VSI254 | |
Library | VS (Link to library) |
Clone ID | VSI254 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | G01030 |
dictyBase ID | DDB0191264 |
Link to Contig | Contig-U06506-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI2-C/VSI254Q.Seq.d/ |
Representative seq. ID | VSI254E (Link to Original site) |
Representative DNA sequence | >VSI254 (VSI254Q) /CSM/VS/VSI2-C/VSI254Q.Seq.d/ |
sequence update | 2001. 3.25 |
Translated Amino Acid sequence | niyi*QYKMSSVGSGYDLYVSTYSPDGKLFQVDYANKAVENSGTLVAIKAKDGVVLGVEK |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2002. 7.12 |
Homology vs DNA |
|
dna update | 2009. 7. 6 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSI254F |
5' end seq. | >VSI254F.Seq |
Length of 5' end seq. | 596 |
3' end seq. ID | VSI254Z |
3' end seq. | >VSI254Z.Seq |
Length of 3' end seq. | 609 |
Connected seq. ID | VSI254P |
Connected seq. | >VSI254P.Seq |
Length of connected seq. | 1205 |
Full length Seq ID | VSI254E |
Full length Seq. | >VSI254E.Seq |
Length of full length seq. | 766 |