VSJ241 | |
Library | VS (Link to library) |
Clone ID | VSJ241 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G01047 |
dictyBase ID | DDB0167807 |
Link to Contig | Contig-U02292-1|Contig-U16528-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ2-B/VSJ241Q.Seq.d/ |
Representative seq. ID | VSJ241P (Link to Original site) |
Representative DNA sequence | >VSJ241 (VSJ241Q) /CSM/VS/VSJ2-B/VSJ241Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | kivivnydnnifwtlvnqtirnifyyriifcig*fetctsrsrismskknctks*rfnkr |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004.12.25 |
Homology vs DNA |
|
dna update | 2003. 7.18 |
Homology vs Protein |
|
protein update | 2009. 3.25 |
PSORT |
|
5' end seq. ID | VSJ241F |
5' end seq. | >VSJ241F.Seq |
Length of 5' end seq. | 591 |
3' end seq. ID | VSJ241Z |
3' end seq. | >VSJ241Z.Seq |
Length of 3' end seq. | 159 |
Connected seq. ID | VSJ241P |
Connected seq. | >VSJ241P.Seq |
Length of connected seq. | 750 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |