VSJ206 | |
Library | VS (Link to library) |
Clone ID | VSJ206 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16485-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ2-A/VSJ206Q.Seq.d/ |
Representative seq. ID | VSJ206E (Link to Original site) |
Representative DNA sequence | >VSJ206 (VSJ206Q) /CSM/VS/VSJ2-A/VSJ206Q.Seq.d/ |
sequence update | 2001. 3.26 |
Translated Amino Acid sequence | xdnlnkkrk*vvll*l*IENGPAILGALKTGAGLIRSFFPDKTKDLQDVTYRVYEDEQPK |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.10 |
Homology vs DNA |
|
dna update | 2003. 7.18 |
Homology vs Protein |
|
protein update | 2009. 3.25 |
PSORT |
|
5' end seq. ID | VSJ206F |
5' end seq. | >VSJ206F.Seq |
Length of 5' end seq. | 483 |
3' end seq. ID | VSJ206Z |
3' end seq. | >VSJ206Z.Seq |
Length of 3' end seq. | 610 |
Connected seq. ID | VSJ206P |
Connected seq. | >VSJ206P.Seq |
Length of connected seq. | 1093 |
Full length Seq ID | VSJ206E |
Full length Seq. | >VSJ206E.Seq |
Length of full length seq. | 611 |