Contig-U04026-1
Contig ID Contig-U04026-1
Contig update 2002. 9.13
Contig sequence
>Contig-U04026-1 (Contig-U04026-1Q) /CSM_Contig/Contig-U04026-1Q.Seq.d
GTTTTTAGAATCACTACAATCATTATACCAAAACAAGAGGGTACTACTGA
TACTTGTAATACCATTGAAGAACATGAAATCTTTGAATATCAACTAGAGA
ATGATTTACTAACTTTGGGTTGGATTCATACTCATCCAACTCAAGATTGT
TTCTTATCAGCCGTTGATGTCCATACTCATTGTTCCTATCAATATCTTCT
TCAAGAGGCTATAGCCGTTGTCATTAGTCCAATGGCAAATCCAAACTTTG
GTATCTTTAGATTAACCGATCCACCCGGTTTGGAAACTGTACAAAAATGT
AAACTAAAATCATTCCATCCCCATCCACCCGTTAATGGTATACCAATCTA
TACAAAAGTTGATCATGTCGATTTAATTTGGGGTAAAAAATCTGATAGTA
AAGTTGTAGATTTACGTTTTTTAAAGAAATAAAAACACTTTAATAAATAT
TTATTTCTTTTTAAAAAAAAATAAAATAAAATAAAAAGAATAAAAAATAA
AA

Gap no gap
Contig length 502
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 1597982
End point 1598484
Strand (PLUS/MINUS) PLUS
Number of clones 1
Number of EST 1
Link to clone list U04026
List of clone(s)

est1=SLE396E,1,503
Translated Amino Acid sequence
VFRITTIIIPKQEGTTDTCNTIEEHEIFEYQLENDLLTLGWIHTHPTQDCFLSAVDVHTH
CSYQYLLQEAIAVVISPMANPNFGIFRLTDPPGLETVQKCKLKSFHPHPPVNGIPIYTKV
DHVDLIWGKKSDSKVVDLRFLKK*khfnkylflfkkk*nkikriknk


Translated Amino Acid sequence (All Frames)
Frame A:
VFRITTIIIPKQEGTTDTCNTIEEHEIFEYQLENDLLTLGWIHTHPTQDCFLSAVDVHTH
CSYQYLLQEAIAVVISPMANPNFGIFRLTDPPGLETVQKCKLKSFHPHPPVNGIPIYTKV
DHVDLIWGKKSDSKVVDLRFLKK*khfnkylflfkkk*nkikriknk


Frame B:
fleslqslyqnkrvllilviplknmkslnin*rmiy*lwvgfiliqlkivsyqplmsili
vpiniffkrl*plslvqwqiqtlvsld*pihpvwklyknvn*nhsipihplmvyqsiqkl
imsi*fgvknlivkl*iyvf*rnkntliniyfflkknkik*ke*kik


Frame C:
f*nhynhytktrgyy*yl*yh*rt*nl*istre*ftnfgldsyssnsrlflisr*cpysl
flsisssrgysrch*sngksklwyl*inrstrfgnctkm*tkiipspstr*wytnlyks*
scrfnlg*ki***scrftffkeiktl**ifisf*kkik*nkknkk*


own update 2004. 6. 9
Homology vs CSM-cDNA
Query= Contig-U04026-1 (Contig-U04026-1Q)
/CSM_Contig/Contig-U04026-1Q.Seq.d
(502 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U04026-1 (Contig-U04026-1Q) /CSM_Contig/Conti... 825 0.0
Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Conti... 36 0.035
Contig-U10152-1 (Contig-U10152-1Q) /CSM_Contig/Conti... 36 0.035
Contig-U06682-1 (Contig-U06682-1Q) /CSM_Contig/Conti... 34 0.14
Contig-U11921-1 (Contig-U11921-1Q) /CSM_Contig/Conti... 32 0.54
Contig-U11216-1 (Contig-U11216-1Q) /CSM_Contig/Conti... 32 0.54
Contig-U09404-1 (Contig-U09404-1Q) /CSM_Contig/Conti... 32 0.54
Contig-U09338-1 (Contig-U09338-1Q) /CSM_Contig/Conti... 32 0.54
Contig-U09317-1 (Contig-U09317-1Q) /CSM_Contig/Conti... 32 0.54
Contig-U06881-1 (Contig-U06881-1Q) /CSM_Contig/Conti... 32 0.54

>Contig-U04026-1 (Contig-U04026-1Q) /CSM_Contig/Contig-U04026-1Q.Seq.d
Length = 502

Score = 825 bits (416), Expect = 0.0
Identities = 416/416 (100%)
Strand = Plus / Plus


Query: 1 gtttttagaatcactacaatcattataccaaaacaagagggtactactgatacttgtaat 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 gtttttagaatcactacaatcattataccaaaacaagagggtactactgatacttgtaat 60


Query: 61 accattgaagaacatgaaatctttgaatatcaactagagaatgatttactaactttgggt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 accattgaagaacatgaaatctttgaatatcaactagagaatgatttactaactttgggt 120


Query: 121 tggattcatactcatccaactcaagattgtttcttatcagccgttgatgtccatactcat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tggattcatactcatccaactcaagattgtttcttatcagccgttgatgtccatactcat 180


Query: 181 tgttcctatcaatatcttcttcaagaggctatagccgttgtcattagtccaatggcaaat 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tgttcctatcaatatcttcttcaagaggctatagccgttgtcattagtccaatggcaaat 240


Query: 241 ccaaactttggtatctttagattaaccgatccacccggtttggaaactgtacaaaaatgt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 ccaaactttggtatctttagattaaccgatccacccggtttggaaactgtacaaaaatgt 300


Query: 301 aaactaaaatcattccatccccatccacccgttaatggtataccaatctatacaaaagtt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 aaactaaaatcattccatccccatccacccgttaatggtataccaatctatacaaaagtt 360


Query: 361 gatcatgtcgatttaatttggggtaaaaaatctgatagtaaagttgtagatttacg 416
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 gatcatgtcgatttaatttggggtaaaaaatctgatagtaaagttgtagatttacg 416


>Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d
Length = 1355

Score = 36.2 bits (18), Expect = 0.035
Identities = 18/18 (100%)
Strand = Plus / Plus


Query: 365 atgtcgatttaatttggg 382
||||||||||||||||||
Sbjct: 686 atgtcgatttaatttggg 703


>Contig-U10152-1 (Contig-U10152-1Q) /CSM_Contig/Contig-U10152-1Q.Seq.d
Length = 1215

Score = 36.2 bits (18), Expect = 0.035
Identities = 18/18 (100%)
Strand = Plus / Plus


Query: 373 ttaatttggggtaaaaaa 390
||||||||||||||||||
Sbjct: 889 ttaatttggggtaaaaaa 906


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 3244
Number of Sequences: 6905
Number of extensions: 3244
Number of successful extensions: 318
Number of sequences better than 10.0: 94
length of query: 502
length of database: 5,674,871
effective HSP length: 16
effective length of query: 486
effective length of database: 5,564,391
effective search space: 2704294026
effective search space used: 2704294026
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2009. 6.11
Homology vs DNA
Query= Contig-U04026-1 (Contig-U04026-1Q) /CSM_Contig/Contig-U04026-1Q.Seq.d
(502 letters)

Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AF018638) Dictyostelium discoideum unknown (1039) gene, par... 813 0.0 1
(AU034953) Dictyostelium discoideum slug cDNA, clone SLE396. 813 0.0 1
(EL565754) Physarum00449 Physarum polycephalum starvation st... 50 1e-05 2
(EL578744) Physarum06660 Physarum polycephalum starvation st... 50 1e-05 2
(DC444675) Gryllus bimaculatus mRNA, clone:GB00364-66_E08, 5... 48 0.050 2
(CO771926) testis_EST03023 Testis cDNA Library Gallus gallus... 34 0.064 2
(BU360511) 603586385F1 CSEQCHN72 Gallus gallus cDNA clone Ch... 34 0.064 2
(BU225664) 603398334F1 CSEQCHN23 Gallus gallus cDNA clone Ch... 34 0.065 2
(BU272891) 603532129F1 CSEQCHN53 Gallus gallus cDNA clone Ch... 34 0.065 2
(BU207938) 604151373F1 CSEQCHN03 Gallus gallus cDNA clone Ch... 34 0.065 2
(BU210383) 604160003F1 CSEQCHN03 Gallus gallus cDNA clone Ch... 34 0.065 2
(BU278425) 603865931F1 CSEQCHN54 Gallus gallus cDNA clone Ch... 34 0.065 2
(CQ575331) Sequence 3089 from Patent WO0171042. 48 0.32 1
(AY075309) Drosophila melanogaster AT31826 full insert cDNA. 48 0.32 1
(BX005127) Mouse DNA sequence *** SEQUENCING CANCELLED *** f... 34 0.66 2
(AL731711) Mouse DNA sequence from clone RP23-55A17 on chrom... 34 0.68 2
(G52111) SHGC-82151 Human Homo sapiens STS genomic, sequence... 46 1.3 1
(AM477047) Vitis vinifera contig VV78X254203.21, whole genom... 46 1.3 1
(DL464175) Tumor diagnosis marker and therapeutic target mol... 46 1.3 1
(GC700752) Sequence 15997 from patent US 6812339. 46 1.3 1
(GC700751) Sequence 15996 from patent US 6812339. 46 1.3 1
(AL390241) Human DNA sequence from clone RP11-343L14 on chro... 46 1.3 1
(AC053473) Homo sapiens chromosome 1 clone RP11-223G15 map 1... 46 1.3 1
(AL391060) Human DNA sequence *** SEQUENCING CANCELLED *** f... 46 1.3 1
(AC023411) Homo sapiens chromosome 1 clone RP11-54A23 map 1,... 46 1.3 1
(AQ081923) RPCI11-54A23.TJ RPCI-11 Homo sapiens genomic clon... 46 1.3 1
(AG924238) Drosophila melanogaster DNA, clone: DME1-003N14.F... 46 1.3 1
(CN817499) HRO4458_A04_B08ZS5 Lib AA070E1X Avena sativa cv. ... 46 1.3 1
(DV576337) 0061P0006B06_5' library 61 - subtracted (Single m... 42 1.7 2
(DV576336) 0061P0006B06_3' library 61 - subtracted (Single m... 42 1.7 2
(CU329670) Schizosaccharomyces pombe chromosome I. 34 2.0 2
(AC118233) Mus musculus clone RP23-462L17, WORKING DRAFT SEQ... 32 2.5 2
(AL831760) Mouse DNA sequence from clone RP23-382F2 on chrom... 32 2.6 2
(AB172857) Macaca fascicularis brain cDNA clone: QflA-19868,... 32 3.2 2
(AB172083) Macaca fascicularis brain cDNA clone: QflA-16583,... 32 3.2 2
(FB803744) Sequence 23017 from Patent WO2008034648. 34 3.3 2
(CL976247) OsIFCC028554 Oryza sativa Express Library Oryza s... 42 3.4 2
(BD460461) Diagnosis of Diseases Associated with Cell Cycle. 44 3.6 2
(BD452383) Diagnosis of Diseases Associated with Cell Cycle. 44 3.6 2
(AX348774) Sequence 232 from Patent WO0202807. 44 3.6 2
(AX251997) Sequence 258 from Patent WO0168911. 44 3.6 2
(FB672388) Sequence 12 from Patent WO2007146511. 44 5.0 1
(EA071119) Sequence 243 from patent US 7179796. 44 5.0 1
(DD096573) ANTISENSE MODULATION OF PTP1B EXPRESSION. 44 5.0 1
(GC700761) Sequence 16006 from patent US 6812339. 44 5.0 1
(AY029236) Homo sapiens protein tyrosine phosphatase 1B (PTP... 44 5.0 1
(AL390739) Human DNA sequence from clone RP11-157F14 on chro... 44 5.0 1
(AL034429) Human DNA sequence from clone RP5-894K16 on chrom... 44 5.0 1
(AC159914) Gorilla gorilla gorilla clone CH255-116D16, WORKI... 44 5.0 1
(AC155772) Pongo abelii clone CH253-269P2, WORKING DRAFT SEQ... 44 5.0 1
(AC135904) Rattus norvegicus clone CH230-32M21, *** SEQUENCI... 44 5.0 1
(AL357043) Human DNA sequence *** SEQUENCING CANCELLED *** f... 44 5.0 1
(DV620446) EST1223442 Glossina morsitans morsitans Fat body ... 44 5.0 1
(CD183133) MS1-0037T-D122-A05-U.G MS1-0037 Schistosoma manso... 44 5.0 1
(CD083863) MA3-9999U-V268-A04-U.B MA3-0001 Schistosoma manso... 44 5.0 1
(FL843901) CCGH23755.b1 CCGH Panicum virgatum late flowering... 44 5.0 1
(CR555291) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 32 8.6 2
(AC111882) Rattus norvegicus clone CH230-26I4, *** SEQUENCIN... 30 8.9 2
(AC133208) Mus musculus BAC clone RP23-17O6 from chromosome ... 30 8.9 2
(CR628370) Zebrafish DNA sequence from clone DKEY-33L16 in l... 32 9.1 2
(BX119956) Mouse DNA sequence from clone RP23-301K15 on chro... 30 9.1 2
(CR388178) Zebrafish DNA sequence from clone DKEY-114D20 in ... 32 9.1 2
(AC140472) Mus musculus BAC clone RP24-403L12 from chromosom... 30 9.1 2

>(AF018638) Dictyostelium discoideum unknown (1039) gene, partial cds.
Length = 1453

Score = 813 bits (410), Expect = 0.0
Identities = 410/410 (100%)
Strand = Plus / Plus


Query: 1 gtttttagaatcactacaatcattataccaaaacaagagggtactactgatacttgtaat 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 907 gtttttagaatcactacaatcattataccaaaacaagagggtactactgatacttgtaat 966


Query: 61 accattgaagaacatgaaatctttgaatatcaactagagaatgatttactaactttgggt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 967 accattgaagaacatgaaatctttgaatatcaactagagaatgatttactaactttgggt 1026


Query: 121 tggattcatactcatccaactcaagattgtttcttatcagccgttgatgtccatactcat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1027 tggattcatactcatccaactcaagattgtttcttatcagccgttgatgtccatactcat 1086


Query: 181 tgttcctatcaatatcttcttcaagaggctatagccgttgtcattagtccaatggcaaat 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1087 tgttcctatcaatatcttcttcaagaggctatagccgttgtcattagtccaatggcaaat 1146


Query: 241 ccaaactttggtatctttagattaaccgatccacccggtttggaaactgtacaaaaatgt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1147 ccaaactttggtatctttagattaaccgatccacccggtttggaaactgtacaaaaatgt 1206


Query: 301 aaactaaaatcattccatccccatccacccgttaatggtataccaatctatacaaaagtt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1207 aaactaaaatcattccatccccatccacccgttaatggtataccaatctatacaaaagtt 1266


Query: 361 gatcatgtcgatttaatttggggtaaaaaatctgatagtaaagttgtaga 410
||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1267 gatcatgtcgatttaatttggggtaaaaaatctgatagtaaagttgtaga 1316

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 454,476,789
Number of extensions: 24385439
Number of successful extensions: 1924496
Number of sequences better than 10.0: 63
Length of query: 502
Length of database: 101,790,757,118
Length adjustment: 23
Effective length of query: 479
Effective length of database: 99,442,330,388
Effective search space: 47632876255852
Effective search space used: 47632876255852
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)

protein update 2009. 7.29
Homology vs Protein
Query= Contig-U04026-1 (Contig-U04026-1Q) /CSM_Contig/Contig-U04026-1Q.Seq.d
(502 letters)

Database: nrp_A
3,268,448 sequences; 1,061,185,681 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

AF018638_1(AF018638|pid:none) Dictyostelium discoideum unknown (... 297 8e-80
FB803772_1(FB803772|pid:none) Sequence 23045 from Patent WO20080... 149 4e-35
(Q9P371) RecName: Full=ESCRT I complex subunit sst2; EC... 145 4e-34
BT020354_1(BT020354|pid:none) Arabidopsis thaliana At4g16144 gen... 145 7e-34
CR382129_2(CR382129|pid:none) Yarrowia lipolytica strain CLIB122... 142 6e-33
FB803780_1(FB803780|pid:none) Sequence 23053 from Patent WO20080... 141 8e-33
FB803778_1(FB803778|pid:none) Sequence 23051 from Patent WO20080... 140 2e-32
AM270034_18(AM270034|pid:none) Aspergillus niger contig An02c040... 139 3e-32
AM920435_371(AM920435|pid:none) Penicillium chrysogenum Wisconsi... 138 9e-32
EU967864_1(EU967864|pid:none) Zea mays clone 306723 mov34/MPN/PA... 138 9e-32
AE014297_4785(AE014297|pid:none) Drosophila melanogaster chromos... 137 1e-31
AY075309_1(AY075309|pid:none) Drosophila melanogaster AT31826 fu... 137 1e-31
FB803760_1(FB803760|pid:none) Sequence 23033 from Patent WO20080... 137 1e-31
FB803752_1(FB803752|pid:none) Sequence 23025 from Patent WO20080... 137 2e-31
AK175458_1(AK175458|pid:none) Arabidopsis thaliana mRNA for hypo... 136 2e-31
FB803750_1(FB803750|pid:none) Sequence 23023 from Patent WO20080... 134 1e-30
(Q6TH47) RecName: Full=STAM-binding protein-like; EC=3.... 134 2e-30
AC073555_4(AC073555|pid:none) Arabidopsis thaliana chromosome 1 ... 132 5e-30
BC110110_1(BC110110|pid:none) Danio rerio zgc:123247, mRNA (cDNA... 128 9e-29
FN392320_1277(FN392320|pid:none) Pichia pastoris GS115 chromosom... 127 2e-28
(Q63ZM7) RecName: Full=STAM-binding protein-like; EC=3.... 126 3e-28
(Q5R558) RecName: Full=AMSH-like protease; Short=AMSH-L... 124 2e-27
AF164597_1(AF164597|pid:none) Lapemis hardwickii AMSH-like mRNA,... 124 2e-27
BT033261_1(BT033261|pid:none) Zea mays full-length cDNA clone ZM... 123 2e-27
AB172857_1(AB172857|pid:none) Macaca fascicularis brain cDNA clo... 123 2e-27
FN357399_16(FN357399|pid:none) Schistosoma mansoni genome sequen... 123 2e-27
AK220541_1(AK220541|pid:none) Mus musculus mRNA for mKIAA4198 pr... 123 3e-27
(Q96FJ0) RecName: Full=AMSH-like protease; Short=AMSH-L... 123 3e-27
(Q9CQ26) RecName: Full=STAM-binding protein; EC=3.1.2.1... 123 3e-27
AB037794_1(AB037794|pid:none) Homo sapiens mRNA for KIAA1373 pro... 123 3e-27
AK092946_1(AK092946|pid:none) Homo sapiens cDNA FLJ35627 fis, cl... 123 3e-27
AB385458_1(AB385458|pid:none) Synthetic construct DNA, clone: pF... 123 3e-27
CU633459_13(CU633459|pid:none) Podospora anserina genomic DNA ch... 122 5e-27
FN317712_1(FN317712|pid:none) Schistosoma japonicum isolate Anhu... 122 5e-27
BC074422_1(BC074422|pid:none) Xenopus laevis MGC84444 protein, m... 122 6e-27
AP008207_2047(AP008207|pid:none) Oryza sativa (japonica cultivar... 121 8e-27
BC018343_1(BC018343|pid:none) Mus musculus STAM binding protein ... 120 2e-26
BC158624_1(BC158624|pid:none) Rattus norvegicus similar to AMSH-... 120 2e-26
AP003284_6(AP003284|pid:none) Oryza sativa Japonica Group genomi... 119 4e-26
EF083826_1(EF083826|pid:none) Picea sitchensis clone WS0272_E08 ... 117 2e-25
AK317451_1(AK317451|pid:none) Arabidopsis thaliana AT1G10600 mRN... 113 2e-24
AY815756_1(AY815756|pid:none) Schistosoma japonicum SJCHGC04560 ... 107 1e-22
AP005838_26(AP005838|pid:none) Oryza sativa Japonica Group genom... 97 2e-19
FB803740_1(FB803740|pid:none) Sequence 23013 from Patent WO20080... 92 5e-18
CR382125_616(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 53 4e-06
CP000882_36(CP000882|pid:none) Hemiselmis andersenii chromosome ... 52 8e-06
FM992692_300(FM992692|pid:none) Candida dubliniensis CD36 chromo... 51 2e-05
(Q6FKS1) RecName: Full=26S proteasome regulatory subunit RPN11; ... 51 2e-05
AY152546_1(AY152546|pid:none) Saccharomyces cerevisiae 26S prote... 51 2e-05
CU928165_76(CU928165|pid:none) Kluyveromyces thermotolerans stra... 50 2e-05
(P41883) RecName: Full=Uncharacterized protein F37A4.5; &S44642... 50 2e-05
EU927390_1(EU927390|pid:none) Homo sapiens STAM binding protein ... 50 3e-05
FN392320_965(FN392320|pid:none) Pichia pastoris GS115 chromosome... 50 3e-05
(Q750E9) RecName: Full=26S proteasome regulatory subunit RPN11; ... 50 3e-05
AM484392_1(AM484392|pid:none) Vitis vinifera contig VV78X043448.... 50 3e-05
GN125683_1(GN125683|pid:none) Sequence 8579 from Patent WO200903... 50 3e-05
BT070585_1(BT070585|pid:none) Picea sitchensis clone WS02737_M03... 50 3e-05
AL590450_57(AL590450|pid:none) chromosome XI of strain GB-M1 of ... 50 4e-05
CU928175_405(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 50 4e-05
GN125707_1(GN125707|pid:none) Sequence 8603 from Patent WO200903... 49 7e-05
DQ440392_1(DQ440392|pid:none) Aedes aegypti clone AET-5254 26S p... 49 7e-05
AM260494_1(AM260494|pid:none) Platanus acerifolia partial mRNA f... 49 7e-05
(Q9LT08) RecName: Full=26S proteasome non-ATPase regulatory subu... 49 7e-05
(Q9V3H2) RecName: Full=26S proteasome non-ATPase regulatory subu... 49 7e-05
AJ010592_110(AJ010592|pid:none) Guillardia theta DNA for complet... 49 7e-05
AY086277_1(AY086277|pid:none) Arabidopsis thaliana clone 23276 m... 49 7e-05
AP007166_211(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 48 1e-04
AB037152_1(AB037152|pid:none) Oryza sativa Japonica Group OsRPN1... 48 1e-04
AF014466_1(AF014466|pid:none) Schistosoma mansoni trans-spliced ... 48 1e-04
AM270139_47(AM270139|pid:none) Aspergillus niger contig An07c022... 48 1e-04
AJ245813_1(AJ245813|pid:none) Aphrocallistes vastus mRNA for pot... 48 1e-04
AJ249917_1(AJ249917|pid:none) Aphrocallistes vastus mRNA for put... 48 1e-04
AC009299_2(AC009299|pid:none) Homo sapiens BAC clone RP11-26B22 ... 48 2e-04
AK150280_1(AK150280|pid:none) Mus musculus bone marrow macrophag... 48 2e-04
AJ720599_1(AJ720599|pid:none) Gallus gallus mRNA for hypothetica... 48 2e-04
BT082336_1(BT082336|pid:none) Anoplopoma fimbria clone afim-evh-... 48 2e-04
BC045094_1(BC045094|pid:none) Xenopus laevis 26S proteasome-asso... 48 2e-04
Y13071_1(Y13071|pid:none) Mus musculus mRNA for 26S proteasome n... 48 2e-04
BT080708_1(BT080708|pid:none) Caligus clemensi clone ccle-evs-50... 47 2e-04
FN314296_1(FN314296|pid:none) Schistosoma japonicum isolate Anhu... 47 2e-04
FN314297_1(FN314297|pid:none) Schistosoma japonicum isolate Anhu... 47 2e-04
D31731_1(D31731|pid:none) Schizosaccharomyces pombe pad1+ gene f... 47 3e-04
(O76577) RecName: Full=26S proteasome non-ATPase regulatory subu... 47 3e-04
CP000587_74(CP000587|pid:none) Ostreococcus lucimarinus CCE9901 ... 47 3e-04
CR954207_75(CR954207|pid:none) Ostreococcus tauri strain OTTH059... 47 3e-04
(O94454) RecName: Full=COP9 signalosome complex subunit 5; ... 47 3e-04
AM502234_88(AM502234|pid:none) Leishmania infantum chromosome 16. 46 6e-04
CP001574_389(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 45 0.001
CR940348_763(CR940348|pid:none) Theileria annulata strain Ankara... 44 0.002
FN357323_13(FN357323|pid:none) Schistosoma mansoni genome sequen... 44 0.002
BC098736_1(BC098736|pid:none) Rattus norvegicus COP9 constitutiv... 44 0.002
GN125685_1(GN125685|pid:none) Sequence 8581 from Patent WO200903... 44 0.002
EF191987_1(EF191987|pid:none) Taeniopygia guttata clone 0058P004... 44 0.002
AK133073_1(AK133073|pid:none) Mus musculus adult male testis cDN... 44 0.002
AJ719811_1(AJ719811|pid:none) Gallus gallus mRNA for hypothetica... 44 0.002
(Q6GLM9) RecName: Full=COP9 signalosome complex subunit 5; ... 44 0.002
AL844509_665(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 44 0.002
AY894067_1(AY894067|pid:none) Synthetic construct Homo sapiens c... 44 0.002
AB070063_1(AB070063|pid:none) Macaca fascicularis testis cDNA cl... 44 0.002
AM910993_24(AM910993|pid:none) Plasmodium knowlesi strain H chro... 44 0.002
(Q6BMQ3) RecName: Full=COP9 signalosome complex subunit 5; ... 44 0.002
(O35864) RecName: Full=COP9 signalosome complex subunit 5; ... 44 0.002
U70734_1(U70734|pid:none) Homo sapiens 38 kDa Mov34 homolog mRNA... 44 0.002
DQ214122_1(DQ214122|pid:none) Taeniopygia guttata clone 0058P002... 44 0.003
AF404119_1(AF404119|pid:none) Trypanosoma brucei proteasome regu... 44 0.003
S71820(S71820) JUN-activation-domain-binding protein 1 - human ... 44 0.003
CP001323_235(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 44 0.003
AB055495_1(AB055495|pid:none) Oryza sativa Jab1 mRNA for JUN-act... 43 0.004
GN125693_1(GN125693|pid:none) Sequence 8589 from Patent WO200903... 43 0.004
(Q5KAB0) RecName: Full=COP9 signalosome complex subunit 5; ... 43 0.004
(Q7RXX8) RecName: Full=COP9 signalosome complex subunit 5; ... 43 0.004
BX538352_11(BX538352|pid:none) Cryptosporidium parvum chromosome... 43 0.005
(Q12468) RecName: Full=COP9 signalosome complex subunit 5; ... 43 0.005
S67775(S67775;S67779) hypothetical protein YDL216c - yeast (Sacc... 43 0.005
(A6ZXB7) RecName: Full=COP9 signalosome complex subunit 5; ... 43 0.005
AM042543_1(AM042543|pid:none) Sordaria macrospora partial kbp ge... 43 0.005
GN125671_1(GN125671|pid:none) Sequence 8567 from Patent WO200903... 43 0.005
EF085453_1(EF085453|pid:none) Picea sitchensis clone WS02728_B20... 43 0.005
FM992691_304(FM992691|pid:none) Candida dubliniensis CD36 chromo... 42 0.006
BT040797_1(BT040797|pid:none) Zea mays full-length cDNA clone ZM... 42 0.006
AF195189_1(AF195189|pid:none) Drosophila melanogaster yippee int... 42 0.006
BT079931_1(BT079931|pid:none) Esox lucius clone eluc-evq-507-068... 42 0.008
AY087510_1(AY087510|pid:none) Arabidopsis thaliana clone 36216 m... 42 0.008
GN125687_1(GN125687|pid:none) Sequence 8583 from Patent WO200903... 42 0.008
GN125741_1(GN125741|pid:none) Sequence 8637 from Patent WO200903... 42 0.008
(Q8LAZ7) RecName: Full=COP9 signalosome complex subunit 5b; ... 42 0.008
AF087413_1(AF087413|pid:none) Arabidopsis thaliana AJH1 mRNA, co... 42 0.008
AK342713_1(AK342713|pid:none) Acyrthosiphon pisum ACYPI006786 mR... 42 0.011
AK160356_1(AK160356|pid:none) Mus musculus 0 day neonate eyeball... 42 0.011
AM494957_58(AM494957|pid:none) Leishmania braziliensis chromosom... 42 0.011
GN125695_1(GN125695|pid:none) Sequence 8591 from Patent WO200903... 42 0.011
AF087412_1(AF087412|pid:none) Arabidopsis thaliana AJH2 mRNA, co... 42 0.011
GN125675_1(GN125675|pid:none) Sequence 8571 from Patent WO200903... 42 0.011
GN125677_1(GN125677|pid:none) Sequence 8573 from Patent WO200903... 42 0.011
AC140026_24(AC140026|pid:none) Medicago truncatula clone mth2-36... 42 0.011
FJ602773_1(FJ602773|pid:none) Bombyx mori JAB-MPN domain protein... 42 0.011
BT051794_1(BT051794|pid:none) Medicago truncatula clone MTYF5_F6... 42 0.011
(P91001) RecName: Full=COP9 signalosome complex subunit 5; ... 41 0.014
GN125699_1(GN125699|pid:none) Sequence 8595 from Patent WO200903... 41 0.014
AF175964_1(AF175964|pid:none) Lycopersicon esculentum JAB mRNA, ... 41 0.019
AY232223_1(AY232223|pid:none) Drosophila yakuba clone yak-ad_CSN... 40 0.024
GN125705_1(GN125705|pid:none) Sequence 8601 from Patent WO200903... 40 0.024
(Q6C703) RecName: Full=COP9 signalosome complex subunit 5; ... 40 0.024
AY909453_1(AY909453|pid:none) Siniperca chuatsi clone C325 26S p... 40 0.024
(Q8T295) RecName: Full=Pre-mRNA-processing-splicing factor 8 hom... 40 0.024
EU020524_1(EU020524|pid:none) Nebalia hessleri clone Nhe2f7 puta... 40 0.032
EU020519_1(EU020519|pid:none) Lithobius forticatus clone Lfo2f7 ... 40 0.032
(Q59PG6) RecName: Full=COP9 signalosome complex subunit 5; ... 40 0.032
AF129083_1(AF129083|pid:none) Drosophila melanogaster COP9 signa... 39 0.070
AE013599_1462(AE013599|pid:none) Drosophila melanogaster chromos... 39 0.070
EU020528_1(EU020528|pid:none) Triops longicaudatus clone Tlo2f7 ... 38 0.16
CU633900_411(CU633900|pid:none) Podospora anserina genomic DNA c... 38 0.16
(Q6CRJ8) RecName: Full=COP9 signalosome complex subunit 5; ... 37 0.20
EU020523_1(EU020523|pid:none) Narceus americanus clone Nam2f7 pu... 37 0.20
CP000498_315(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 37 0.20
BC101893_1(BC101893|pid:none) Rattus norvegicus MPN domain conta... 37 0.20
AK099780_1(AK099780|pid:none) Oryza sativa Japonica Group cDNA c... 37 0.27
AB023482_13(AB023482|pid:none) Oryza sativa Japonica Group genom... 37 0.27
EU020522_1(EU020522|pid:none) Mastigoproctus giganteus clone Mga... 37 0.27
GN125697_1(GN125697|pid:none) Sequence 8593 from Patent WO200903... 37 0.27
AC007292_1(AC007292|pid:none) Homo sapiens chromosome 19, cosmid... 37 0.27
AP007162_206(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 37 0.35
(Q8N594) RecName: Full=MPN domain-containing protein; E... 37 0.35
(Q9VKJ1) RecName: Full=MPN domain-containing protein CG4751; ... 37 0.35
AM920436_177(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 37 0.35
AM270349_23(AM270349|pid:none) Aspergillus niger contig An15c022... 36 0.46
EU020520_1(EU020520|pid:none) Limulus polyphemus clone Lpo2f7 pu... 36 0.60
EU020525_1(EU020525|pid:none) Cypridopsis vidua clone Ost2f7 put... 36 0.60
EU020521_1(EU020521|pid:none) Mesocyclops edax clone Meso2f7 put... 35 0.78
AC153129_15(AC153129|pid:none) Medicago truncatula clone mth2-10... 35 0.78
BC099197_1(BC099197|pid:none) Rattus norvegicus PRP8 pre-mRNA pr... 35 0.78
BC136148_1(BC136148|pid:none) Xenopus tropicalis hypothetical pr... 35 0.78
BC034648_1(BC034648|pid:none) Mus musculus pre-mRNA processing f... 35 0.78
AL591496_12(AL591496|pid:none) Mouse DNA sequence from clone RP2... 35 0.78
(Q99PV0) RecName: Full=Pre-mRNA-processing-splicing factor 8; Al... 35 0.78
AK167984_1(AK167984|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 35 0.78
CP000591_23(CP000591|pid:none) Ostreococcus lucimarinus CCE9901 ... 35 1.0
BC045266_1(BC045266|pid:none) Xenopus laevis pre-mRNA processing... 35 1.0
BC064370_1(BC064370|pid:none) Homo sapiens PRP8 pre-mRNA process... 35 1.3
AB174670_1(AB174670|pid:none) Macaca fascicularis brain cDNA clo... 35 1.3
AK296344_1(AK296344|pid:none) Homo sapiens cDNA FLJ57882 complet... 35 1.3
AB007510_1(AB007510|pid:none) Homo sapiens mRNA for PRP8 protein... 35 1.3
EU020526_1(EU020526|pid:none) Speleonectes tulumensis clone Stu2... 35 1.3
BT068129_1(BT068129|pid:none) Zea mays full-length cDNA clone ZM... 34 1.7
AM425853_2(AM425853|pid:none) Vitis vinifera contig VV78X191886.... 34 2.3
CU928180_25(CU928180|pid:none) Kluyveromyces thermotolerans stra... 34 2.3
(O14187) RecName: Full=Pre-mRNA-splicing factor spp42; AltName: ... 34 2.3
BT072223_1(BT072223|pid:none) Salmo salar clone ssal-rgf-517-199... 33 3.0
BT035512_1(BT035512|pid:none) Zea mays full-length cDNA clone ZM... 33 3.9
(P34369) RecName: Full=Pre-mRNA-splicing factor 8 homolog; &L14... 33 3.9
AK299194_1(AK299194|pid:none) Homo sapiens cDNA FLJ60049 complet... 33 5.0
AK011876_1(AK011876|pid:none) Mus musculus 10 days embryo whole ... 33 5.0
(B0KWU8) RecName: Full=Lys-63-specific deubiquitinase BRCC36; ... 33 5.0
CS300821_1(CS300821|pid:none) Sequence 329 from Patent EP1661986... 33 5.0
(B2RYM5) RecName: Full=Lys-63-specific deubiquitinase BRCC36; ... 33 5.0
(Q5R9L6) RecName: Full=Lys-63-specific deubiquitinase BRCC36; ... 33 5.0
AK298886_1(AK298886|pid:none) Homo sapiens cDNA FLJ60802 complet... 33 5.0
AL671860_6(AL671860|pid:none) Mouse DNA sequence from clone RP23... 33 5.0
(B5X8M4) RecName: Full=Lys-63-specific deubiquitinase BRCC36; ... 33 5.0
EF583984_7(EF583984|pid:none) Uncultured haloarchaeon clone fosm... 33 5.0
BT021737_1(BT021737|pid:none) Bos taurus chromosome X open readi... 33 5.0
BX293995_3(BX293995|pid:none) Human DNA sequence from clone RP11... 33 5.0
AC023912_4(AC023912|pid:none) Arabidopsis thaliana chromosome II... 32 8.6
FN392321_1108(FN392321|pid:none) Pichia pastoris GS115 chromosom... 32 8.6

>AF018638_1(AF018638|pid:none) Dictyostelium discoideum unknown
(1039) gene, partial cds.
Length = 445

Score = 297 bits (761), Expect = 8e-80
Identities = 140/140 (100%), Positives = 140/140 (100%)
Frame = +1

Query: 1 VFRITTIIIPKQEGTTDTCNTIEEHEIFEYQLENDLLTLGWIHTHPTQDCFLSAVDVHTH 180
VFRITTIIIPKQEGTTDTCNTIEEHEIFEYQLENDLLTLGWIHTHPTQDCFLSAVDVHTH
Sbjct: 303 VFRITTIIIPKQEGTTDTCNTIEEHEIFEYQLENDLLTLGWIHTHPTQDCFLSAVDVHTH 362

Query: 181 CSYQYLLQEAIAVVISPMANPNFGIFRLTDPPGLETVQKCKLKSFHPHPPVNGIPIYTKV 360
CSYQYLLQEAIAVVISPMANPNFGIFRLTDPPGLETVQKCKLKSFHPHPPVNGIPIYTKV
Sbjct: 363 CSYQYLLQEAIAVVISPMANPNFGIFRLTDPPGLETVQKCKLKSFHPHPPVNGIPIYTKV 422

Query: 361 DHVDLIWGKKSDSKVVDLRF 420
DHVDLIWGKKSDSKVVDLRF
Sbjct: 423 DHVDLIWGKKSDSKVVDLRF 442

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3268448
Number of Hits to DB: 840,627,357
Number of extensions: 17611926
Number of successful extensions: 47400
Number of sequences better than 10.0: 204
Number of HSP's gapped: 47351
Number of HSP's successfully gapped: 204
Length of query: 167
Length of database: 1,061,185,681
Length adjustment: 119
Effective length of query: 48
Effective length of database: 672,240,369
Effective search space: 32267537712
Effective search space used: 32267537712
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

PSORT

psg: 0.60 gvh: 0.53 alm: 0.39 top: 0.53 tms: 0.00 mit: 0.27 mip: 0.02
nuc: 0.00 erl: 0.00 erm: 0.40 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

48.0 %: cytoplasmic
20.0 %: mitochondrial
20.0 %: nuclear
4.0 %: cytoskeletal
4.0 %: peroxisomal
4.0 %: endoplasmic reticulum

>> prediction for Contig-U04026-1 is cyt

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 1
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0