou... 226 6e-58
AY216818_1(AY216818|pid:none) Vermivora chrysoptera specimen-vou... 226 6e-58
AY383109_1(AY383109|pid:none) Tangara chilensis specimen voucher... 226 6e-58
AY167220_1(AY167220|pid:none) Sheppardia lowei specimen-voucher ... 226 6e-58

>EU275726_19(EU275726|pid:none) Polysphondylium pallidum strain
PN500 mitochondrion, complete genome.
Length = 385

Score = 349 bits (895), Expect = 4e-95
Identities = 165/206 (80%), Positives = 179/206 (86%)
Frame = -2

Query: 634 MRLVKKNVVINGIYEAGVRYPEPANISYLWNFGFFSLICLIIQLVSGILLAMHYSAHVDL 455
MRLVK N +ING+YEAGVRYPEP NISY WNFGFFSLICL++QLV+GILLAMHY+AHVDL
Sbjct: 1 MRLVKSNQIINGVYEAGVRYPEPVNISYFWNFGFFSLICLVMQLVTGILLAMHYTAHVDL 60

Query: 454 AFNSIERLVREVDYGWLLRYIHANGASFFFIVVYIHMLRGLYFGSYQKPNAMLWVSXXXX 275
AF SIERLVREVDYGWLLRY+HANGASFFFIV+YIHMLRGLY+GSYQ PN +W+S
Sbjct: 61 AFMSIERLVREVDYGWLLRYVHANGASFFFIVLYIHMLRGLYYGSYQAPNTFVWISGVII 120

Query: 274 XXXXXXXXXXGYVLPWGQMSYWAATVITNLVTVLPVIGEDIVIWLWGGFNVDNPTLNRFF 95
GYVLPWGQMSYWAATVITNLVTV+PV+G+ IVIWLWG F V NPTLNRFF
Sbjct: 121 FLLTILTAFLGYVLPWGQMSYWAATVITNLVTVIPVVGDAIVIWLWGSFVVSNPTLNRFF 180

Query: 94 SLHYLCPFIIVGLVGLHIIFLRENGS 17
SLHYL PFIIVGLVGLHIIFLRENGS
Sbjct: 181 SLHYLFPFIIVGLVGLHIIFLRENGS 206

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 1,078,483,126
Number of extensions: 22851362
Number of successful extensions: 127364
Number of sequences better than 10.0: 39003
Number of HSP's gapped: 96534
Number of HSP's successfully gapped: 39054
Length of query: 212
Length of database: 1,061,185,681
Length adjustment: 123
Effective length of query: 89
Effective length of database: 659,166,577
Effective search space: 58665825353
Effective search space used: 58665825353
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)

PSORT

psg: 0.89 gvh: 0.35 alm: 0.47 top: 0.53 tms: 0.00 mit: 0.41 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

44.0 %: mitochondrial
28.0 %: cytoplasmic
16.0 %: nuclear
4.0 %: cytoskeletal
4.0 %: plasma membrane
4.0 %: peroxisomal

>> prediction for Contig-U04150-1 is mit

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 2
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0