VSJ788 | |
Library | VS (Link to library) |
Clone ID | VSJ788 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16504-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ7-D/VSJ788Q.Seq.d/ |
Representative seq. ID | VSJ788P (Link to Original site) |
Representative DNA sequence | >VSJ788 (VSJ788Q) /CSM/VS/VSJ7-D/VSJ788Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | ffikkewkk*KKLLKKKNKEKXXLNDYKIISEGNNIKVLQKKDFKPKFSLVSYKNYEQNF |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 7.27 |
Homology vs Protein |
|
protein update | 2009. 3.25 |
PSORT |
|
5' end seq. ID | VSJ788F |
5' end seq. | >VSJ788F.Seq |
Length of 5' end seq. | 413 |
3' end seq. ID | VSJ788Z |
3' end seq. | >VSJ788Z.Seq |
Length of 3' end seq. | 571 |
Connected seq. ID | VSJ788P |
Connected seq. | >VSJ788P.Seq |
Length of connected seq. | 984 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |