VSJ171 | |
Library | VS (Link to library) |
Clone ID | VSJ171 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U06368-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSJ1-C/VSJ171Q.Seq.d/ |
Representative seq. ID | VSJ171P (Link to Original site) |
Representative DNA sequence | >VSJ171 (VSJ171Q) /CSM/VS/VSJ1-C/VSJ171Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | kk*inkkwknkmislgplkmvilqmlknqlkpkki*fqllmvikevhaiglliliklkf* |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.11.21 |
Homology vs DNA |
|
dna update | 2003. 7.17 |
Homology vs Protein |
|
protein update | 2009. 3.25 |
PSORT |
|
5' end seq. ID | VSJ171F |
5' end seq. | >VSJ171F.Seq |
Length of 5' end seq. | 447 |
3' end seq. ID | VSJ171Z |
3' end seq. | >VSJ171Z.Seq |
Length of 3' end seq. | 427 |
Connected seq. ID | VSJ171P |
Connected seq. | >VSJ171P.Seq |
Length of connected seq. | 874 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |