VSJ377 | |
Library | VS (Link to library) |
Clone ID | VSJ377 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G23946 |
dictyBase ID | DDB0186910 |
Link to Contig | Contig-U14907-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ3-D/VSJ377Q.Seq.d/ |
Representative seq. ID | VSJ377P (Link to Original site) |
Representative DNA sequence | >VSJ377 (VSJ377Q) /CSM/VS/VSJ3-D/VSJ377Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | *xtmvyqsllnalikllplpsnqlifqhlsfkllqshhhslvnnikviylnqikmvqpql |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.10 |
Homology vs DNA |
|
dna update | 2003. 7.19 |
Homology vs Protein |
|
protein update | 2009. 3.25 |
PSORT |
|
5' end seq. ID | VSJ377F |
5' end seq. | >VSJ377F.Seq |
Length of 5' end seq. | 424 |
3' end seq. ID | VSJ377Z |
3' end seq. | >VSJ377Z.Seq |
Length of 3' end seq. | 342 |
Connected seq. ID | VSJ377P |
Connected seq. | >VSJ377P.Seq |
Length of connected seq. | 766 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |