VSI221 | |
Library | VS (Link to library) |
Clone ID | VSI221 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U10168-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI2-A/VSI221Q.Seq.d/ |
Representative seq. ID | VSI221P (Link to Original site) |
Representative DNA sequence | >VSI221 (VSI221Q) /CSM/VS/VSI2-A/VSI221Q.Seq.d/ |
sequence update | 2001. 3.22 |
Translated Amino Acid sequence | lssqnvsktn*tscchqscssqhhhyhhqsmshhhqelkhqhllynf*lkngiysksmif |
Translated Amino Acid sequence (All Frames) | Frame A: |
Homology vs CSM-cDNA |
|
own update | 2001.11.29 |
Homology vs DNA |
|
dna update | 2009. 7. 5 |
Homology vs Protein |
|
protein update | 2009. 3.24 |
PSORT |
|
5' end seq. ID | VSI221F |
5' end seq. | >VSI221F.Seq |
Length of 5' end seq. | 353 |
3' end seq. ID | VSI221Z |
3' end seq. | >VSI221Z.Seq |
Length of 3' end seq. | 331 |
Connected seq. ID | VSI221P |
Connected seq. | >VSI221P.Seq |
Length of connected seq. | 684 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |