VSI588 | |
Library | VS (Link to library) |
Clone ID | VSI588 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U06953-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI5-D/VSI588Q.Seq.d/ |
Representative seq. ID | VSI588F (Link to Original site) |
Representative DNA sequence | >VSI588 (VSI588Q) /CSM/VS/VSI5-D/VSI588Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | il*MLSFYPKNVITGSLIRPGPTIFPAGSNSGGKPTPAISIKQTFKI*in*keennslis |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2004. 8. 6 |
Homology vs DNA |
|
dna update | 2009. 7.24 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSI588F |
5' end seq. | >VSI588F.Seq |
Length of 5' end seq. | 195 |
3' end seq. ID | - |
3' end seq. | - |
Length of 3' end seq. | - |
Connected seq. ID | - |
Connected seq. | - |
Length of connected seq. | - |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |