VSJ470 | |
Library | VS (Link to library) |
Clone ID | VSJ470 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U01513-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ4-C/VSJ470Q.Seq.d/ |
Representative seq. ID | VSJ470P (Link to Original site) |
Representative DNA sequence | >VSJ470 (VSJ470Q) /CSM/VS/VSJ4-C/VSJ470Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | rvrkykynfylfrlssqqksnnndsddsdddnek*r***qyy*ssriilysm*rslf*ky |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 7.19 |
Homology vs Protein |
|
protein update | 2009. 3.25 |
PSORT |
|
5' end seq. ID | VSJ470F |
5' end seq. | >VSJ470F.Seq |
Length of 5' end seq. | 512 |
3' end seq. ID | VSJ470Z |
3' end seq. | >VSJ470Z.Seq |
Length of 3' end seq. | 486 |
Connected seq. ID | VSJ470P |
Connected seq. | >VSJ470P.Seq |
Length of connected seq. | 998 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |