VSI532 | |
Library | VS (Link to library) |
Clone ID | VSI532 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15504-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI5-B/VSI532Q.Seq.d/ |
Representative seq. ID | VSI532E (Link to Original site) |
Representative DNA sequence | >VSI532 (VSI532Q) /CSM/VS/VSI5-B/VSI532Q.Seq.d/ |
sequence update | 2001. 3.26 |
Translated Amino Acid sequence | HIHRKSYHRMRVFKDIVGYSHDELCSDAYPMTEINNGLIYEVQAKMVTIDLDVKVNTGAN |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2003. 1.10 |
Homology vs DNA |
|
dna update | 2009. 7.23 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSI532F |
5' end seq. | >VSI532F.Seq |
Length of 5' end seq. | 488 |
3' end seq. ID | VSI532Z |
3' end seq. | >VSI532Z.Seq |
Length of 3' end seq. | 292 |
Connected seq. ID | VSI532P |
Connected seq. | >VSI532P.Seq |
Length of connected seq. | 780 |
Full length Seq ID | VSI532E |
Full length Seq. | >VSI532E.Seq |
Length of full length seq. | 580 |